NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F075460

Metagenome / Metatranscriptome Family F075460

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F075460
Family Type Metagenome / Metatranscriptome
Number of Sequences 119
Average Sequence Length 41 residues
Representative Sequence VPVWGVVPERVGIAAGPEARLYREGLEEYDKVLRRALRGR
Number of Associated Samples 103
Number of Associated Scaffolds 119

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 2.52 %
% of genes near scaffold ends (potentially truncated) 94.12 %
% of genes from short scaffolds (< 2000 bps) 92.44 %
Associated GOLD sequencing projects 99
AlphaFold2 3D model prediction Yes
3D model pTM-score0.41

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (91.597 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil
(7.563 % of family members)
Environment Ontology (ENVO) Unclassified
(22.689 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(49.580 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 36.76%    β-sheet: 0.00%    Coil/Unstructured: 63.24%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.41
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 119 Family Scaffolds
PF09996DUF2237 9.24
PF04185Phosphoesterase 3.36
PF00266Aminotran_5 2.52
PF04545Sigma70_r4 2.52
PF14542Acetyltransf_CG 1.68
PF01243Putative_PNPOx 1.68
PF07978NIPSNAP 1.68
PF00557Peptidase_M24 1.68
PF04087DUF389 1.68
PF00005ABC_tran 1.68
PF05988DUF899 1.68
PF08352oligo_HPY 1.68
PF07883Cupin_2 1.68
PF02653BPD_transp_2 1.68
PF02774Semialdhyde_dhC 1.68
PF13191AAA_16 0.84
PF04984Phage_sheath_1 0.84
PF13376OmdA 0.84
PF13336AcetylCoA_hyd_C 0.84
PF12680SnoaL_2 0.84
PF02775TPP_enzyme_C 0.84
PF01042Ribonuc_L-PSP 0.84
PF00696AA_kinase 0.84
PF00903Glyoxalase 0.84
PF00174Oxidored_molyb 0.84
PF02614UxaC 0.84
PF07045DUF1330 0.84
PF03640Lipoprotein_15 0.84
PF00180Iso_dh 0.84
PF00248Aldo_ket_red 0.84
PF00313CSD 0.84
PF13185GAF_2 0.84
PF01551Peptidase_M23 0.84
PF03631Virul_fac_BrkB 0.84
PF12897Asp_aminotransf 0.84
PF11336DUF3138 0.84
PF09723Zn-ribbon_8 0.84
PF09140MipZ 0.84
PF13683rve_3 0.84
PF03841SelA 0.84
PF12697Abhydrolase_6 0.84
PF05157T2SSE_N 0.84
PF00216Bac_DNA_binding 0.84
PF09948DUF2182 0.84
PF01425Amidase 0.84
PF12277DUF3618 0.84
PF00587tRNA-synt_2b 0.84
PF06262Zincin_1 0.84
PF07837FTCD_N 0.84

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 119 Family Scaffolds
COG3511Phospholipase CCell wall/membrane/envelope biogenesis [M] 3.36
COG0002N-acetyl-gamma-glutamylphosphate reductaseAmino acid transport and metabolism [E] 1.68
COG0136Aspartate-semialdehyde dehydrogenaseAmino acid transport and metabolism [E] 1.68
COG1808Uncharacterized membrane protein AF0785, contains DUF389 domainFunction unknown [S] 1.68
COG4312Predicted dithiol-disulfide oxidoreductase, DUF899 familyGeneral function prediction only [R] 1.68
COG0154Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidaseTranslation, ribosomal structure and biogenesis [J] 0.84
COG0251Enamine deaminase RidA/Endoribonuclease Rid7C, YjgF/YER057c/UK114 familyDefense mechanisms [V] 0.84
COG0776Bacterial nucleoid DNA-binding protein IHF-alphaReplication, recombination and repair [L] 0.84
COG1192ParA-like ATPase involved in chromosome/plasmid partitioning or cellulose biosynthesis protein BcsQCell cycle control, cell division, chromosome partitioning [D] 0.84
COG1295Uncharacterized membrane protein, BrkB/YihY/UPF0761 family (not an RNase)Function unknown [S] 0.84
COG1904Glucuronate isomeraseCarbohydrate transport and metabolism [G] 0.84
COG1921Seryl-tRNA(Sec) selenium transferaseTranslation, ribosomal structure and biogenesis [J] 0.84
COG2041Molybdopterin-dependent catalytic subunit of periplasmic DMSO/TMAO and protein-methionine-sulfoxide reductasesEnergy production and conversion [C] 0.84
COG3497Phage tail sheath protein FIMobilome: prophages, transposons [X] 0.84
COG3643Glutamate formiminotransferaseAmino acid transport and metabolism [E] 0.84
COG3824Predicted Zn-dependent protease, minimal metalloprotease (MMP)-like domainPosttranslational modification, protein turnover, chaperones [O] 0.84
COG3915Uncharacterized conserved proteinFunction unknown [S] 0.84
COG4315Predicted lipoprotein with conserved Yx(FWY)xxD motif (function unknown)Function unknown [S] 0.84
COG5470Uncharacterized conserved protein, DUF1330 familyFunction unknown [S] 0.84


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms91.60 %
UnclassifiedrootN/A8.40 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2166559005|cont_contig65884All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium758Open in IMG/M
2170459007|GJ61VE201CCEO3All Organisms → cellular organisms → Bacteria517Open in IMG/M
2170459008|GA8OVOZ02I6JYXAll Organisms → cellular organisms → Bacteria501Open in IMG/M
2199352024|deeps__Contig_125351All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria566Open in IMG/M
3300000956|JGI10216J12902_115013131All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Intrasporangiaceae → Humibacillus → unclassified Humibacillus → Humibacillus sp. DSM 29435795Open in IMG/M
3300001398|JGI20207J14881_1000317All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria17831Open in IMG/M
3300001398|JGI20207J14881_1056056All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → environmental samples → uncultured Acidimicrobiales bacterium690Open in IMG/M
3300003369|JGI24140J50213_10111349All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria899Open in IMG/M
3300003369|JGI24140J50213_10265043All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria526Open in IMG/M
3300004081|Ga0063454_101965248All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales516Open in IMG/M
3300004092|Ga0062389_100438631All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1437Open in IMG/M
3300004152|Ga0062386_100888507All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia736Open in IMG/M
3300004479|Ga0062595_101643122All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria601Open in IMG/M
3300005172|Ga0066683_10686039All Organisms → cellular organisms → Bacteria609Open in IMG/M
3300005336|Ga0070680_100905138All Organisms → cellular organisms → Bacteria761Open in IMG/M
3300005455|Ga0070663_100774955All Organisms → cellular organisms → Bacteria821Open in IMG/M
3300005529|Ga0070741_10000590All Organisms → cellular organisms → Bacteria126482Open in IMG/M
3300005529|Ga0070741_10249986All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1690Open in IMG/M
3300005532|Ga0070739_10011162All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia8518Open in IMG/M
3300005538|Ga0070731_10901596All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria586Open in IMG/M
3300005546|Ga0070696_100833306All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales761Open in IMG/M
3300005557|Ga0066704_10397865All Organisms → cellular organisms → Bacteria916Open in IMG/M
3300005598|Ga0066706_11002838All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Mumia644Open in IMG/M
3300005712|Ga0070764_10385716All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia825Open in IMG/M
3300005899|Ga0075271_10077464Not Available617Open in IMG/M
3300006028|Ga0070717_11857010All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium544Open in IMG/M
3300006034|Ga0066656_10595329All Organisms → cellular organisms → Bacteria716Open in IMG/M
3300006046|Ga0066652_101794074All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium555Open in IMG/M
3300006358|Ga0068871_100829988All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria853Open in IMG/M
3300006638|Ga0075522_10016593All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia4716Open in IMG/M
3300006638|Ga0075522_10498429All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria564Open in IMG/M
3300006755|Ga0079222_11604100All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria617Open in IMG/M
3300006797|Ga0066659_11430403All Organisms → cellular organisms → Bacteria578Open in IMG/M
3300006800|Ga0066660_10863531All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium737Open in IMG/M
3300009839|Ga0116223_10331861All Organisms → cellular organisms → Bacteria → Terrabacteria group903Open in IMG/M
3300010038|Ga0126315_10349154All Organisms → cellular organisms → Bacteria921Open in IMG/M
3300010325|Ga0134064_10294096All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Mumia616Open in IMG/M
3300010373|Ga0134128_10875729All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria994Open in IMG/M
3300010375|Ga0105239_10834359All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1057Open in IMG/M
3300010375|Ga0105239_11598581Not Available754Open in IMG/M
3300010379|Ga0136449_102809866All Organisms → cellular organisms → Bacteria687Open in IMG/M
3300010379|Ga0136449_103744677All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria573Open in IMG/M
3300010937|Ga0137776_1693727All Organisms → cellular organisms → Bacteria → Terrabacteria group573Open in IMG/M
3300011991|Ga0120153_1052557All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium742Open in IMG/M
3300012204|Ga0137374_10792793All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium703Open in IMG/M
3300012205|Ga0137362_10952548All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria732Open in IMG/M
3300012205|Ga0137362_11627674Not Available532Open in IMG/M
3300012212|Ga0150985_113352826All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium514Open in IMG/M
3300012353|Ga0137367_10165802Not Available1608Open in IMG/M
3300012469|Ga0150984_105529571All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria500Open in IMG/M
3300012469|Ga0150984_106950252All Organisms → cellular organisms → Bacteria704Open in IMG/M
3300012685|Ga0137397_10758021All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → environmental samples → uncultured Acidimicrobiales bacterium720Open in IMG/M
3300012925|Ga0137419_11103591All Organisms → cellular organisms → Bacteria661Open in IMG/M
3300012960|Ga0164301_11086641All Organisms → cellular organisms → Bacteria635Open in IMG/M
3300012961|Ga0164302_11604518All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria541Open in IMG/M
3300012987|Ga0164307_10625032All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium834Open in IMG/M
3300013100|Ga0157373_10576665All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria817Open in IMG/M
3300013105|Ga0157369_11526795All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria679Open in IMG/M
3300013105|Ga0157369_12689882All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria501Open in IMG/M
3300013768|Ga0120155_1037838All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1488Open in IMG/M
3300014168|Ga0181534_10909535All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → environmental samples → uncultured Acidimicrobiales bacterium526Open in IMG/M
3300014168|Ga0181534_10955720Not Available515Open in IMG/M
3300014489|Ga0182018_10251589All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria972Open in IMG/M
3300014495|Ga0182015_10481240All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria794Open in IMG/M
3300014497|Ga0182008_10890658All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria523Open in IMG/M
3300014501|Ga0182024_12907691All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → environmental samples → uncultured Acidimicrobiales bacterium507Open in IMG/M
3300014638|Ga0181536_10201233All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiales incertae sedis → Allonocardiopsis → Allonocardiopsis opalescens992Open in IMG/M
3300014838|Ga0182030_10240445All Organisms → cellular organisms → Bacteria → Terrabacteria group2088Open in IMG/M
3300014838|Ga0182030_10675793Not Available975Open in IMG/M
3300016341|Ga0182035_11414333All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia625Open in IMG/M
3300016422|Ga0182039_10443441All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1111Open in IMG/M
3300017973|Ga0187780_10081733All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Kineosporiales → Kineosporiaceae → Kineosporia2221Open in IMG/M
3300019787|Ga0182031_1479323All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi1721Open in IMG/M
3300020080|Ga0206350_10159173All Organisms → cellular organisms → Bacteria1595Open in IMG/M
3300021073|Ga0210378_10049565All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1657Open in IMG/M
3300021363|Ga0193699_10402497All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria567Open in IMG/M
3300025604|Ga0207930_1067554Not Available861Open in IMG/M
3300025854|Ga0209176_10029408All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1166Open in IMG/M
3300025862|Ga0209483_1248781All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria687Open in IMG/M
3300025909|Ga0207705_10065549All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2626Open in IMG/M
3300025909|Ga0207705_10120284All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1948Open in IMG/M
3300025909|Ga0207705_10537518Not Available908Open in IMG/M
3300025913|Ga0207695_10683080All Organisms → cellular organisms → Bacteria907Open in IMG/M
3300025916|Ga0207663_11307630All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria584Open in IMG/M
3300025917|Ga0207660_10334906All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1210Open in IMG/M
3300025919|Ga0207657_10326590All Organisms → cellular organisms → Bacteria1212Open in IMG/M
3300025919|Ga0207657_10653629All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria818Open in IMG/M
3300025924|Ga0207694_11047523All Organisms → cellular organisms → Bacteria690Open in IMG/M
3300025927|Ga0207687_11617189All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria556Open in IMG/M
3300025929|Ga0207664_10824644All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria834Open in IMG/M
3300025929|Ga0207664_11793116All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium536Open in IMG/M
3300025929|Ga0207664_11988857All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria504Open in IMG/M
3300026325|Ga0209152_10470830All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria511Open in IMG/M
3300027574|Ga0208982_1098269All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → environmental samples → uncultured Acidimicrobiales bacterium595Open in IMG/M
3300027634|Ga0209905_1050761All Organisms → cellular organisms → Bacteria654Open in IMG/M
3300027773|Ga0209810_1032241All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3070Open in IMG/M
3300027867|Ga0209167_10350073Not Available803Open in IMG/M
3300028558|Ga0265326_10032443All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1487Open in IMG/M
3300028577|Ga0265318_10234078All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium670Open in IMG/M
3300028877|Ga0302235_10081534All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → environmental samples → uncultured Acidimicrobiales bacterium1493Open in IMG/M
3300029915|Ga0311358_11006095All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → environmental samples → uncultured Acidimicrobiales bacterium573Open in IMG/M
3300030503|Ga0311370_12178780All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → environmental samples → uncultured Acidimicrobiales bacterium546Open in IMG/M
3300030519|Ga0302193_10294645Not Available857Open in IMG/M
3300030617|Ga0311356_11318107All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria660Open in IMG/M
(restricted) 3300031197|Ga0255310_10020381All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1705Open in IMG/M
3300031234|Ga0302325_12339387All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria644Open in IMG/M
3300031239|Ga0265328_10117983All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria988Open in IMG/M
3300031543|Ga0318516_10233071All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1064Open in IMG/M
3300031561|Ga0318528_10296327All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia868Open in IMG/M
3300031670|Ga0307374_10655180All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria516Open in IMG/M
3300031711|Ga0265314_10254139All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1007Open in IMG/M
3300031859|Ga0318527_10139212All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1014Open in IMG/M
3300031902|Ga0302322_100262370All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1923Open in IMG/M
3300031912|Ga0306921_12753659All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → environmental samples → uncultured Acidimicrobiales bacterium504Open in IMG/M
3300031938|Ga0308175_102322512All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria601Open in IMG/M
3300032066|Ga0318514_10772520All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria511Open in IMG/M
3300032783|Ga0335079_10670911All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1086Open in IMG/M
3300033824|Ga0334840_051328All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1225Open in IMG/M
3300033887|Ga0334790_032671All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2131Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil7.56%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil7.56%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil5.04%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil5.04%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere5.04%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil3.36%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil3.36%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa3.36%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere3.36%
RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere3.36%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog2.52%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil2.52%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil2.52%
BogEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Bog2.52%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere2.52%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil2.52%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere2.52%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil1.68%
PermafrostEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost1.68%
Grass SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil1.68%
PalsaEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa1.68%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere1.68%
SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Soil1.68%
BogEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Bog1.68%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere1.68%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment0.84%
SedimentEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Sediment → Sediment0.84%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.84%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.84%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil0.84%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.84%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.84%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.84%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.84%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil0.84%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil0.84%
Rice Paddy SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil0.84%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland0.84%
Thawing PermafrostEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Thawing Permafrost0.84%
PermafrostEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost0.84%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.84%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil0.84%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil0.84%
Sandy SoilEnvironmental → Terrestrial → Soil → Sand → Unclassified → Sandy Soil0.84%
SoilEnvironmental → Terrestrial → Soil → Clay → Unclassified → Soil0.84%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen0.84%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere0.84%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere0.84%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.84%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.84%
SimulatedEngineered → Modeled → Simulated Communities (Sequence Read Mixture) → Unclassified → Unclassified → Simulated0.84%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
2166559005Simulated microbial communities from Lyon, FranceEngineeredOpen in IMG/M
2170459007Grass soil microbial communities from Rothamsted Park, UK - March 2009 indirect in plug lysis (for fosmid construction) 10-21cmEnvironmentalOpen in IMG/M
2170459008Grass soil microbial communities from Rothamsted Park, UK - March 2009 indirect DNA Tissue lysis 0-10cmEnvironmentalOpen in IMG/M
2199352024Bare-fallow DEEP SOILEnvironmentalOpen in IMG/M
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300001398Arctic peat soil from Barrow, Alaska - NGEE Surface sample F53-3 deep-092012EnvironmentalOpen in IMG/M
3300003369Arctic peat soil from Barrow, Alaska - Barrow Graham LP Incubations 002-22AEnvironmentalOpen in IMG/M
3300004081Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2)EnvironmentalOpen in IMG/M
3300004092Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3EnvironmentalOpen in IMG/M
3300004152Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3EnvironmentalOpen in IMG/M
3300004479Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAsEnvironmentalOpen in IMG/M
3300005172Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132EnvironmentalOpen in IMG/M
3300005336Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaGEnvironmentalOpen in IMG/M
3300005455Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaGHost-AssociatedOpen in IMG/M
3300005529Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1EnvironmentalOpen in IMG/M
3300005532Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen14_06102014_R1EnvironmentalOpen in IMG/M
3300005538Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1EnvironmentalOpen in IMG/M
3300005546Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaGEnvironmentalOpen in IMG/M
3300005557Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153EnvironmentalOpen in IMG/M
3300005598Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155EnvironmentalOpen in IMG/M
3300005712Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4EnvironmentalOpen in IMG/M
3300005899Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_5C_0N_302EnvironmentalOpen in IMG/M
3300006028Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaGEnvironmentalOpen in IMG/M
3300006034Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105EnvironmentalOpen in IMG/M
3300006046Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101EnvironmentalOpen in IMG/M
3300006358Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2Host-AssociatedOpen in IMG/M
3300006638Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostL2-AEnvironmentalOpen in IMG/M
3300006755Agricultural soil microbial communities from Georgia to study Nitrogen management - GA PlitterEnvironmentalOpen in IMG/M
3300006797Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108EnvironmentalOpen in IMG/M
3300006800Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109EnvironmentalOpen in IMG/M
3300009839Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaGEnvironmentalOpen in IMG/M
3300010038Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106EnvironmentalOpen in IMG/M
3300010325Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_0_1 metaGEnvironmentalOpen in IMG/M
3300010373Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4EnvironmentalOpen in IMG/M
3300010375Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaGHost-AssociatedOpen in IMG/M
3300010379Sb_50d combined assemblyEnvironmentalOpen in IMG/M
3300010937Fumarole sediment microbial communities, Furnas, Sao Miguel, Azores. Combined Assembly of Gp0156138, Gp0156139EnvironmentalOpen in IMG/M
3300011991Permafrost microbial communities from Nunavut, Canada - A34_65cm_12MEnvironmentalOpen in IMG/M
3300012204Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaGEnvironmentalOpen in IMG/M
3300012205Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaGEnvironmentalOpen in IMG/M
3300012212Combined assembly of Hopland grassland soilHost-AssociatedOpen in IMG/M
3300012353Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaGEnvironmentalOpen in IMG/M
3300012469Combined assembly of Soil carbon rhizosphereHost-AssociatedOpen in IMG/M
3300012685Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaGEnvironmentalOpen in IMG/M
3300012925Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012960Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MGEnvironmentalOpen in IMG/M
3300012961Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MGEnvironmentalOpen in IMG/M
3300012987Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MGEnvironmentalOpen in IMG/M
3300013100Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaGHost-AssociatedOpen in IMG/M
3300013105Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaGHost-AssociatedOpen in IMG/M
3300013768Permafrost microbial communities from Nunavut, Canada - A35_65cm_0MEnvironmentalOpen in IMG/M
3300014168Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_10_metaGEnvironmentalOpen in IMG/M
3300014489Permafrost microbial communities from Stordalen Mire, Sweden - 812P2M metaGEnvironmentalOpen in IMG/M
3300014495Permafrost microbial communities from Stordalen Mire, Sweden - 712P3M metaGEnvironmentalOpen in IMG/M
3300014497Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaGHost-AssociatedOpen in IMG/M
3300014501Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300014638Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_60_metaGEnvironmentalOpen in IMG/M
3300014838Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300016341Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170EnvironmentalOpen in IMG/M
3300016422Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111EnvironmentalOpen in IMG/M
3300017973Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MGEnvironmentalOpen in IMG/M
3300019787Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (PacBio error correction)EnvironmentalOpen in IMG/M
3300020080Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300021073Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_b1 redoEnvironmentalOpen in IMG/M
3300021363Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3c2EnvironmentalOpen in IMG/M
3300025604Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-3 shallow-092012 (SPAdes)EnvironmentalOpen in IMG/M
3300025854Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE Permafrost305-11B (SPAdes)EnvironmentalOpen in IMG/M
3300025862Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostL2-A (SPAdes)EnvironmentalOpen in IMG/M
3300025909Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025913Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025916Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025917Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025919Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025924Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025927Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025929Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026325Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 (SPAdes)EnvironmentalOpen in IMG/M
3300027574Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM1_O3 (SPAdes)EnvironmentalOpen in IMG/M
3300027634Thawing permafrost microbial communities from the Arctic, studying carbon transformations - Permafrost 812S1MEnvironmentalOpen in IMG/M
3300027773Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen14_06102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027867Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300028558Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaGHost-AssociatedOpen in IMG/M
3300028577Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaGHost-AssociatedOpen in IMG/M
3300028877Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N3_3EnvironmentalOpen in IMG/M
3300029915III_Bog_E1 coassemblyEnvironmentalOpen in IMG/M
3300030503III_Palsa_E3 coassemblyEnvironmentalOpen in IMG/M
3300030519Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_E3_3EnvironmentalOpen in IMG/M
3300030617II_Palsa_N2 coassemblyEnvironmentalOpen in IMG/M
3300031197 (restricted)Sandy soil microbial communities from University of British Columbia, Vancouver, Canada - EtOH1_T0_E1EnvironmentalOpen in IMG/M
3300031234Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2EnvironmentalOpen in IMG/M
3300031239Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaGHost-AssociatedOpen in IMG/M
3300031543Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20EnvironmentalOpen in IMG/M
3300031561Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26EnvironmentalOpen in IMG/M
3300031670Soil microbial communities from Risofladan, Vaasa, Finland - OX-3EnvironmentalOpen in IMG/M
3300031711Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaGHost-AssociatedOpen in IMG/M
3300031859Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f25EnvironmentalOpen in IMG/M
3300031902Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_2EnvironmentalOpen in IMG/M
3300031912Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2)EnvironmentalOpen in IMG/M
3300031938Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1EnvironmentalOpen in IMG/M
3300032066Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18EnvironmentalOpen in IMG/M
3300032783Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3EnvironmentalOpen in IMG/M
3300033824Peat soil microbial communities from Stordalen Mire, Sweden - 714 S2 5-9EnvironmentalOpen in IMG/M
3300033887Peat soil microbial communities from Stordalen Mire, Sweden - 713 P-1-X1EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
cont_0884.000038502166559005SimulatedVAVWGVIPERVGIAAGPEARLYRDGLAEYDAVFRRVARKL
L02_023598102170459007Grass SoilIAVWGVVPERVAIASGPEANLSREGLELYAAVLRKAQG
F48_047588102170459008Grass SoilVIPERVGIAAGPEARLYRQGLDEYDAVFRRVLRRI
deeps_022690202199352024SoilVPVWGVVPERVGIAAGPEARLYREGLEEYDKVLRRALRGR
JGI10216J12902_11501313113300000956SoilIPERVGIAAGPEARLYREGLSEYGTVLQRALRRR*
JGI20207J14881_1000317163300001398Arctic Peat SoilEQKVALWGVIPERVGIAAGPEARLSREGLEGYDAVLRRALRGWY*
JGI20207J14881_105605613300001398Arctic Peat SoilIWGIIPERVGIASGPEARLYREGLDAYDTVLKKALRKR*
JGI24140J50213_1011134933300003369Arctic Peat SoilENQVPIWGVIPERVGIASGPEARLYREGLDAYAGVLKKAVRRRS*
JGI24140J50213_1026504313300003369Arctic Peat SoilEIWGVIPERVGIAAGPEARLSRDGLEGYDAVLHRALRGWR*
Ga0063454_10196524813300004081SoilWWKGEGVPIWGVVPERVGIAAGPEARLYREGLDEYGKVLRYALRSR*
Ga0062389_10043863113300004092Bog Forest SoilKAEKVPIWGIIPERVGIAAGPEARLFREGLDEYDKVLRKALRRG*
Ga0062386_10088850713300004152Bog Forest SoilVPVWGIIPERVGIAAGPAGRIHPEGLEQYRAVLKRAMRGAR*
Ga0062595_10164312213300004479SoilVWGVVPERVGIAAGPEARLYREGLTEYDKVLRRVLRGSR*
Ga0066683_1068603913300005172SoilAWWKTERVPIWGLIPERVGIAAGPEARLYREGRERYATVLQRALRQKH*
Ga0070680_10090513833300005336Corn RhizosphereWWKGEGVPIWGVVPERVAIAAGPEARLYREGLAEYDTVLRKALKR*
Ga0070663_10077495513300005455Corn RhizosphereDVPIWGVVPERVGIAAGPEARLYREGLDEYGHVLRRVLRSRR*
Ga0070741_1000059013300005529Surface SoilEKVPIWGVVPERVGIAAGPEARLYREGLEEYAKVLRRALRGGR*
Ga0070741_1024998613300005529Surface SoilWGIVPERVGIASGPEARLSREGLALYSGVLRRARGRR*
Ga0070739_1001116213300005532Surface SoilPIWGVIPERVGIAAGPEARLYREGLEEYASVLKRALRRVK*
Ga0070731_1090159623300005538Surface SoilWKGESVPVWAVVPERVGIAAGPESRLYRDGLDEYDRLLRRVLRAL*
Ga0070696_10083330633300005546Corn, Switchgrass And Miscanthus RhizospherePIWGVVPERVGIAAGPEARLYRDGLDEYGKVLRRVMRTR*
Ga0066704_1039786513300005557SoilPVWGVVPERVAIAAGPEARLYREGLEEYDAVLRRALRRR*
Ga0066706_1100283813300005598SoilVWGVIPERVGIAAGPESRLYREGLDEYDKVLRRALRGTR*
Ga0070764_1038571623300005712SoilTAGVPVWGVIPERVGIAAGPSGRIYAEGLEEYQGVLKKALRGLR*
Ga0075271_1007746423300005899Rice Paddy SoilGVIPERVGIAAGPEGRLYREGLTEYDAVLRRALRGRR*
Ga0070717_1185701023300006028Corn, Switchgrass And Miscanthus RhizosphereKTPIWGIVPERVGIASGPEARLSREGLALYSAVLRRARGRR*
Ga0066656_1059532923300006034SoilIPERVGIASGPEGRLYREGLNEYDAVLKRALRGKR*
Ga0066652_10179407433300006046SoilWGLIPERVGIAAGPDARLYREGRERYATVLQRALRQKH*
Ga0068871_10082998813300006358Miscanthus RhizosphereWGVIPERVGIAAGPEARLYREGLNEYEAVLRRALRKR*
Ga0075522_1001659313300006638Arctic Peat SoilIWGVIPERVGIAAGPEARLYRQGLDEYGSVLRRVLRKR*
Ga0075522_1049842913300006638Arctic Peat SoilEIWGVIPERVGIAAGPEARLSREGLEGYDAVLHRALRGWH*
Ga0079222_1160410023300006755Agricultural SoilVVPERVGIAAGPEARLYRDGLDEYAKMLRRIRRTN*
Ga0066659_1143040323300006797SoilGVIPERVGIAAGPEGRLYREGLNEYDAVLRRALRGKR*
Ga0066660_1086353133300006800SoilWGVIPERVGIASGPEARLDREGLQLYTGVLRRAQRGLR*
Ga0116223_1033186113300009839Peatlands SoilKVPIWGVIPERVGIASGPASRIYREGLEAYQEILRKVMRAVR*
Ga0126315_1034915413300010038Serpentine SoilIWGVIPERVGIAAGPEARLYRDGLDEYGHVLRQVLRSS*
Ga0134064_1029409613300010325Grasslands SoilKVPVWGVIPERVAIAAGPESRLYREGLDEYDKVLRRALRGTR*
Ga0134128_1087572913300010373Terrestrial SoilKKEGVRIWGVIPERVGIAAGPEARLYREGLQGYDGVLRAALRATR*
Ga0105239_1083435913300010375Corn RhizospherePIWGVVPERVGIAAGPEARLYRDGLDEYGKVLRRVMRSR*
Ga0105239_1159858113300010375Corn RhizosphereKVPIWGVVPERVGIAAGPEARLYRDGLDEYGNVLRRVLRAAR*
Ga0136449_10280986623300010379Peatlands SoilVIPERVGIAAGPEARLYREGLNEYDVVLRRVLRGTR*
Ga0136449_10374467713300010379Peatlands SoilVPVWGVIPERVGIAAGPEARLYAGGLESYDAVLRRALRQRSS*
Ga0137776_169372723300010937SedimentRVAVWGVIPERVGIAAGPEARLHREGIERYSAVLRRALRKG*
Ga0120153_105255723300011991PermafrostAWWKGENVSVWGVIPERVGIAAGPEARLYREGLHEYEAILRRALRKR*
Ga0137374_1079279333300012204Vadose Zone SoilGVVPERVGIAAGPEARLYREGLVEYDKVLRRVLRGRR*
Ga0137362_1095254823300012205Vadose Zone SoilPLWGVIPERVAIAAGPEARLYRQGLEEYDAVLRRALRAR*
Ga0137362_1162767413300012205Vadose Zone SoilAEKVAIWGVIPERVGIAAGPEARLYRQGLDEYDAVLRRVLRAS*
Ga0150985_11335282623300012212Avena Fatua RhizosphereWKGESVPIWGVVPERVGIAAGPEARLYRDGLDEYGNVLRRVLRSR*
Ga0137367_1016580213300012353Vadose Zone SoilKEQKVPVWGVIPERVGIAAGPEARLYREGLDEYGTVLLRALRRRR*
Ga0150984_10552957123300012469Avena Fatua RhizosphereVPIWAVVPERVGIAAGPESRLYREGLEEYDKALRRALAGR*
Ga0150984_10695025213300012469Avena Fatua RhizosphereVPIWGVVPERVGIAAGPEARLYRDGLDEYGSVLRRVLRSR*
Ga0137397_1075802123300012685Vadose Zone SoilVIPERVGIASGPEARLYREGLDAYDAVLKKALRKR*
Ga0137419_1110359123300012925Vadose Zone SoilAEKVPIWGVVPERVGIAAGPEARLYREGLDEYDKVLRRALRAR*
Ga0164301_1108664113300012960SoilWWKGEGGPIWGVVPERVGIAAGPEARLYREGLDEYGKVLRSVLRTR*
Ga0164302_1160451813300012961SoilEKVPVWGVIPERVGIAAGPEARLYRQGLDEYDAVLRRLLRKL*
Ga0164307_1062503233300012987SoilWGVVPERVGIAAGPEARLYREGLDEYGKVLRRVLRAT*
Ga0157373_1057666513300013100Corn RhizosphereEGVPIWGVIPERVAIAAGPEGRLHREGLDLYADVLRKARARR*
Ga0157369_1152679523300013105Corn RhizosphereSVWGVIPERVAIAAGPEGRLHREGLDLYADVLRKARARR*
Ga0157369_1268988213300013105Corn RhizosphereVPVWGVIPERVGIAAGPEARLYRQGLDEYDAVLRRLLRKL*
Ga0120155_103783833300013768PermafrostVWGVIPERVGIAAGPEARLYREGLNEYEAILRRALRKRA*
Ga0181534_1090953523300014168BogVWGIIPERVGIASGPESRLYREGLEAYETVLKKAQKAVRKR*
Ga0181534_1095572013300014168BogIWGIIPERVGIASGPEARLYREGLDAYDAVLKKALRKR*
Ga0182018_1025158923300014489PalsaAWWKEQKVPVWGVIPERVGIAAGPEARLFREGLEEYDAVLRQALRAKRR*
Ga0182015_1048124023300014495PalsaWGVIPERVGIAAGPEARLFREGLEEYDAVLRQALRAKRR*
Ga0182008_1089065823300014497RhizosphereVWGVIPERVGIAAGPEARLYREGLDLYADVLKRAQRRR*
Ga0182024_1290769123300014501PermafrostPIWGIIPERVGIAAGPEARLYREGLEAYGAVLKKVLRKRSA*
Ga0181536_1020123313300014638BogGVIPERVAIATGPEARLSREGLEGYDAVLRRALRGRR*
Ga0182030_1024044513300014838BogQKVEIWGVIPERVGIAAGPEAHLSREGLNGYDAVLSRALRGWK*
Ga0182030_1067579313300014838BogQKVEIWGVIPERVGIAAGPEAHLSREGLNGYDAVLSRALRAWK*
Ga0182035_1141433333300016341SoilPVWGVVPERVGIAAGPEARLHRDGLEHYSGVLKRATRAAR
Ga0182039_1044344113300016422SoilAYWRSEQVPVWGVVPERVGIAAGPEARLHRDGLEHYSGVLKRATRAAR
Ga0187780_1008173313300017973Tropical PeatlandPVWGVVPERVAIASGPASSLSAEGLEHYDKVLRRAIAKPR
Ga0182031_147932323300019787BogEAAITWWKEQKIEIWGVIPERVGIAAGPERRLSREGVEGYDSVLHQALRGWR
Ga0206350_1015917313300020080Corn, Switchgrass And Miscanthus RhizosphereIPERVGIAAGPEGRLYREGLNEYDAVLRRALRGKR
Ga0210378_1004956543300021073Groundwater SedimentWGVIPERVGIAAGPEARLYREGLNEYGTVLQRALRRRR
Ga0193699_1040249723300021363SoilENVPVWGVIPERVGIAAGPEARLYRDGLTEYDTVLRRALRKR
Ga0207930_106755413300025604Arctic Peat SoilWWKEQKMEVWGVIPERVGIAAGPEARLSREGLEGYDAVLHQALRGWR
Ga0209176_1002940823300025854Arctic Peat SoilAERVPIWGVIPERVGIASGPESKLYREGLDAYDAVLKKALRKRWQ
Ga0209483_124878123300025862Arctic Peat SoilVALWGVIPERVGIAAGPEARLSREGLEGYDAVLRRALRGWH
Ga0207705_1006554913300025909Corn RhizosphereVIPERVGIAAGPEARLYREGLIEYDTVLRRALRKR
Ga0207705_1012028413300025909Corn RhizosphereRAEKVPIWGVIPERVGIAAGPEARLYRQGLDEYDAVLRRALRGR
Ga0207705_1053751843300025909Corn RhizospherePIWGVVPERVGIAAGPEARLYRDGLDEYDSVLKRVLRGR
Ga0207695_1068308013300025913Corn RhizosphereWGVIPERVGIAAGPEGRLYREGLNEYDAVLRRALRGKR
Ga0207663_1130763013300025916Corn, Switchgrass And Miscanthus RhizosphereAWWKGENVAVWGVIPERVGIAAGPEARLYRDGLAEYDAVFRRVARKL
Ga0207660_1033490623300025917Corn RhizosphereVSVWGVIPERVAIAAGPEGRLHREGLDLYADVLRKARARR
Ga0207657_1032659033300025919Corn RhizosphereGVVPERVGIAAGPGARLYREGLDEYGHVLRRVLRSRR
Ga0207657_1065362923300025919Corn RhizosphereVIPERVGIAAGPEARLYREGLNEYETVLRRALRKR
Ga0207694_1104752333300025924Corn RhizosphereGVVPERVAIAAGPEARLYREGLAEYDTVLRKALKR
Ga0207687_1161718913300025927Miscanthus RhizosphereKNENVPIWGVVPERVGIAAGPEARLYRDGLDEYGKVLRRVMRTR
Ga0207664_1082464423300025929Agricultural SoilKLPIWGVIPERVGIAAGPDARLNRDGLDHYAGVLRRALRQAH
Ga0207664_1179311623300025929Agricultural SoilGVAIWGVIPERVGIAAGPESRLYREGLDLYADVLKRAQRRR
Ga0207664_1198885713300025929Agricultural SoilGVVPERVGIAAGPEARLYREGLDEYGKVLRRVLRATRSTAH
Ga0209152_1047083023300026325SoilIPERVGIAAGPEARLYREGLDLYDEVLRKALRKRA
Ga0208982_109826913300027574Forest SoilPERVGIAAGPEARLYREGLDEYDAVLKKALRKRPG
Ga0209905_105076123300027634Thawing PermafrostEIWGVIPERVGIAAGPEARLSREGLEGYDVVLSRALRGWR
Ga0209810_103224113300027773Surface SoilPIWGVIPERVGIAAGPEARLYREGLEEYASVLKRALRRVK
Ga0209167_1035007313300027867Surface SoilPERVAIASGPEARLSREGIEAYAGVLRRATRRRPH
Ga0265326_1003244333300028558RhizosphereWWKSQSVAIWGVIPERVGVAAGPEARLYREGLNEYDVVLRRALRRTR
Ga0265318_1023407843300028577RhizosphereQKVAIWGVIPERVGIAAGPESRLYREGLNEYAAVLRRALRGAR
Ga0302235_1008153443300028877PalsaSKVPIWGIIPERVGIASGPEARLYREGLDAYDAVLKKALRKR
Ga0311358_1100609523300029915BogWGIIPERVGIASGPEARLYREGLDAYSAVLKKAIRKRPS
Ga0311370_1217878023300030503PalsaIVPERVGIAAGPEARLYRDGLDEYDAVLKKALRKRPG
Ga0302193_1029464513300030519BogIPERVGIAAGPESKLYRDGIEAYDAVLKKALRKRQA
Ga0311356_1131810723300030617PalsaVPIWGVIPERVGIATGPAGRIYREGLEAYQEILRKVMRAALR
(restricted) Ga0255310_1002038113300031197Sandy SoilWWREQKTPIWGIVPERVGIASGPEARLSREGLALYAAVLRRARR
Ga0302325_1233938713300031234PalsaVAIWGVVPERVGIAAGPEARLFRDGLESYEAILRTILKQRRSRAAR
Ga0265328_1011798323300031239RhizosphereQSVAIWGVIPERVGVAAGPEARLYREGLNEYDVVLRRALRRTR
Ga0318516_1023307123300031543SoilKSQNVPIWGVVPERVGIAAGPEARLYRDGLDEYGKVFRRVLRTS
Ga0318528_1029632713300031561SoilVWGVVPERVGIAAGPEARLHRDGLEHYSGVLKRATRAAR
Ga0307374_1065518013300031670SoilIAWWKEQKVELWGVIPERVGIAAGPEARLSREGLEGYDAVLRRALRGWH
Ga0265314_1025413913300031711RhizosphereSQSVTIWGVIPERVGVAAGPEARLYREGLNEYDVVLRRALRRTR
Ga0318527_1013921213300031859SoilVPVWGVVPERVGIAAGPEARLHRDGLEHYSGVLKRATRAAR
Ga0302322_10026237013300031902FenVWGVIPERVGIAAGPEARLYRDGLHEYEAILRRALRKR
Ga0306921_1275365913300031912SoilIWGVIPERVGIAAGPEARLFREGLDAYDAVLKKALRRRSG
Ga0308175_10232251233300031938SoilEGVPVWGVVPERVAIAAGPEARLYREGLDEYDGVLRKALRGR
Ga0318514_1077252013300032066SoilWRAEKVPIWGVIPERVGIAAGPEARLYRPGLNEYDAVLRRALRSRRRD
Ga0335079_1067091113300032783SoilIPERVGIAAGPDARLYREGLNEYDKVLRRALRGKR
Ga0334840_051328_1081_12063300033824SoilMEIWGVIPERVGIAAGPERRLSREGLEGYDAVLHQALRGWR
Ga0334790_032671_2002_21303300033887SoilKLEIWGVIPERVGIAAGPEARLSREGLEGYDAVLNRALRGWR


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.