Metagenome Family F075387

Basic Information
Family ID	F075387
Family Type	Metagenome
Number of Sequences	119
Average Sequence Length	42 residues
Representative Sequence	MGVWKRARVFNWELMFWISSLILAFMAVGALLAYQSFMRAR
Number of Associated Samples	96
Number of Associated Scaffolds	119

Quality Assessment
Transcriptomic Evidence	No
Most common taxonomic group	Bacteria
% of genes with valid RBS motifs	86.55 %
% of genes near scaffold ends (potentially truncated)	21.85 %
% of genes from short scaffolds (< 2000 bps)	72.27 %
Associated GOLD sequencing projects	84
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.53

Most Common Taxonomy
Group	Bacteria (56.303 % of family members)
NCBI Taxonomy ID	2
Taxonomy	All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (14.286 % of family members)
Environment Ontology (ENVO)	Unclassified (39.496 % of family members)
Earth Microbiome Project Ontology (EMPO)	Host-associated → Plant → Plant rhizosphere (51.261 % of family members)

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Predicted Topology & Secondary Structure
Classification:	Transmembrane (alpha-helical)	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 55.07% β-sheet: 0.00% Coil/Unstructured: 44.93%
Feature Viewer

Powered by Feature Viewer

Pfam ID	Name	% Frequency in 119 Family Scaffolds
PF14378	PAP2_3	2.52
PF04357	TamB	1.68
PF07650	KH_2	1.68
PF07238	PilZ	1.68
PF04952	AstE_AspA	1.68
PF04679	DNA_ligase_A_C	1.68
PF00069	Pkinase	1.68
PF00072	Response_reg	0.84
PF14805	THDPS_N_2	0.84
PF02627	CMD	0.84
PF01145	Band_7	0.84
PF05016	ParE_toxin	0.84
PF13276	HTH_21	0.84
PF03705	CheR_N	0.84
PF13578	Methyltransf_24	0.84
PF00155	Aminotran_1_2	0.84
PF14659	Phage_int_SAM_3	0.84
PF00535	Glycos_transf_2	0.84
PF13620	CarboxypepD_reg	0.84
PF00589	Phage_integrase	0.84
PF01850	PIN	0.84
PF00248	Aldo_ket_red	0.84
PF13414	TPR_11	0.84
PF13175	AAA_15	0.84
PF00871	Acetate_kinase	0.84
PF12704	MacB_PCD	0.84
PF00551	Formyl_trans_N	0.84
PF07883	Cupin_2	0.84
PF08240	ADH_N	0.84
PF07593	UnbV_ASPIC	0.84
PF01047	MarR	0.84
PF12710	HAD	0.84
PF12867	DinB_2	0.84
PF03466	LysR_substrate	0.84

COG ID	Name	Functional Category	% Frequency in 119 Family Scaffolds
COG0515	Serine/threonine protein kinase	Signal transduction mechanisms [T]	6.72
COG1352	Methylase of chemotaxis methyl-accepting proteins	Signal transduction mechanisms [T]	1.68
COG1793	ATP-dependent DNA ligase	Replication, recombination and repair [L]	1.68
COG2911	Phospholipid transport to the outer membrane protein TamB	Cell wall/membrane/envelope biogenesis [M]	1.68
COG0282	Acetate kinase	Energy production and conversion [C]	0.84
COG0599	Uncharacterized conserved protein YurZ, alkylhydroperoxidase/carboxymuconolactone decarboxylase family	General function prediction only [R]	0.84
COG2128	Alkylhydroperoxidase family enzyme, contains CxxC motif	Inorganic ion transport and metabolism [P]	0.84
COG3426	Butyrate kinase	Energy production and conversion [C]	0.84

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	56.30 %
Unclassified	root	N/A	43.70 %

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	56.30 %
Unclassified	root	N/A	43.70 %

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	56.30 %
Unclassified	root	N/A	43.70 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	43.70 %
Acidobacteria	phylum	All Organisms → cellular organisms → Bacteria → Acidobacteria	35.29 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	43.70 %
unclassified Acidobacteria	no rank	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria	12.61 %
Acidobacteriia	class	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia	5.88 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	43.70 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	12.61 %
Acidobacteriales	order	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales	5.04 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	43.70 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	12.61 %
Acidobacteriaceae	family	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	5.04 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
2088090014\|GPIPI_16894253	All Organisms → cellular organisms → Bacteria → Acidobacteria	3777	Open in IMG/M
2088090014\|GPIPI_16939934	All Organisms → cellular organisms → Bacteria	1634	Open in IMG/M
2088090014\|GPIPI_16993339	All Organisms → cellular organisms → Bacteria → Acidobacteria	32969	Open in IMG/M
2088090014\|GPIPI_17370766	Not Available	1494	Open in IMG/M
3300000364\|INPhiseqgaiiFebDRAFT_101495840	Not Available	1198	Open in IMG/M
3300000364\|INPhiseqgaiiFebDRAFT_101939631	All Organisms → cellular organisms → Bacteria → Acidobacteria	1863	Open in IMG/M
3300000559\|F14TC_100040558	All Organisms → cellular organisms → Bacteria	3740	Open in IMG/M
3300000955\|JGI1027J12803_100107147	All Organisms → cellular organisms → Bacteria → Acidobacteria	7610	Open in IMG/M
3300001431\|F14TB_104129872	All Organisms → cellular organisms → Bacteria	2369	Open in IMG/M
3300004156\|Ga0062589_100160841	All Organisms → cellular organisms → Bacteria → Acidobacteria	1558	Open in IMG/M
3300004479\|Ga0062595_101467465	Not Available	626	Open in IMG/M
3300004479\|Ga0062595_101688109	Not Available	595	Open in IMG/M
3300004633\|Ga0066395_10003424	All Organisms → cellular organisms → Bacteria	5491	Open in IMG/M
3300005330\|Ga0070690_101677320	All Organisms → cellular organisms → Bacteria → Acidobacteria	516	Open in IMG/M
3300005332\|Ga0066388_100090393	All Organisms → cellular organisms → Bacteria	3482	Open in IMG/M
3300005332\|Ga0066388_100162569	All Organisms → cellular organisms → Bacteria	2824	Open in IMG/M
3300005332\|Ga0066388_100391843	All Organisms → cellular organisms → Bacteria → Acidobacteria	2035	Open in IMG/M
3300005332\|Ga0066388_101251811	All Organisms → cellular organisms → Bacteria	1274	Open in IMG/M
3300005332\|Ga0066388_101864658	Not Available	1072	Open in IMG/M
3300005367\|Ga0070667_101000144	All Organisms → cellular organisms → Bacteria	780	Open in IMG/M
3300005440\|Ga0070705_101122643	Not Available	644	Open in IMG/M
3300005466\|Ga0070685_10094157	Not Available	1819	Open in IMG/M
3300005467\|Ga0070706_100116423	All Organisms → cellular organisms → Bacteria → Acidobacteria	2489	Open in IMG/M
3300005468\|Ga0070707_100025474	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	5611	Open in IMG/M
3300005518\|Ga0070699_100249003	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1587	Open in IMG/M
3300005526\|Ga0073909_10010020	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	2865	Open in IMG/M
3300005526\|Ga0073909_10413288	Not Available	638	Open in IMG/M
3300005539\|Ga0068853_100199586	Not Available	1820	Open in IMG/M
3300005548\|Ga0070665_100050900	All Organisms → cellular organisms → Bacteria	4156	Open in IMG/M
3300005548\|Ga0070665_100180564	Not Available	2111	Open in IMG/M
3300005548\|Ga0070665_102236286	Not Available	550	Open in IMG/M
3300005552\|Ga0066701_10304378	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	988	Open in IMG/M
3300005559\|Ga0066700_10044879	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	2683	Open in IMG/M
3300005586\|Ga0066691_10773837	Not Available	566	Open in IMG/M
3300005764\|Ga0066903_100522836	All Organisms → cellular organisms → Bacteria	2021	Open in IMG/M
3300005764\|Ga0066903_103270116	Not Available	876	Open in IMG/M
3300005842\|Ga0068858_102434141	Not Available	517	Open in IMG/M
3300005843\|Ga0068860_100899461	Not Available	901	Open in IMG/M
3300006031\|Ga0066651_10483153	Not Available	656	Open in IMG/M
3300006163\|Ga0070715_10070224	Not Available	1563	Open in IMG/M
3300006173\|Ga0070716_100131451	Not Available	1583	Open in IMG/M
3300006175\|Ga0070712_100842771	Not Available	788	Open in IMG/M
3300006175\|Ga0070712_100888337	Not Available	768	Open in IMG/M
3300006237\|Ga0097621_100023513	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	4799	Open in IMG/M
3300006854\|Ga0075425_100028697	All Organisms → cellular organisms → Bacteria → Acidobacteria	6158	Open in IMG/M
3300006854\|Ga0075425_100699357	Not Available	1164	Open in IMG/M
3300006854\|Ga0075425_101686748	All Organisms → cellular organisms → Bacteria	713	Open in IMG/M
3300006871\|Ga0075434_100213692	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1949	Open in IMG/M
3300006914\|Ga0075436_101299794	Not Available	550	Open in IMG/M
3300007076\|Ga0075435_101099152	Not Available	695	Open in IMG/M
3300009038\|Ga0099829_10017047	All Organisms → cellular organisms → Bacteria → Acidobacteria	4895	Open in IMG/M
3300009038\|Ga0099829_10211925	All Organisms → cellular organisms → Bacteria	1571	Open in IMG/M
3300009101\|Ga0105247_10258957	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1192	Open in IMG/M
3300009792\|Ga0126374_10091829	All Organisms → cellular organisms → Bacteria	1695	Open in IMG/M
3300010043\|Ga0126380_11595424	Not Available	582	Open in IMG/M
3300010046\|Ga0126384_10969788	Not Available	772	Open in IMG/M
3300010047\|Ga0126382_10339730	All Organisms → cellular organisms → Bacteria → Acidobacteria	1145	Open in IMG/M
3300010358\|Ga0126370_11326372	Not Available	676	Open in IMG/M
3300010359\|Ga0126376_10794686	Not Available	923	Open in IMG/M
3300010362\|Ga0126377_13359330	Not Available	517	Open in IMG/M
3300010366\|Ga0126379_10521196	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	1264	Open in IMG/M
3300010400\|Ga0134122_11061022	All Organisms → cellular organisms → Bacteria → Acidobacteria	799	Open in IMG/M
3300011270\|Ga0137391_10881600	All Organisms → cellular organisms → Bacteria → Acidobacteria	733	Open in IMG/M
3300011271\|Ga0137393_10231570	All Organisms → cellular organisms → Bacteria → Acidobacteria	1565	Open in IMG/M
3300012202\|Ga0137363_10913297	Not Available	745	Open in IMG/M
3300012205\|Ga0137362_10063376	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	3044	Open in IMG/M
3300012205\|Ga0137362_10627494	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	926	Open in IMG/M
3300012209\|Ga0137379_10861173	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	811	Open in IMG/M
3300012361\|Ga0137360_10305561	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1321	Open in IMG/M
3300012683\|Ga0137398_10786065	Not Available	664	Open in IMG/M
3300012903\|Ga0157289_10145205	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	727	Open in IMG/M
3300012929\|Ga0137404_10338018	All Organisms → cellular organisms → Bacteria	1315	Open in IMG/M
3300012960\|Ga0164301_10794985	Not Available	723	Open in IMG/M
3300012971\|Ga0126369_10436408	Not Available	1355	Open in IMG/M
3300013306\|Ga0163162_10535161	Not Available	1300	Open in IMG/M
3300013308\|Ga0157375_10362717	All Organisms → cellular organisms → Bacteria	1615	Open in IMG/M
3300015241\|Ga0137418_10382955	All Organisms → cellular organisms → Bacteria → Acidobacteria	1152	Open in IMG/M
3300015371\|Ga0132258_10015633	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	16259	Open in IMG/M
3300015371\|Ga0132258_12986795	Not Available	1173	Open in IMG/M
3300015373\|Ga0132257_101694619	Not Available	810	Open in IMG/M
3300015374\|Ga0132255_102728802	Not Available	755	Open in IMG/M
3300016404\|Ga0182037_11684824	Not Available	565	Open in IMG/M
3300019886\|Ga0193727_1137754	Not Available	679	Open in IMG/M
3300019887\|Ga0193729_1023320	Not Available	2666	Open in IMG/M
3300020199\|Ga0179592_10425996	Not Available	576	Open in IMG/M
3300022557\|Ga0212123_10002010	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia	51640	Open in IMG/M
3300024181\|Ga0247693_1046723	All Organisms → cellular organisms → Bacteria → Acidobacteria	621	Open in IMG/M
3300024331\|Ga0247668_1087731	Not Available	629	Open in IMG/M
3300025910\|Ga0207684_10020680	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	5623	Open in IMG/M
3300025910\|Ga0207684_10143548	All Organisms → cellular organisms → Bacteria	2053	Open in IMG/M
3300025914\|Ga0207671_10849868	Not Available	723	Open in IMG/M
3300025915\|Ga0207693_10670936	Not Available	804	Open in IMG/M
3300025922\|Ga0207646_11103106	All Organisms → cellular organisms → Bacteria	698	Open in IMG/M
3300025936\|Ga0207670_10388883	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1113	Open in IMG/M
3300025942\|Ga0207689_11599695	Not Available	542	Open in IMG/M
3300025961\|Ga0207712_10341219	Not Available	1242	Open in IMG/M
3300026088\|Ga0207641_10580494	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1096	Open in IMG/M
3300026089\|Ga0207648_10440738	Not Available	1185	Open in IMG/M
3300026324\|Ga0209470_1156984	All Organisms → cellular organisms → Bacteria	996	Open in IMG/M
3300026490\|Ga0257153_1033492	All Organisms → cellular organisms → Bacteria	1060	Open in IMG/M
3300026490\|Ga0257153_1085810	All Organisms → cellular organisms → Bacteria	630	Open in IMG/M
3300026514\|Ga0257168_1016049	All Organisms → cellular organisms → Bacteria	1500	Open in IMG/M
3300026557\|Ga0179587_10024345	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	3299	Open in IMG/M
3300027846\|Ga0209180_10013810	All Organisms → cellular organisms → Bacteria	4213	Open in IMG/M
3300027862\|Ga0209701_10030136	All Organisms → cellular organisms → Bacteria	3525	Open in IMG/M
3300027874\|Ga0209465_10049124	Not Available	2016	Open in IMG/M
3300027903\|Ga0209488_10885440	Not Available	627	Open in IMG/M
3300028379\|Ga0268266_10092981	All Organisms → cellular organisms → Bacteria → Acidobacteria	2646	Open in IMG/M
3300028379\|Ga0268266_10127286	Not Available	2274	Open in IMG/M
3300028381\|Ga0268264_10061925	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	3140	Open in IMG/M
3300031231\|Ga0170824_104862693	All Organisms → cellular organisms → Bacteria	620	Open in IMG/M
3300031231\|Ga0170824_111847694	All Organisms → cellular organisms → Bacteria	1259	Open in IMG/M
3300031474\|Ga0170818_106721865	Not Available	557	Open in IMG/M
3300031561\|Ga0318528_10121296	All Organisms → cellular organisms → Bacteria → Acidobacteria	1382	Open in IMG/M
3300031720\|Ga0307469_11490646	Not Available	647	Open in IMG/M
3300031879\|Ga0306919_11053043	All Organisms → cellular organisms → Bacteria → Acidobacteria	621	Open in IMG/M
3300031946\|Ga0310910_10169779	All Organisms → cellular organisms → Bacteria → Acidobacteria	1679	Open in IMG/M
3300031959\|Ga0318530_10183563	Not Available	856	Open in IMG/M
3300032180\|Ga0307471_100190321	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	2038	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	75.63%
Host-Associated	Host-Associated	24.37%

Habitat	Taxonomy	Distribution
Terrestrial	Environmental → Terrestrial	74.79%
Plants	Host-Associated → Plants	24.37%
Aquatic	Environmental → Aquatic	0.84%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	74.79%
Rhizosphere	Host-Associated → Plants → Rhizosphere	13.45%
Rhizoplane	Host-Associated → Plants → Rhizoplane	10.08%
Thermal Springs	Environmental → Aquatic → Thermal Springs	0.84%
Roots	Host-Associated → Plants → Roots	0.84%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	52.94%
Loam	Environmental → Terrestrial → Soil → Loam	21.85%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	8.40%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	6.72%
Soil	Host-Associated → Plants → Rhizosphere → Soil	5.04%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified	3.36%
Hot (42-90C)	Environmental → Aquatic → Thermal Springs → Hot (42-90C)	0.84%
Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere	0.84%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	27.73%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	12.61%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	12.61%
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	10.08%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	8.40%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil	7.56%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	6.72%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	5.04%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified	3.36%
Agricultural Land	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land	2.52%
Grasslands	Environmental → Terrestrial → Soil → Loam → Grasslands	1.68%
Acidic	Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic	0.84%
Soil	Host-Associated → Plants → Roots → Rhizosphere → Soil	0.84%

Habitat	Taxonomy	Distribution
Vadose Zone Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil	14.29%
Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil	10.08%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	10.08%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil	7.56%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil	7.56%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	6.72%
Populus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere	5.04%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere	5.04%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	3.36%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere	3.36%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	3.36%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil	2.52%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil	2.52%
Switchgrass Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere	2.52%
Surface Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil	1.68%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	1.68%
Hardwood Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil	1.68%
Soil	Environmental → Terrestrial → Soil → Loam → Grasslands → Soil	1.68%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere	1.68%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	1.68%
Iron-Sulfur Acid Spring	Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring	0.84%
Terrestrial Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil	0.84%
Corn Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere	0.84%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	0.84%
Miscanthus Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere	0.84%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere	0.84%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	0.84%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
2088090014	Soil microbial communities from Great Prairies - Iowa, Native Prairie soil	Environmental	Open in IMG/M
3300000364	Soil microbial communities from Great Prairies - Iowa, Native Prairie soil	Environmental	Open in IMG/M
3300000559	Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemly	Environmental	Open in IMG/M
3300000955	Soil microbial communities from Great Prairies - Iowa, Native Prairie soil	Environmental	Open in IMG/M
3300001431	Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.4TB clc assemly	Environmental	Open in IMG/M
3300004156	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1	Environmental	Open in IMG/M
3300004479	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs	Environmental	Open in IMG/M
3300004633	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio	Environmental	Open in IMG/M
3300005330	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG	Environmental	Open in IMG/M
3300005332	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)	Environmental	Open in IMG/M
3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Host-Associated	Open in IMG/M
3300005440	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG	Environmental	Open in IMG/M
3300005466	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG	Environmental	Open in IMG/M
3300005467	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG	Environmental	Open in IMG/M
3300005468	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG	Environmental	Open in IMG/M
3300005518	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG	Environmental	Open in IMG/M
3300005526	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1	Environmental	Open in IMG/M
3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Host-Associated	Open in IMG/M
3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Host-Associated	Open in IMG/M
3300005552	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150	Environmental	Open in IMG/M
3300005559	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149	Environmental	Open in IMG/M
3300005586	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140	Environmental	Open in IMG/M
3300005764	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)	Environmental	Open in IMG/M
3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Host-Associated	Open in IMG/M
3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Host-Associated	Open in IMG/M
3300006031	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100	Environmental	Open in IMG/M
3300006163	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG	Environmental	Open in IMG/M
3300006173	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG	Environmental	Open in IMG/M
3300006175	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG	Environmental	Open in IMG/M
3300006237	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2)	Host-Associated	Open in IMG/M
3300006854	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4	Host-Associated	Open in IMG/M
3300006871	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Host-Associated	Open in IMG/M
3300006914	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5	Host-Associated	Open in IMG/M
3300007076	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4	Host-Associated	Open in IMG/M
3300009038	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG	Environmental	Open in IMG/M
3300009101	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG	Host-Associated	Open in IMG/M
3300009792	Tropical forest soil microbial communities from Panama - MetaG Plot_12	Environmental	Open in IMG/M
3300010043	Tropical forest soil microbial communities from Panama - MetaG Plot_26	Environmental	Open in IMG/M
3300010046	Tropical forest soil microbial communities from Panama - MetaG Plot_36	Environmental	Open in IMG/M
3300010047	Tropical forest soil microbial communities from Panama - MetaG Plot_30	Environmental	Open in IMG/M
3300010358	Tropical forest soil microbial communities from Panama - MetaG Plot_3	Environmental	Open in IMG/M
3300010359	Tropical forest soil microbial communities from Panama - MetaG Plot_15	Environmental	Open in IMG/M
3300010362	Tropical forest soil microbial communities from Panama - MetaG Plot_22	Environmental	Open in IMG/M
3300010366	Tropical forest soil microbial communities from Panama - MetaG Plot_24	Environmental	Open in IMG/M
3300010400	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2	Environmental	Open in IMG/M
3300011270	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG	Environmental	Open in IMG/M
3300011271	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG	Environmental	Open in IMG/M
3300012202	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG	Environmental	Open in IMG/M
3300012205	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG	Environmental	Open in IMG/M
3300012209	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG	Environmental	Open in IMG/M
3300012361	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG	Environmental	Open in IMG/M
3300012683	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG	Environmental	Open in IMG/M
3300012903	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S134-311R-1	Environmental	Open in IMG/M
3300012929	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)	Environmental	Open in IMG/M
3300012960	Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG	Environmental	Open in IMG/M
3300012971	Tropical forest soil microbial communities from Panama - MetaG Plot_1	Environmental	Open in IMG/M
3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Host-Associated	Open in IMG/M
3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Host-Associated	Open in IMG/M
3300015241	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly)	Environmental	Open in IMG/M
3300015371	Combined assembly of cpr5 and col0 rhizosphere and soil	Host-Associated	Open in IMG/M
3300015373	Combined assembly of cpr5 rhizosphere	Host-Associated	Open in IMG/M
3300015374	Col-0 rhizosphere combined assembly	Host-Associated	Open in IMG/M
3300016404	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082	Environmental	Open in IMG/M
3300019886	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2c2	Environmental	Open in IMG/M
3300019887	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c2	Environmental	Open in IMG/M
3300020199	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly)	Environmental	Open in IMG/M
3300022557	Paint Pots_combined assembly	Environmental	Open in IMG/M
3300024181	Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK34	Environmental	Open in IMG/M
3300024331	Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK09	Environmental	Open in IMG/M
3300025910	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)	Environmental	Open in IMG/M
3300025914	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025915	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes)	Environmental	Open in IMG/M
3300025922	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)	Environmental	Open in IMG/M
3300025936	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes)	Environmental	Open in IMG/M
3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes)	Host-Associated	Open in IMG/M
3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026324	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 (SPAdes)	Environmental	Open in IMG/M
3300026490	Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-10-A	Environmental	Open in IMG/M
3300026514	Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-13-B	Environmental	Open in IMG/M
3300026557	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal	Environmental	Open in IMG/M
3300027846	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes)	Environmental	Open in IMG/M
3300027862	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes)	Environmental	Open in IMG/M
3300027874	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes)	Environmental	Open in IMG/M
3300027903	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes)	Environmental	Open in IMG/M
3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes)	Host-Associated	Open in IMG/M
3300031231	Coassembly Site 11 (all samples) - Champenoux / Amance forest	Environmental	Open in IMG/M
3300031474	Fir Coassembly Site 11 - Champenoux / Amance forest	Environmental	Open in IMG/M
3300031561	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26	Environmental	Open in IMG/M
3300031720	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515	Environmental	Open in IMG/M
3300031879	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2)	Environmental	Open in IMG/M
3300031946	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172	Environmental	Open in IMG/M
3300031959	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f24	Environmental	Open in IMG/M
3300032180	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
GPIPI_03892150	2088090014	Soil	MGVWKRARVFNWELMFWISSLILAFAAIGALLVYQSYMRAR
GPIPI_02333700	2088090014	Soil	MRGWKRAHAFNWELMFGISSLILAFMAVGALLVYESFMRAR
GPIPI_03972440	2088090014	Soil	MGVWKRERAFNWELMFWISSLTLAVLATAALLAYQSFIHAR
GPIPI_00896620	2088090014	Soil	MGVWKGTRVFNWDLMFWISSLILAFTAIGAFLTYYSFLSAR
INPhiseqgaiiFebDRAFT_1014958403	3300000364	Soil	MGVWKQARVFNWELAFWITSLVLAFMAIGALLAYHSFLHA*
INPhiseqgaiiFebDRAFT_1019396314	3300000364	Soil	MGAWKRARVFNWDLMFGISCLILAFFAVAALAAYQSFLLAR*
F14TC_1000405585	3300000559	Soil	MRGWKRAHAFNWELMFGISSLILAFMAVGALLVYESFMRAR*
JGI1027J12803_1001071476	3300000955	Soil	MGVWKRERAFNWELMFWISSLTLAVLATAALLAYQSFIHAR*
F14TB_1041298722	3300001431	Soil	LRGWKRAHAFNWELMFGISSLILAFMAVGALLVYESFMRAR*
Ga0062589_1001608411	3300004156	Soil	MGVWKGTRVFNWDLMFWISSLILAFMGMGALLAYQNFLSAR*
Ga0062595_1014674652	3300004479	Soil	MGVWKRVRVFNWELMFGISFLILAFFAVGALLAYHSFLSAR*
Ga0062595_1016881092	3300004479	Soil	MGEWKRARVFNWELMLGISFLVLGFAAMGALLAYHSFVHAR*
Ga0066395_100034243	3300004633	Tropical Forest Soil	MGVWKRARAFNWELAFWISALVLAFITIGALLTYQSYGLAGR*
Ga0070690_1016773201	3300005330	Switchgrass Rhizosphere	MGVWKRARVFNWELAFWISSLVLAFMAIGALLAYQSFLHA*
Ga0066388_1000903931	3300005332	Tropical Forest Soil	MGVWKRQRVFNWELMFGISALVLAFIAMGALLAYRGFVSAGR*
Ga0066388_1001625693	3300005332	Tropical Forest Soil	MGVWKRDRVVNWELMFWISSLILAFLAMGALLAYQSFILAR*
Ga0066388_1003918433	3300005332	Tropical Forest Soil	MGVWKRERVFNWELMFGISGLVLAFMVMGALLTYHGFVSAGR*
Ga0066388_1012518112	3300005332	Tropical Forest Soil	MGVWKRERVFNWELVFGISGLVLAFMAMGALLAYKGFVSAGR*
Ga0066388_1018646582	3300005332	Tropical Forest Soil	MGVWKRARVFNWELAFWISALVLAFITIGALLTYQSYGLAGR*
Ga0070667_1010001442	3300005367	Switchgrass Rhizosphere	VSMGVWKRARVFNWELAFWISSLVLAFMAIGALLAYQSFLHA*
Ga0070705_1011226431	3300005440	Corn, Switchgrass And Miscanthus Rhizosphere	MRRWKRARVFNWELMLKISSLILGFMALGALLIYESFIQAQ*
Ga0070685_100941573	3300005466	Switchgrass Rhizosphere	MLHEAGREVTMGVWKGTRVFNWDLMFWIFSFILAFVGLGAFLAYQSFLSAR*
Ga0070706_1001164232	3300005467	Corn, Switchgrass And Miscanthus Rhizosphere	MKRWKRAHVFNWELMFKISSLILVFMALGALLIYESFMQAQ*
Ga0070707_1000254744	3300005468	Corn, Switchgrass And Miscanthus Rhizosphere	MRRWKRAHVFNWELMFKISSLILGFMALGALLIYESFMQAQ*
Ga0070699_1002490032	3300005518	Corn, Switchgrass And Miscanthus Rhizosphere	MRGWKRVHVFNWELMFTISSLVLAFMAVGALLIYESFVRAR*
Ga0073909_100100204	3300005526	Surface Soil	MGVWKRERVFNWELMFWISSLILAFMAIGALLAYLSFIRAR*
Ga0073909_104132882	3300005526	Surface Soil	MSGNGRRVFNWELIFWISCLTLGFMAIGALAIYQSYVHAQ*
Ga0068853_1001995863	3300005539	Corn Rhizosphere	MGVWKGTRVFNWDLMFWIFSLILAFVGLGVFLAYQSFLSAR*
Ga0070665_1000509001	3300005548	Switchgrass Rhizosphere	AEAGREAGMGEWKRARVFNWELMLGISFLVLGFAAMGALLAYHSFVHAR*
Ga0070665_1001805643	3300005548	Switchgrass Rhizosphere	MLHEAGREVTMGVWKGTRVFNWDLMFWIFSLILAFVGLGVFLAYQSFLSAR*
Ga0070665_1022362861	3300005548	Switchgrass Rhizosphere	MGVWKRARVFNWELMFWISSLTLAILTTGALLAYQSFIRAR*
Ga0066701_103043782	3300005552	Soil	MRGWKRARVFNWELMFGISSLILAFMAVGALLIYESFMRAR*
Ga0066700_100448791	3300005559	Soil	MKRWKRAHVFNWELMFKISSLILGFMALGALLIYESFMQAQ*
Ga0066691_107738371	3300005586	Soil	MKRWKRAHVFNWELMFKISSLILAFMALGALLIYESFMQAQ*
Ga0066903_1005228363	3300005764	Tropical Forest Soil	MGVWKRQRVFNWELVFGISGLVLAFMAIGALLAYQGFLSAGR*
Ga0066903_1032701162	3300005764	Tropical Forest Soil	MGVWKRARVFNWELVFWISSLILAFLAIGALLAYQSFMRAR*
Ga0068858_1024341412	3300005842	Switchgrass Rhizosphere	MGVWKRVRVFNWELMFWISSLILGFMAIGALLAYQSFMRAR*
Ga0068860_1008994612	3300005843	Switchgrass Rhizosphere	MGVWKRARVFNWELMFGVSFLVLAFAAMGALLAYHSFVHAR*
Ga0066651_104831532	3300006031	Soil	MRRWKRAHVFNWELMFKISSLILGFVALGALLIYESFIQAQ*
Ga0070715_100702243	3300006163	Corn, Switchgrass And Miscanthus Rhizosphere	MGVWKRERVFNWELMFWISSVILAFMAIGALLAYLSFIRAR*
Ga0070716_1001314512	3300006173	Corn, Switchgrass And Miscanthus Rhizosphere	MGVWKRTRVFNWDLMFWISSLILAFTAIGAFLTYYSFPSAR*
Ga0070712_1008427712	3300006175	Corn, Switchgrass And Miscanthus Rhizosphere	MGVWKRARVFNWELMFWISSLILAFMVMAALLAYQSFMSAR*
Ga0070712_1008883371	3300006175	Corn, Switchgrass And Miscanthus Rhizosphere	MSARGRRLFKWELIFGISSLILGFMVIGALLTYASFVHAR*
Ga0097621_1000235132	3300006237	Miscanthus Rhizosphere	MGVWKRIRVFNWELMFGISFLILAFIAMGALLAYHSFLHAR*
Ga0075425_10002869713	3300006854	Populus Rhizosphere	MGVWKRARVFNWELMFWISSLILAFFAIGALLAYQSFLRAR*
Ga0075425_1006993572	3300006854	Populus Rhizosphere	MGRWKRARVFNWELLFKISSLILGFMAVGALLIYDSYINAR*
Ga0075425_1016867482	3300006854	Populus Rhizosphere	MGVWRPVYVFNWELALGISALVLAFIAVAVFLTYQSYLPG*
Ga0075434_1002136923	3300006871	Populus Rhizosphere	MGVWKRARVFNWELMFWISSLVLAFMGVGAMLAYQSFLRAR*
Ga0075436_1012997941	3300006914	Populus Rhizosphere	MGVWKRARVFNWELTFWISALILGFMAIGALLAYQSFLRAR*
Ga0075435_1010991521	3300007076	Populus Rhizosphere	MGVWKRARVFNWELMFGISFLVLAFVAMGTLLAYHSFLHAR*
Ga0099829_100170473	3300009038	Vadose Zone Soil	MGSWKRARVFNWELMFGISSLIFAFMAAGALLVYETFMRAR*
Ga0099829_102119252	3300009038	Vadose Zone Soil	MRRWKRAHVFNWELMFGISFLILGFMAVGALLIYESAP*
Ga0105247_102589571	3300009101	Switchgrass Rhizosphere	MGVWKRARVFNWELMFGVSFLVLAFAAMGALLAYHSFVHAR
Ga0126374_100918291	3300009792	Tropical Forest Soil	VSRRKGEVSMGVWKRAPAFNWELMFWISCLIMAFLGTGALLAYRGFLSAR*
Ga0126380_115954241	3300010043	Tropical Forest Soil	MGEWKRARVFNWELTFGISFLVLSLMAMGALLAYHGFITAR*
Ga0126384_109697881	3300010046	Tropical Forest Soil	MGVWKRDRVFNWELLVGISALTLAFLIFAAVLTYHGYTVAGRYR*
Ga0126382_103397302	3300010047	Tropical Forest Soil	MGVWKRQRVFNWELMFGISALVLAFIAVGALLAYRGFVSAGR*
Ga0126370_113263721	3300010358	Tropical Forest Soil	MGGWKRHRVFNWELVFGISGLVLAFMVVGALLAYQS
Ga0126376_107946862	3300010359	Tropical Forest Soil	MGVWKRQRVFNWELMFGISALVLAFIAMGALLAYRGFV*
Ga0126377_133593301	3300010362	Tropical Forest Soil	RAAKHYLSRRKGEVSMGVWKRAPAFNWELMFWVSCLVLAFLGTGALLAYRGFLSAR*
Ga0126379_105211962	3300010366	Tropical Forest Soil	MGVWKRERVFNWELLFGISALTLAFIAMGALLAYHGFVSAGR*
Ga0134122_110610222	3300010400	Terrestrial Soil	MGVWKRARVFNWELAFWISSLILAFMAMGALLAYHSFVHA*
Ga0137391_108816001	3300011270	Vadose Zone Soil	LQKTGREVRMGSWKRARVFNWELMFGISSLIFAFMAAGALLIYESFMRAR*
Ga0137393_102315701	3300011271	Vadose Zone Soil	KTGREVRMGSWKRARVFNWELMFGISSLIFAFMAAGALLVYETFMRAR*
Ga0137363_109132972	3300012202	Vadose Zone Soil	MGSWKRARVFNWELMFGISSLIFAFMAAGALLIYESFMRAR*
Ga0137362_100633761	3300012205	Vadose Zone Soil	MKRWKRAHVFNWELMFKISSLILGFMALGALLIYESFIQAQ*
Ga0137362_106274941	3300012205	Vadose Zone Soil	MGVWKRARVFNWELMFWISSLILAFMAGGALLAYQSFMRAR*
Ga0137379_108611732	3300012209	Vadose Zone Soil	WKRAHAFNWELMFKISSLILGFMALGALLIYESFIQAQ*
Ga0137360_103055612	3300012361	Vadose Zone Soil	MGVWKRARVFNWELTFWISSLILAFMAGGALLAYQSFMRAR*
Ga0137398_107860651	3300012683	Vadose Zone Soil	RARVFNWELMFGISSLIFAFMAAGALLIYESFMRAR*
Ga0157289_101452051	3300012903	Soil	MGVWKRARVFNWELAFWISSLVLAFMAMGALLAYHSFVHA*
Ga0137404_103380181	3300012929	Vadose Zone Soil	MGVWKRARVFNWELMFWISSLILAFMAGGALLAYQSFMRTR*
Ga0164301_107949851	3300012960	Soil	MGVWKRERVFNWELMFWISSLILAFVAIGALLAYLSFIRAR*
Ga0126369_104364082	3300012971	Tropical Forest Soil	MGAWKRQRVFNWELVFGIFGLVLGFVAVGALLAYQSFLSAGR
Ga0163162_105351612	3300013306	Switchgrass Rhizosphere	MLHEAGREVTMGAWKGTRVFNWDLMFWIFSLILAFVGLGVFLAYQSFLSAR*
Ga0157375_103627172	3300013308	Miscanthus Rhizosphere	RVFNWELMFGISFLILAFFAVGALLAYHSFLSAR*
Ga0137418_103829551	3300015241	Vadose Zone Soil	MRGWKRARVFNWELMFGISSLIFAFMAAAALLIYESFMRAR*
Ga0132258_1001563321	3300015371	Arabidopsis Rhizosphere	MGVWKRAGAFNWELLLCISSLIWALVAMGALLTYHSFVHAR*
Ga0132258_129867951	3300015371	Arabidopsis Rhizosphere	MGAWKRARVFNWELMFWISSLILAFLAVGALLAYQSFLRAR*
Ga0132257_1016946191	3300015373	Arabidopsis Rhizosphere	MGAWKRARVFNWDLVVWISCLVLAIFAVAALAAYQSFLS
Ga0132255_1027288022	3300015374	Arabidopsis Rhizosphere	MGVWKRIRVFNWELMFGISFLILAFIAMGALLAYH
Ga0182037_116848241	3300016404	Soil	GMGVWKRQRVFNWELVFGIFGLVLAFVAMGALLAYQGFISAGR
Ga0193727_11377542	3300019886	Soil	MGVWKRARVLNWELMFWISSLILVFMAGGALLAYQSFIRAR
Ga0193729_10233203	3300019887	Soil	MGVWKRARVLNWELTFWISSLILAFMAGGALLAYQSFIRAR
Ga0179592_104259961	3300020199	Vadose Zone Soil	KTGREVRMGSWKRARVFNWELMFGISSLIFAFMAAGALLIYESFMRAR
Ga0212123_100020101	3300022557	Iron-Sulfur Acid Spring	MGGWKRARVFNWELMFGISSLVLAFMAVGALLIYASFMRAR
Ga0247693_10467232	3300024181	Soil	MGAWKRARVFNWELMFGISGLILAFFAVGALLAYHSFSSAR
Ga0247668_10877311	3300024331	Soil	KRARVFNWELMFGVSFLVLAFAAMGALLAYHSFVHAR
Ga0207684_100206802	3300025910	Corn, Switchgrass And Miscanthus Rhizosphere	MRRWKRAHVFNWELMFKISSLILGFMALGALLIYESFMQAQ
Ga0207684_101435483	3300025910	Corn, Switchgrass And Miscanthus Rhizosphere	MKRWKRAHVFNWELMFKISSLILVFMALGALLIYESFMQAQ
Ga0207671_108498682	3300025914	Corn Rhizosphere	MGVWKRVRVFNWELMFGISFLILAFFAVGALLAYHSFLSAR
Ga0207693_106709362	3300025915	Corn, Switchgrass And Miscanthus Rhizosphere	MGVWKRARVFNWELMFWISSLILAFMVMAALLAYQSFMSAR
Ga0207646_111031061	3300025922	Corn, Switchgrass And Miscanthus Rhizosphere	MRSWKRAQVFNGELMFKISSLILGFMAVGAILIYESFIRAR
Ga0207670_103888831	3300025936	Switchgrass Rhizosphere	MGVWKRVRVFNWELMFGVSFLVLAFAAMGALLAYHSF
Ga0207689_115996951	3300025942	Miscanthus Rhizosphere	MGEWKRARVFNWELMLGISFLVLGFAAMGALLAYHSFVHAR
Ga0207712_103412191	3300025961	Switchgrass Rhizosphere	MLHEAGREVTMGVWKGTRVFNWDLMFWIFSLILAFVGLGAFLAYQSFLSAR
Ga0207641_105804941	3300026088	Switchgrass Rhizosphere	MGVWKRVRVFNWELMFWISSLTLAILTTGALLAYQSFIRAR
Ga0207648_104407383	3300026089	Miscanthus Rhizosphere	MGVWKRARVFNWELAFWISSLILAFMAMGALLAYRSFLQA
Ga0209470_11569842	3300026324	Soil	MKRWKRAHVFNWELMFKISSLILGFMALGALLIYESFMQAQ
Ga0257153_10334923	3300026490	Soil	MGVWKRARVFNWELMFWISSLILAFMAVGALLAYQSFMRAR
Ga0257153_10858102	3300026490	Soil	MGVWKRARVFNWELMFWISSLILAFMAEGALLAYQSFMRAR
Ga0257168_10160491	3300026514	Soil	MGSWKRARVFNWELMFGISSLIFAFMAAGALLVYE
Ga0179587_100243452	3300026557	Vadose Zone Soil	MGSWKRARVFNWELMFGISSLIFAFMAAGALLIYESFMRAR
Ga0209180_100138105	3300027846	Vadose Zone Soil	MGSWKRARVFNWELMFGISSLIFAFMAAGALLVYETFMRAR
Ga0209701_100301363	3300027862	Vadose Zone Soil	MRRWKRAHVFNWELMFGISFLILGFMAVGALLIYESAP
Ga0209465_100491241	3300027874	Tropical Forest Soil	MGVWKRARAFNWELAFWISALVLAFITIGALLTYQSYGLAGR
Ga0209488_108854401	3300027903	Vadose Zone Soil	MGSWKRARVFNWELMFWISSLILAFMAGGALLAYQSFMRAR
Ga0268266_100929815	3300028379	Switchgrass Rhizosphere	MLHEAGREVTMGVWKGTRVFNWDLMFWIFSFILAFVGLGAFLAYQSFLSAR
Ga0268266_101272862	3300028379	Switchgrass Rhizosphere	MLHEAGREVTMGAWKGTRVFNWDLMFWIFSLILAFVGLGVFLAYQSFLSAR
Ga0268264_100619255	3300028381	Switchgrass Rhizosphere	MGVWKRARVFNWELMFWISSLTLAILTTGALLAYQ
Ga0170824_1048626931	3300031231	Forest Soil	EAGWEVGMGVWKRARVFNWELMFWISSLILAFMAGGALLAYQSFLRAR
Ga0170824_1118476941	3300031231	Forest Soil	MGVWKRARVFNWELMFWISSVILAFMAVGALLAYQSFMRAR
Ga0170818_1067218652	3300031474	Forest Soil	ARVFNWELMFWISSVILAFMAVGALLAYQSFMRAR
Ga0318528_101212961	3300031561	Soil	MGAWKRQRVFNWELVFGIFGLVLAFVAMGALLAYQ
Ga0307469_114906462	3300031720	Hardwood Forest Soil	MGLWKRASVFNWELMFWISSLILAFMAIGAVLVYQTYMRAR
Ga0306919_110530432	3300031879	Soil	MGAWKRQRVFNWELVFGIFGLVLAFVAMGALLAYQGFISA
Ga0310910_101697792	3300031946	Soil	MGAWKRQRVFNWELVFGIFGLVLAFVAMGALLAYQGFISAGR
Ga0318530_101835631	3300031959	Soil	GMGAWKRQRVFNWELVFGIFGLVLAFVAMGALLAYQGFISAGR
Ga0307471_1001903212	3300032180	Hardwood Forest Soil	MGVWKRVRVFNWELVFWISSLILAFMAIGALLAYQSFMRAR

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.53
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.53
Powered by PDBe Molstar

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome Family F075387

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign