NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F076091

Metagenome / Metatranscriptome Family F076091

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F076091
Family Type Metagenome / Metatranscriptome
Number of Sequences 118
Average Sequence Length 82 residues
Representative Sequence MLGIYVGVPEDVLLQYKQEALADLGKAVTSYSDSGTSVNKQFGMPPAQRLQEINYALSRIDPKKYGGAHTSVQINWDTRVDL
Number of Associated Samples 86
Number of Associated Scaffolds 118

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 8.47 %
% of genes near scaffold ends (potentially truncated) 31.36 %
% of genes from short scaffolds (< 2000 bps) 66.10 %
Associated GOLD sequencing projects 79
AlphaFold2 3D model prediction Yes
3D model pTM-score0.58

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (89.831 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake
(16.102 % of family members)
Environment Ontology (ENVO) Unclassified
(45.763 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Water (non-saline)
(55.932 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 32.73%    β-sheet: 8.18%    Coil/Unstructured: 59.09%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.58
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 118 Family Scaffolds
PF05136Phage_portal_2 40.68
PF05876GpA_ATPase 27.97
PF01343Peptidase_S49 6.78
PF14743DNA_ligase_OB_2 0.85
PF08774VRR_NUC 0.85

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 118 Family Scaffolds
COG5511Phage capsid proteinMobilome: prophages, transposons [X] 40.68
COG5525Phage terminase, large subunit GpAMobilome: prophages, transposons [X] 27.97
COG0616Periplasmic serine protease, ClpP classPosttranslational modification, protein turnover, chaperones [O] 13.56


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms96.61 %
UnclassifiedrootN/A3.39 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300002098|JGI24219J26650_1007194All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → unclassified Opitutae → Opitutae bacterium Tous-C10FEB2092Open in IMG/M
3300002098|JGI24219J26650_1017522All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → unclassified Opitutae → Opitutae bacterium Tous-C10FEB1015Open in IMG/M
3300002098|JGI24219J26650_1033812All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → unclassified Opitutae → Opitutae bacterium Tous-C10FEB614Open in IMG/M
3300003393|JGI25909J50240_1121542All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → unclassified Opitutae → Opitutae bacterium Tous-C10FEB514Open in IMG/M
3300003860|Ga0031658_1091400All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → unclassified Opitutae → Opitutae bacterium Tous-C10FEB547Open in IMG/M
3300004481|Ga0069718_10133275All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → unclassified Opitutae → Opitutae bacterium Tous-C10FEB1721Open in IMG/M
3300004829|Ga0068515_123693All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → unclassified Opitutae → Opitutae bacterium Tous-C10FEB767Open in IMG/M
3300005805|Ga0079957_1029852All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → unclassified Opitutae → Opitutae bacterium Tous-C10FEB3628Open in IMG/M
3300006037|Ga0075465_10067974All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium768Open in IMG/M
3300006037|Ga0075465_10165951All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → unclassified Opitutae → Opitutae bacterium Tous-C10FEB505Open in IMG/M
3300006484|Ga0070744_10015459All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium2262Open in IMG/M
3300006803|Ga0075467_10351995All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → unclassified Opitutae → Opitutae bacterium Tous-C10FEB774Open in IMG/M
3300006863|Ga0075459_1002026All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → unclassified Opitutae → Opitutae bacterium Tous-C10FEB3244Open in IMG/M
3300006875|Ga0075473_10303808All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → unclassified Opitutae → Opitutae bacterium Tous-C10FEB645Open in IMG/M
3300006920|Ga0070748_1047023All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium1724Open in IMG/M
3300006920|Ga0070748_1303782All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → unclassified Opitutae → Opitutae bacterium Tous-C10FEB567Open in IMG/M
3300007544|Ga0102861_1047963All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → unclassified Opitutae → Opitutae bacterium Tous-C10FEB1107Open in IMG/M
3300007622|Ga0102863_1166982All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → unclassified Opitutae → Opitutae bacterium Tous-C10FEB648Open in IMG/M
3300007708|Ga0102859_1205920All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → unclassified Opitutae → Opitutae bacterium Tous-C10FEB585Open in IMG/M
3300007972|Ga0105745_1270435All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → unclassified Opitutae → Opitutae bacterium Tous-C10FEB550Open in IMG/M
3300009056|Ga0102860_1045680All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → unclassified Opitutae → Opitutae bacterium Tous-C10FEB1174Open in IMG/M
3300009152|Ga0114980_10003626All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → unclassified Opitutae → Opitutae bacterium Tous-C10FEB10527Open in IMG/M
3300009152|Ga0114980_10013028All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → unclassified Opitutae → Opitutae bacterium Tous-C10FEB5291Open in IMG/M
3300009158|Ga0114977_10001387All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → unclassified Opitutae → Opitutae bacterium Tous-C10FEB15863Open in IMG/M
3300009161|Ga0114966_10003653All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → unclassified Opitutae → Opitutae bacterium Tous-C10FEB13426Open in IMG/M
3300009161|Ga0114966_10148091All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → unclassified Opitutae → Opitutae bacterium Tous-C10FEB1531Open in IMG/M
3300009163|Ga0114970_10031086All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → unclassified Opitutae → Opitutae bacterium Tous-C10FEB3549Open in IMG/M
3300009180|Ga0114979_10296271All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → unclassified Opitutae → Opitutae bacterium Tous-C10FEB962Open in IMG/M
3300009185|Ga0114971_10149920All Organisms → Viruses → Predicted Viral1404Open in IMG/M
3300009185|Ga0114971_10504417All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → unclassified Opitutae → Opitutae bacterium Tous-C10FEB676Open in IMG/M
3300009194|Ga0114983_1019897All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → unclassified Opitutae → Opitutae bacterium Tous-C10FEB1788Open in IMG/M
3300009419|Ga0114982_1035154All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → unclassified Opitutae → Opitutae bacterium Tous-C10FEB1616Open in IMG/M
3300009419|Ga0114982_1156361All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → unclassified Opitutae → Opitutae bacterium Tous-C10FEB704Open in IMG/M
3300010885|Ga0133913_11257509All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → unclassified Opitutae → Opitutae bacterium Tous-C10FEB1894Open in IMG/M
3300010885|Ga0133913_12318763All Organisms → Viruses → Predicted Viral1317Open in IMG/M
3300011010|Ga0139557_1000261All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → unclassified Opitutae → Opitutae bacterium Tous-C10FEB13479Open in IMG/M
3300011011|Ga0139556_1056594All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → unclassified Opitutae → Opitutae bacterium Tous-C10FEB584Open in IMG/M
3300011268|Ga0151620_1104928All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → unclassified Opitutae → Opitutae bacterium Tous-C10FEB888Open in IMG/M
3300011334|Ga0153697_1409All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → unclassified Opitutae → Opitutae bacterium Tous-C10FEB13352Open in IMG/M
3300011336|Ga0153703_1436All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → unclassified Opitutae → Opitutae bacterium Tous-C10FEB14319Open in IMG/M
3300011339|Ga0153700_10189All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → unclassified Opitutae → Opitutae bacterium Tous-C10FEB32241Open in IMG/M
3300012006|Ga0119955_1080170All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → unclassified Opitutae → Opitutae bacterium Tous-C10FEB951Open in IMG/M
3300012017|Ga0153801_1047289All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → unclassified Opitutae → Opitutae bacterium Tous-C10FEB758Open in IMG/M
3300012346|Ga0157141_1001216All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia6124Open in IMG/M
3300012348|Ga0157140_10000096All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → unclassified Opitutae → Opitutae bacterium Tous-C10FEB12639Open in IMG/M
3300012352|Ga0157138_1001186All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → unclassified Opitutae → Opitutae bacterium Tous-C10FEB4755Open in IMG/M
3300012352|Ga0157138_1001634All Organisms → Viruses → Predicted Viral3964Open in IMG/M
3300012352|Ga0157138_1002208All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → unclassified Opitutae → Opitutae bacterium Tous-C10FEB3382Open in IMG/M
3300017736|Ga0181365_1072374Not Available849Open in IMG/M
3300017736|Ga0181365_1173131All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → unclassified Opitutae → Opitutae bacterium Tous-C10FEB506Open in IMG/M
3300020141|Ga0211732_1576003All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → unclassified Opitutae → Opitutae bacterium Tous-C10FEB14197Open in IMG/M
3300020151|Ga0211736_10555214All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → unclassified Opitutae → Opitutae bacterium Tous-C10FEB1129Open in IMG/M
3300020151|Ga0211736_11021368All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → unclassified Opitutae → Opitutae bacterium Tous-C10FEB552Open in IMG/M
3300020157|Ga0194049_1229916Not Available505Open in IMG/M
3300020159|Ga0211734_10008272All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → unclassified Opitutae → Opitutae bacterium Tous-C10FEB561Open in IMG/M
3300020159|Ga0211734_10698607All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → unclassified Opitutae → Opitutae bacterium Tous-C10FEB591Open in IMG/M
3300020161|Ga0211726_10762614All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → unclassified Opitutae → Opitutae bacterium Tous-C10FEB526Open in IMG/M
3300020161|Ga0211726_10872166All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → unclassified Opitutae → Opitutae bacterium Tous-C10FEB603Open in IMG/M
3300020524|Ga0208858_1029004All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → unclassified Opitutae → Opitutae bacterium Tous-C10FEB802Open in IMG/M
3300021952|Ga0213921_1016924All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → unclassified Opitutae → Opitutae bacterium Tous-C10FEB1267Open in IMG/M
3300021956|Ga0213922_1007064All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → unclassified Opitutae → Opitutae bacterium Tous-C10FEB3299Open in IMG/M
3300021956|Ga0213922_1079559All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → unclassified Opitutae → Opitutae bacterium Tous-C10FEB682Open in IMG/M
3300021961|Ga0222714_10045470All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → unclassified Opitutae → Opitutae bacterium Tous-C10FEB3095Open in IMG/M
3300021961|Ga0222714_10225258All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → unclassified Opitutae → Opitutae bacterium Tous-C10FEB1067Open in IMG/M
3300021962|Ga0222713_10153558All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → unclassified Opitutae → Opitutae bacterium Tous-C10FEB1585Open in IMG/M
3300024289|Ga0255147_1106066All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → unclassified Opitutae → Opitutae bacterium Tous-C10FEB514Open in IMG/M
3300024306|Ga0255148_1048752All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → unclassified Opitutae → Opitutae bacterium Tous-C10FEB754Open in IMG/M
3300024346|Ga0244775_10056351All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → unclassified Opitutae → Opitutae bacterium Tous-C10FEB3407Open in IMG/M
3300024495|Ga0255164_1062702All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → unclassified Opitutae → Opitutae bacterium Tous-C10FEB586Open in IMG/M
3300024496|Ga0255151_1020518All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → unclassified Opitutae → Opitutae bacterium Tous-C10FEB1158Open in IMG/M
3300025451|Ga0208426_1032153All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → unclassified Opitutae → Opitutae bacterium Tous-C10FEB799Open in IMG/M
3300025635|Ga0208147_1029080All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → unclassified Opitutae → Opitutae bacterium Tous-C10FEB1462Open in IMG/M
3300025896|Ga0208916_10016643All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → unclassified Opitutae → Opitutae bacterium Tous-C10FEB2886Open in IMG/M
3300025896|Ga0208916_10134693All Organisms → Viruses → Predicted Viral1057Open in IMG/M
3300026573|Ga0255269_1052927All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → unclassified Opitutae → Opitutae bacterium Tous-C10FEB1127Open in IMG/M
3300027365|Ga0209300_1006150All Organisms → Viruses → Predicted Viral3717Open in IMG/M
3300027659|Ga0208975_1020856All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → unclassified Opitutae → Opitutae bacterium Tous-C10FEB2149Open in IMG/M
3300027733|Ga0209297_1000336All Organisms → cellular organisms → Bacteria31078Open in IMG/M
3300027733|Ga0209297_1170916All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → unclassified Opitutae → Opitutae bacterium Tous-C10FEB880Open in IMG/M
3300027736|Ga0209190_1000413All Organisms → cellular organisms → Bacteria31411Open in IMG/M
3300027746|Ga0209597_1002574All Organisms → cellular organisms → Bacteria11477Open in IMG/M
3300027746|Ga0209597_1261959All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → unclassified Opitutae → Opitutae bacterium Tous-C10FEB678Open in IMG/M
3300027754|Ga0209596_1019878All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → unclassified Opitutae → Opitutae bacterium Tous-C10FEB4049Open in IMG/M
3300027754|Ga0209596_1243310All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → unclassified Opitutae → Opitutae bacterium Tous-C10FEB742Open in IMG/M
3300027759|Ga0209296_1002779All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → unclassified Opitutae → Opitutae bacterium Tous-C10FEB12253Open in IMG/M
3300027764|Ga0209134_10021709All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → unclassified Opitutae → Opitutae bacterium Tous-C10FEB2036Open in IMG/M
3300027764|Ga0209134_10047985All Organisms → Viruses → Predicted Viral1414Open in IMG/M
3300027785|Ga0209246_10013432All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → unclassified Opitutae → Opitutae bacterium Tous-C10FEB3049Open in IMG/M
3300027785|Ga0209246_10215865All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → unclassified Opitutae → Opitutae bacterium Tous-C10FEB747Open in IMG/M
3300027798|Ga0209353_10160193All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → unclassified Opitutae → Opitutae bacterium Tous-C10FEB999Open in IMG/M
3300027808|Ga0209354_10050161All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → unclassified Opitutae → Opitutae bacterium Tous-C10FEB1682Open in IMG/M
3300027808|Ga0209354_10192935All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → unclassified Opitutae → Opitutae bacterium Tous-C10FEB827Open in IMG/M
3300027808|Ga0209354_10401224All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → unclassified Opitutae → Opitutae bacterium Tous-C10FEB533Open in IMG/M
3300027899|Ga0209668_10016156All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → unclassified Opitutae → Opitutae bacterium Tous-C10FEB3606Open in IMG/M
3300027899|Ga0209668_10871856Not Available606Open in IMG/M
3300027899|Ga0209668_11014939All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → unclassified Opitutae → Opitutae bacterium Tous-C10FEB559Open in IMG/M
3300027900|Ga0209253_10037864All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → unclassified Opitutae → Opitutae bacterium Tous-C10FEB4027Open in IMG/M
3300027900|Ga0209253_10348999All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → unclassified Opitutae → Opitutae bacterium Tous-C10FEB1136Open in IMG/M
3300028025|Ga0247723_1002309All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → unclassified Opitutae → Opitutae bacterium Tous-C10FEB10274Open in IMG/M
3300029349|Ga0238435_101455All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → unclassified Opitutae → Opitutae bacterium Tous-C10FEB4303Open in IMG/M
3300029349|Ga0238435_104060All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → unclassified Opitutae → Opitutae bacterium Tous-C10FEB1786Open in IMG/M
3300031772|Ga0315288_10109448All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → unclassified Opitutae → Opitutae bacterium Tous-C10FEB3143Open in IMG/M
3300031772|Ga0315288_10937863All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → unclassified Opitutae → Opitutae bacterium Tous-C10FEB779Open in IMG/M
3300031834|Ga0315290_11054881All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → unclassified Opitutae → Opitutae bacterium Tous-C10FEB682Open in IMG/M
3300031873|Ga0315297_10628773All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → unclassified Opitutae → Opitutae bacterium Tous-C10FEB901Open in IMG/M
3300032053|Ga0315284_10169795All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → unclassified Opitutae → Opitutae bacterium Tous-C10FEB2851Open in IMG/M
3300032256|Ga0315271_10365377All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → unclassified Opitutae → Opitutae bacterium Tous-C10FEB1202Open in IMG/M
3300032342|Ga0315286_11156675All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → unclassified Opitutae → Opitutae bacterium Tous-C10FEB760Open in IMG/M
3300032516|Ga0315273_11768864All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → unclassified Opitutae → Opitutae bacterium Tous-C10FEB745Open in IMG/M
3300032516|Ga0315273_11959842Not Available697Open in IMG/M
3300033995|Ga0335003_0072590All Organisms → Viruses → Predicted Viral1817Open in IMG/M
3300033996|Ga0334979_0156645All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → unclassified Opitutae → Opitutae bacterium Tous-C10FEB1373Open in IMG/M
3300034060|Ga0334983_0004510All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → unclassified Opitutae → Opitutae bacterium Tous-C10FEB9660Open in IMG/M
3300034068|Ga0334990_0001566All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → unclassified Opitutae → Opitutae bacterium Tous-C10FEB13260Open in IMG/M
3300034093|Ga0335012_0153303All Organisms → Viruses → Predicted Viral1252Open in IMG/M
3300034200|Ga0335065_0139574All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → unclassified Opitutae → Opitutae bacterium Tous-C10FEB1621Open in IMG/M
3300034200|Ga0335065_0453538All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → unclassified Opitutae → Opitutae bacterium Tous-C10FEB776Open in IMG/M
3300034284|Ga0335013_0569185All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → unclassified Opitutae → Opitutae bacterium Tous-C10FEB667Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake16.10%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater10.17%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake9.32%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous9.32%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment7.63%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater6.78%
FreshwaterEnvironmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater6.78%
Freshwater Lake SedimentEnvironmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment5.08%
FreshwaterEnvironmental → Aquatic → Freshwater → River → Unclassified → Freshwater4.24%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine3.39%
Deep SubsurfaceEnvironmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface3.39%
LenticEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Lentic2.54%
FreshwaterEnvironmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater2.54%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water2.54%
EstuarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine1.69%
SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment0.85%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater0.85%
Freshwater LenticEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic0.85%
Anoxic Zone FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater0.85%
LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Lake0.85%
FreshwaterEnvironmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater0.85%
FreshwaterEnvironmental → Aquatic → Freshwater → Ice → Unclassified → Freshwater0.85%
Estuary WaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water0.85%
Marine WaterEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine Water0.85%
Deep Subsurface SedimentEnvironmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment0.85%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300002098Lentic bog actinobacteria communities from Grosse Fuchskuhle, Germany - Sample acI-B2 co-culture F-B7 metagenomeEnvironmentalOpen in IMG/M
3300003393Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DDEnvironmentalOpen in IMG/M
3300003860Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - PLP11 PLEnvironmentalOpen in IMG/M
3300004481Combined Assembly of Gp0112041, Gp0112042, Gp0112043EnvironmentalOpen in IMG/M
3300004829Marine water microbial communities from the Pohang Bay, Korea with extracellular vesicles - Pohang-EVsEnvironmentalOpen in IMG/M
3300005805Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USAEnvironmentalOpen in IMG/M
3300006037Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_>0.8_DNAEnvironmentalOpen in IMG/M
3300006484Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535EnvironmentalOpen in IMG/M
3300006803Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNAEnvironmentalOpen in IMG/M
3300006863Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_>0.8_DNAEnvironmentalOpen in IMG/M
3300006875Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNAEnvironmentalOpen in IMG/M
3300006920Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12EnvironmentalOpen in IMG/M
3300007544Estuarine microbial communities from the Columbia River estuary - metaG 1449B-3EnvironmentalOpen in IMG/M
3300007622Estuarine microbial communities from the Columbia River estuary - metaG 1449A-02EnvironmentalOpen in IMG/M
3300007708Estuarine microbial communities from the Columbia River estuary - metaG 1371B-02EnvironmentalOpen in IMG/M
3300007972Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460ABC_3.0umEnvironmentalOpen in IMG/M
3300009056Estuarine microbial communities from the Columbia River estuary - metaG 1449A-3EnvironmentalOpen in IMG/M
3300009152Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaGEnvironmentalOpen in IMG/M
3300009158Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaGEnvironmentalOpen in IMG/M
3300009161Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaGEnvironmentalOpen in IMG/M
3300009163Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaGEnvironmentalOpen in IMG/M
3300009180Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaGEnvironmentalOpen in IMG/M
3300009185Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140625_MF_MetaGEnvironmentalOpen in IMG/M
3300009194Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 RTEnvironmentalOpen in IMG/M
3300009419Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 FTEnvironmentalOpen in IMG/M
3300010885northern Canada Lakes Co-assemblyEnvironmentalOpen in IMG/M
3300011010Freshwater microbial communities from Western Basin Lake Erie, Ontario, Canada - Station 970 - Surface IceEnvironmentalOpen in IMG/M
3300011011Freshwater microbial communities from Western Basin Lake Erie, Ontario, Canada - Station 970 - Top - Depth 1mEnvironmentalOpen in IMG/M
3300011268Sub-surface freshwater microbial communities from San Francisco Estuary Delta, California, USA . Combined Assembly of Gp0173482, Gp0175554, Gp0175555EnvironmentalOpen in IMG/M
3300011334Lotic viral community from Han River, Hwacheon, Gangwon-do, South Korea - DaesungEnvironmentalOpen in IMG/M
3300011336Lotic viral community from Han River, Hwacheon, Gangwon-do, South Korea - PaldangEnvironmentalOpen in IMG/M
3300011339Lotic viral community from Han River, Hwacheon, Gangwon-do, South Korea - HannamEnvironmentalOpen in IMG/M
3300012006Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1101BEnvironmentalOpen in IMG/M
3300012017Freshwater microbial communities from Central Basin Lake Erie, Ontario, Canada - Station 1208 - Top - Depth 1mEnvironmentalOpen in IMG/M
3300012346Freshwater microbial communities from Emily Creek, Ontario, Canada - S29EnvironmentalOpen in IMG/M
3300012348Freshwater microbial communities from Coldwater Creek, Ontario, Canada - S44EnvironmentalOpen in IMG/M
3300012352Freshwater microbial communities from Baxter Creek, Ontario, Canada - S37EnvironmentalOpen in IMG/M
3300017736Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.D.NEnvironmentalOpen in IMG/M
3300020141Freshwater lake microbial communities from Lake Erken, Sweden - P4710_104 megahit1EnvironmentalOpen in IMG/M
3300020151Freshwater lake microbial communities from Lake Erken, Sweden - P4710_202 megahit1EnvironmentalOpen in IMG/M
3300020157Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L224-25mEnvironmentalOpen in IMG/M
3300020159Freshwater lake microbial communities from Lake Erken, Sweden - P4710_108 megahit1EnvironmentalOpen in IMG/M
3300020161Freshwater lake microbial communities from Lake Erken, Sweden - P4710_101 megahit1EnvironmentalOpen in IMG/M
3300020524Freshwater microbial communities from Lake Mendota, WI - 16NOV2012 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300021952Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 20-17 MGEnvironmentalOpen in IMG/M
3300021956Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 29-17 MGEnvironmentalOpen in IMG/M
3300021961Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3DEnvironmentalOpen in IMG/M
3300021962Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649DEnvironmentalOpen in IMG/M
3300024289Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Miss_RepA_8hEnvironmentalOpen in IMG/M
3300024306Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Miss_RepB_8hEnvironmentalOpen in IMG/M
3300024346Whole water sample coassemblyEnvironmentalOpen in IMG/M
3300024495Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepA_8dEnvironmentalOpen in IMG/M
3300024496Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Yuk_RepB_8hEnvironmentalOpen in IMG/M
3300025451Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025635Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025896Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300026573Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Yuk_RepC_8h (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300027365Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 RT (SPAdes)EnvironmentalOpen in IMG/M
3300027659Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF (SPAdes)EnvironmentalOpen in IMG/M
3300027733Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027736Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027746Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140625_MF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027754Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027759Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027764Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MLB.SN (SPAdes)EnvironmentalOpen in IMG/M
3300027785Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN (SPAdes)EnvironmentalOpen in IMG/M
3300027798Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD (SPAdes)EnvironmentalOpen in IMG/M
3300027808Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD (SPAdes)EnvironmentalOpen in IMG/M
3300027899Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - PLP11 PL (SPAdes)EnvironmentalOpen in IMG/M
3300027900Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - BRP12 BR (SPAdes)EnvironmentalOpen in IMG/M
3300028025Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 5H_FCEnvironmentalOpen in IMG/M
3300029349Freshwater microbial communities from Iron Gate Dam, Klamath Basin, California, USA - IR103EnvironmentalOpen in IMG/M
3300031772Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_20EnvironmentalOpen in IMG/M
3300031834Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_0EnvironmentalOpen in IMG/M
3300031873Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G15_0EnvironmentalOpen in IMG/M
3300032053Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_16EnvironmentalOpen in IMG/M
3300032256Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_topEnvironmentalOpen in IMG/M
3300032342Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G10_0EnvironmentalOpen in IMG/M
3300032516Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_0EnvironmentalOpen in IMG/M
3300033995Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23May2014-rr0056EnvironmentalOpen in IMG/M
3300033996Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2016-rr0004EnvironmentalOpen in IMG/M
3300034060Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16May2013-rr0016EnvironmentalOpen in IMG/M
3300034068Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME13Apr2016-rr0031EnvironmentalOpen in IMG/M
3300034093Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME08Jun2014-rr0072EnvironmentalOpen in IMG/M
3300034200Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jul2013-rr0190EnvironmentalOpen in IMG/M
3300034284Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME08Jul2016-rr0075EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI24219J26650_100719433300002098LenticTNRKPYLPPNSYMALGIYVGVPEDTLLQYKADALADLGKAVTSYSDSGTSVNKQFGMPPATRILEINYALSRIDSSRYGGAHTSIQVNWDSRVDL*
JGI24219J26650_101752223300002098LenticMCALGIYVGVPEDTLLQYKAEALAQLGLAVTSYSDSGTSVNKTAGMPVATRILEINYALSRIDSSRYGGAHTSIQVNWDSRVDL*
JGI24219J26650_103381213300002098LenticMLGLFVGLEESVLLQYKQEALADIGKAVTSYSDSGTSVNKTFGLPVVQRIQELNYALSRLDPTRYGGAHTSVQINWDYRVD
JGI25909J50240_112154213300003393Freshwater LakeMALGIYVGVPEDVLLQYKQDALADLGKAVTSYSDSGTSVNKQFGMPPATRILEINYALSRIDSSRYGGAHTSIQVNWDNR
Ga0031658_109140013300003860Freshwater Lake SedimentLGIYVGVPEDVLLQYKQDALGDLGKAITSYSDSGTSVNKVFGMPPAQRIQEINYALSRIDPKKYGGAHTSVQINWDMRVDL*
Ga0069718_1013327523300004481SedimentMPLGLFVGLDEDTLLAYKQQALADMGLAVTSYSDSGTSVNKQWGVPPQTRLLELNFALSKLDPKKYGGAHTSVQITWTDRVDL*
Ga0068515_12369313300004829Marine WaterMPLGLFVGLDEDTLLAYKQQALADMGLSVTSYSDSGTSVNKQWGIPPQTRLLEINFALSKLDSKKYGGAHTSVQKDWTYRVD
Ga0079957_102985243300005805LakeMPLGLFVGLDEDTLLAYKQQALADMGLAVTSYSDSGTSVNKTPGLTVKERIMELNYALSKLDPAKYGGAHTSVQKDWTYRVDL*
Ga0075465_1006797423300006037AqueousMLGIYVGVDEDTLLQYKAEALADMGKAVTSYSDSGTSVNKQFGMPPAARIQEINFALSRIDSTRYGGAHTSVQINWSSRVDL*
Ga0075465_1016595113300006037AqueousMALGIYVGVPEETLLAYKAQALADLGLAVTSYSDSGTSVNKTAGMPVATRILEINYALSKIDSSRYGGAHTSVQINWDYRV
Ga0070744_1001545923300006484EstuarineMALGIYVGVPEDVLLQYKQEALSQLGLAVTSYSDSGTSVNKTAGMPVATRILEINYALSRIDSKRYGGAHTSVQINWDYRVDR*
Ga0075467_1035199523300006803AqueousMALGIYVGVPEETLLAYKAQALADLGLAVTSYSDSGTSVNKTAGMPVATRILEINYALSKIDSSRYGGAHTSVQINWDYRVDR*
Ga0075459_100202633300006863AqueousMLGIYVGVSEDVLLQYKQEALGDLGKAVTSYSDSGTSVNKQFGMPPQQRLLEINYALSRIDPKKYGGAHTSVQKNWDMRVDL*
Ga0075473_1030380823300006875AqueousMALGLFVGLDEDTLLAYKQQALADMGLAVTSYSDSGTSVNKTFGVPPKERLLEINYALSRLDSKKYGGAHTSVQKDWTYRVDL*
Ga0070748_104702323300006920AqueousMALGIYVGVPEATLLAYKAQALADLGLAVTSYSDSGTSVNKTAGMPVATRILEINYALSKIDSSRYGGAHTSVQINWDYRVDR*
Ga0070748_130378223300006920AqueousPEDTLLQYKQEALADMGKAVTSYSDSGTSVNKTFGIPPRERLLEINYALSKIDSKRYGGAHTSVQINWNARVDL*
Ga0102861_104796323300007544EstuarineMLGIYLGVSEDVLLQYKQEALGDLGKAVTSYSDSGTSVNKQFGMPPERRLQEINYALSRIDPKKYGGAHTSIQKNWDMRVDL*
Ga0102863_116698223300007622EstuarineLGIYLGVSEDVLLQYKQEALGDLGKAVTSYSDSGTSVNKQFGMPPERRLQEINYALSRIDPKKYGGAHTSIQKNWDMRVDL*
Ga0102859_120592023300007708EstuarineMALGIYVGVPEETLLAYKAEALADLGKAVTSYSDSGTSVNKQFGMPPATRILEINYALSRISPTLYGGAHTSIQVNWDNRVDL*
Ga0105745_127043513300007972Estuary WaterQYKQEALGDLGKAVTSYSDSGTSVNKQFGMPPERRLQEINYALSRIDPKKYGGAHTSIQKNWDMRVDL*
Ga0102860_104568023300009056EstuarineMLGIYLGVSEDVLLQYKQEALGDLGKAVTSYSDSGTSVNKQFGMPPERRLQEINYALSRIDPKKYGGAHTSVQKNWDMRVDL*
Ga0114980_10003626123300009152Freshwater LakeMCALGIYVGVPEDTLLQYKADALADLGKAVTSYSDSGTSVNKQFGMPPATRILEINYALSRIDSSRYGGAHTSIQVNWDSRVDL*
Ga0114980_1001302863300009152Freshwater LakeMCALGIYVGLPEETLLAYKEEALAQLGLAVTSYSDSGTSVNKTAGMPVAQRIQELNYALSRIDPVRYGGAHTSVQINWSSRVDI*
Ga0114977_10001387163300009158Freshwater LakeMLGIYVGVDEDTLLQYKAEALADLGKAVTSYSDSGTSVNKQFGMPPAARIQEINFALSRIDSSRYGGAHTSVQINWSSRVDL*
Ga0114966_1000365323300009161Freshwater LakeMALGIYVGLPEETLLAYKEEALGQLGLAVTSYSDSGTSVNKTAGMPVATRILEINYALSKIDSSRYGGAHTSVQINWDYRVDR*
Ga0114966_1014809123300009161Freshwater LakeMLGIYVGVDEDTLLQYKAEALADLGKAVTSYSDSGTSVNKQFGMPPAARIQEINFALSRIDSTRYGGAHTSVQINWSSRVDL*
Ga0114970_1003108653300009163Freshwater LakeMALGIYVGVPEETLLAYKAQAIADLGLAVTSYSDSGTSVNKTAGLAPATRILEINYALSRIDSSRYGGAHTSIQVNWDSRVDL*
Ga0114979_1029627123300009180Freshwater LakeQYKQEALADIGKAVTSYSDSGTSVNKTFGLPVAQRIQEINYALSRLDPTRYGGSHTSIQVNWDFRVDL*
Ga0114971_1014992023300009185Freshwater LakeMCALGIYVGVPEDTLLAYKAEALADLGKAITSYSDSGTSVNKQFGLPPATRILEINYALSRIDSSRYGGAHTSIQVNWDSRVDL*
Ga0114971_1050441713300009185Freshwater LakeETNRKPYLPRNSYMCALGIYVGVPEDTLLQYKADALADLGKAVTSYSDSGTSVNKQFGMPPATRILEINYALSRIDSSRYGGAHTSIQVNWDSRVDL*
Ga0114983_101989723300009194Deep SubsurfaceMLGLFVGLPEDTLLQYKQEALADMGKSVTSYSDSGTSVNKQWGIPPQTRLLEINYALSKIDSTRYGGAHTSVQINWNARVDL*
Ga0114982_103515413300009419Deep SubsurfaceMALGIYVGVPEDVLLQYKQEALADLGKAVTSYSDSGTSVNKQFGMPPRDRLLEINYALSRIDPKKYGGAHTSVQITWDSRVDL*
Ga0114982_115636123300009419Deep SubsurfaceMLGIYVGVSEDVLLQYKQEALGDLGKAVTSYSDSGTSVNKQFGMPPQQRLQEINYALSRIDPKKYGGAHTSVQKNWDMRVDL*
Ga0133913_1125750913300010885Freshwater LakeSLKPYPPRNKYMLGLFVGLEESVLLQYKQEALADMGKAVTSYSDSGTSVNKTFGIPPRERLLEINYALSKIDSTRYGGAHTSVQINWTSRVDL*
Ga0133913_1231876323300010885Freshwater LakeMCALGIYVGVPEETLLQYKADALADLGKAVTSYSDSGTSVNKQFGMPPATRILEINYALSRISPTLYGGAHTSIQVNWDSRVDL*
Ga0139557_1000261163300011010FreshwaterMLGLFVGLEESVLLQYKQEALADIGKAVTSYSDSGTSVNKTFGLPVAQRIQEINYALSRLDPTRYGGSHTSIQVNWDFRVDL*
Ga0139556_105659423300011011FreshwaterYKQEALADIGKAVTSYSDSGTSVNKTFGLPVAQRIQEINYALSRLDPTRYGGSHTSIQVNWDFRVDL*
Ga0151620_110492823300011268FreshwaterMPNGLYVGLDEDTLLQYKREALADLGRAVTGYSDSGTSVSKAFGIPPKERLMEINWALAKLDPSKYGAMHTSVQKDWRFRVDC*
Ga0153697_140913300011334FreshwaterLAYKAQALADLGLAVTSYSDSGTSVNKQFGLPPATRILEINYALSRISPTLYGGAHTSIQVNWDSRVDL*
Ga0153703_1436163300011336FreshwaterMALGIYVGVPEDTLLQYKAQALADLGLAVSSYSDSGTSVNKQFGMPPATRILEINYALSRIDSSRYGGAHTSIQVNWDNRVDL*
Ga0153700_1018933300011339FreshwaterMALGIYVGVPEETLLAYKAQALADLGLAVTSYSDSGTSVNKQFGLPPATRILEINYALSRISPTLYGGAHTSIQVNWDSRVDL*
Ga0119955_108017023300012006FreshwaterMLGIYVGVDEDTLLQYKAEALADLGKAVTSYSDSGTSVNKQFGMPPAARIQEINFALSRIDSTRYGGAHTSIQINWSSRVDL*
Ga0153801_104728923300012017FreshwaterMALGIYVGVPEDTLLQYKADALADLGKAVTSYSDSGTSVNKQFGMPPATRILEINYALSRIDSSRYGGAHTSIQVNWDSRVDL*
Ga0157141_100121633300012346FreshwaterMLGIYVGVPEDVLLQYKQEALGDLGKAVTSYSDSGTSVNKQFGMPPAQRLQEINYALSRIDPKKYGGAHTSVQINWDTRVDL*
Ga0157140_10000096163300012348FreshwaterMLGIYVGVPEDVLLQYKQEALADLGKAVTSYSDSGTSVNKQFGMPPAQRLQEINYALSRIDPKKYGGAHTSVQINWDTRVDL*
Ga0157138_100118623300012352FreshwaterMLGIYVGLSEDILLQYKQEALADLGKATMSYSDSGTSVSKAFGMPTAQRIQEINYALSRLDSSRYGGAHTSVQINWDNRVDL*
Ga0157138_100163433300012352FreshwaterMALGLFVGLDEDTLLAYKQQALADLGLAVTSYSDSGTSVNKQWGIPPKERLMELNFALSKLDPKKYGGAHTSVQKEWTYRVDL*
Ga0157138_100220823300012352FreshwaterMLGIYVGVPEDVLLQYKQEALADLGKATMSYSDSGTSVNKAFGLPPAQRIQEINYALSRIDSKRYGGAHTSVQINWDMRVDL*
Ga0181365_107237433300017736Freshwater LakeLPRNSYMCALGIYVGVPEETLLAYKAEALADLGKAITSYSDSGTSVNKQFGLPPATRILEINYALSRISPTLYGGAHTSIQVNWDNRVDL
Ga0181365_117313123300017736Freshwater LakeMCALGIYVGVPEETLLQYKADALADLGKAITSYSDSGTSVNKQFGMPPATRILEINYALSRISPTLYGGAHTSIQVNWDSRVDL
Ga0211732_157600353300020141FreshwaterMPLGLFVGLDEDTLLAYKQQALADMGLAVTSYSDSGTSVNKQWGVPPQTRLLELNFALSKLDPKKYGGAHTSVQITWTDRVDL
Ga0211736_1055521423300020151FreshwaterMPLGLFVGLDEDTLLAYKQQALADMGLSVTSYSDSGTSVNKQWGVPPQTRLLEINFALSKLDSKKYGGAHTSVQITWTDRVDL
Ga0211736_1102136813300020151FreshwaterMPLGLFVGLDEDTLLAYKQQALADMGLSVTSYSDSGTSVNKQWGVPPQTRLLEINWALSKLYSKKYGGAHTSVQITWTDRVDL
Ga0194049_122991613300020157Anoxic Zone FreshwaterMLGIYVGVDEDTLLQYKAEALADLGKAVTSYSDSGTSVNKQFGMPPAARIQEINFALSRIDSTRYGGAHTSVQINWSS
Ga0211734_1000827213300020159FreshwaterMPLGLFVGLDEDTLLAYKQQALADMGLSVTSYSDSGTSVNKQWGVPPQTRLLELNFALSKLDPAKYGGAHTSVQKTWTYRIDL
Ga0211734_1069860723300020159FreshwaterMPNQPELRGNKYMPLGLFVGLDEDTLLAYKQQALADMGLAVTSYSDSGTSVNKQWGVPPQTRMLEINFALSKLDPKKYGGAHTSVQITWTDRVDL
Ga0211726_1076261423300020161FreshwaterMPNQPELRGNKYMPLGLFVGLDEDTLLAYKQQALADMGLAVTSYSDSGTSVNKQWGVPPQTRLLELNFALSKLDPKKYGGAHTSVQITWTDRVDL
Ga0211726_1087216613300020161FreshwaterNKYMPLGLFVGLDEDTLLAYKQQALADMGLAVTSYSDSGTSVNKQWGVPPQTRLLELNFALSKLDPAKYGGAHTSVQKTWTYRIDL
Ga0208858_102900423300020524FreshwaterMLGIYVGVQEDVLLQYKQEALGDLGKAVTSYSDSGTSVNKQFGMPPAQRLQEINYALSRIDPKKYGGAHTSVQITWDSRVDL
Ga0213921_101692413300021952FreshwaterYPLRNKYMLGLFVGLDEDTLLAYKQQALADMGLAVTSYSDSGTSVNKQWGLPPKDRLLEINYALSKIDPKKYGGMHTSVQINWDTRVDL
Ga0213922_100706423300021956FreshwaterMLGIYVGLDEDTLLQYKQEALGQLGLAVTSYSDSGTSVNKTFGMPAQQRILEINYALSRIDSKKYGGMHTSVQINWDTRVDL
Ga0213922_107955923300021956FreshwaterMLGLFVGLDEDTLLAYKQQALADMGLAVTSYSDSGTSVNKQWGLPPKDRLLEINYALSKIDPKKYGGMHTSVQINWDTRVDL
Ga0222714_1004547033300021961Estuarine WaterMPLGLFVGLDEDTLLAYKQQALADMGLSVTSYSDSGTSVNKQWGVPPQTRLLELNFALSKLDPKKYGGAHTSVQKDWTYRVDL
Ga0222714_1022525813300021961Estuarine WaterRKPYPPRNKYMLGIYVGLSEDILLQYKQEALADLGKATMSYSDSGTSVNKQFGMPPAQRIQEINYALSRLDSSRYGGAHTSVQINWDNRVDL
Ga0222713_1015355823300021962Estuarine WaterMLGIYVGLSEDILLQYKQEALADLGKATMSYSDSGTSVNKQFGMPPAQRIQEINYALSRLDSSRYGGAHTSVQINWDNRVDL
Ga0255147_110606613300024289FreshwaterRKPYPPRNKYMLGIYVGLSEDILLQYKQEAMGDLGKAVTSYSDSGTSVNKQFGMPPAQRVQEINYALSRLDPKKYGGAHTSVQINWDSRVDL
Ga0255148_104875223300024306FreshwaterMLGIYVGLSEDILLQYKQEAMGDLGKAVTSYSDSGTSVNKQFGMPPAQRVQEINYALSRLDPKKYGGAHTSVQINWDSRVDL
Ga0244775_1005635133300024346EstuarineMALGIYVGVPEDVLLQYKQEALSQLGLAVTSYSDSGTSVNKTAGMPVATRILEINYALSRIDSKRYGGAHTSVQINWDYRVDR
Ga0255164_106270213300024495FreshwaterILLQYKQEAMGDLGKAVTSYSDSGTSVNKQFGMPPAQRVQEINYALSRLDPKKYGGAHTSVQINWDSRVDL
Ga0255151_102051813300024496FreshwaterLGIYVGLSEDILLQYKQEAMGDLGKAVTSYSDSGTSVNKQFGMPPAQRVQEINYALSRLDPKKYGGAHTSVQINWDSRVDL
Ga0208426_103215323300025451AqueousMLGIYVGVDEDTLLQYKAEALADLGKAVTSYSDSGTSVNKQFGMPPAARIQEINFALSRIDSTRYGGAHTSVQINWSSRVDL
Ga0208147_102908023300025635AqueousMALGLFVGLDEDTLLAYKQQALADMGLAVTSYSDSGTSVNKTFGVPPKERLLEINYALSRLDSKKYGGAHTSVQKDWTYRVDL
Ga0208916_1001664333300025896AqueousMLGIYVGVDEDTLLQYKAEALADMGKAVTSYSDSGTSVNKQFGMPPAARIQEINFALSRIDSTRYGGAHTSVQINWSSRVDL
Ga0208916_1013469323300025896AqueousMALGIYVGVPEETLLAYKAQALADLGLAVTSYSDSGTSVNKTAGMPVATRILEINYALSKIDSSRYGGAHTSVQIN
Ga0255269_105292713300026573FreshwaterEDILLQYKQEALADLGKATMSYSDSGTSVSKAFGMPPAQRIQEINYALSRLDSSRYGGAHTSVQINWDSRVDL
Ga0209300_100615033300027365Deep SubsurfaceMLGLFVGLPEDTLLQYKQEALADMGKSVTSYSDSGTSVNKQWGIPPQTRLLEINYALSKIDSTRYGGAHTSVQINWNARVDL
Ga0208975_102085633300027659Freshwater LenticMALGIYVGVPEDTLLQYKADALADLGKAVTSYSDSGTSVNKQFGMPPATRILEINYALSRIDSSRYGGAHTSIQVNWDSRVDL
Ga0209297_1000336173300027733Freshwater LakeMLGIYVGVDEDTLLQYKAEALADLGKAVTSYSDSGTSVNKQFGMPPAARIQEINFALSRIDSSRYGGAHTSVQINWSSRVDL
Ga0209297_117091623300027733Freshwater LakeMCALGIYVGLPEETLLAYKEEALAQLGLAVTSYSDSGTSVNKTAGMPVAQRIQELNYALSRIDPVRYGGAHTSVQINWSSRVDI
Ga0209190_1000413463300027736Freshwater LakeMALGIYVGVPEETLLAYKAQAIADLGLAVTSYSDSGTSVNKTAGLAPATRILEINYALSRIDSSRYGGAHTSIQVNWDSRVDL
Ga0209597_100257423300027746Freshwater LakeMALGIYVGLPEETLLAYKEEALGQLGLAVTSYSDSGTSVNKTAGMPVATRILEINYALSKIDSSRYGGAHTSVQINWDYRVDR
Ga0209597_126195923300027746Freshwater LakeMCALGIYVGVPEDTLLAYKAEALADLGKAITSYSDSGTSVNKQFGLPPATRILEINYALSRIDSSRYGGAHTSIQVNWDSRVDL
Ga0209596_101987823300027754Freshwater LakeLPPNSYMALGIYVGLPEETLLAYKEEALGQLGLAVTSYSDSGTSVNKTAGMPVATRILEINYALSKIDSSRYGGAHTSVQINWDYRVDR
Ga0209596_124331023300027754Freshwater LakeMCALGIYVGVPEDTLLQYKADALADLGKAVTSYSDSGTSVNKQFGMPPATRILEINYALSRIDSSRYGGAHTSIQVNWDSRVDL
Ga0209296_1002779163300027759Freshwater LakeMLGLFVGLEESVLLQYKQEALADIGKAVTSYSDSGTSVNKTFGLPVAQRIQEINYALSRLDPTRYGGSHTSIQVNWDFRVDL
Ga0209134_1002170923300027764Freshwater LakeMCALGIYVGVPEDTLLQYKADALADLGKAVTSYSDSGTSVNKQFGMPPATRILEINYALSRIDSSRYGGAHTSIQVNWDNRVDL
Ga0209134_1004798523300027764Freshwater LakeMCALGIYVGLPEDTLLAYKEEALGQLGLAVTSYSDSGTSVNKQFGLPPATRIMEINYALSRIDSTRYGGAHTSVQVNWDNRVDL
Ga0209246_1001343223300027785Freshwater LakeMALGIYVGVPEDVLLQYKQDALADLGKAVTSYSDSGTSVNKQFGMPPATRILEINYALSRIDSSRYGGAHTSIQVNWDNRVDL
Ga0209246_1021586523300027785Freshwater LakeMLGLFVGLEESVLLQYKQEALADIGKAVTSYSDSGTSVNKTFGLPVAQRIQEINYALSRLDPIRYGGAHTSVQINWDYRVD
Ga0209353_1016019323300027798Freshwater LakeLAGTSLKPYPPRNKYMLGLFVGLEESVLLQYKQEALADIGKAVTSYSDSGTSVNKTFGLPVAQRIQEINYALSRLDPTRYGGSHTSIQVNWDFRVDL
Ga0209354_1005016113300027808Freshwater LakeGTSLKPSPPRNKYMLGLFVGLEESVLLQYKQEALADIGKAVTSYSDSGTSVNKTFGLPVAQRIQEINYALSRLDPTRYGGSHTSIQVNWDFRVDL
Ga0209354_1019293523300027808Freshwater LakeTSLKPYPPRNKYMLGLFVGLEESVLLQYKQEALADIGKAVTSYSDSGTSVNKTFGLPVAQRIQEINYALSRLDPIRYGGAHTSVQINWDYRVDR
Ga0209354_1040122413300027808Freshwater LakeMALGIYVGVPEETLLAYKAQALADLGLAVTSYSDSGTSVNKQFGLPPATRILEINYALSRISPTLYGGAHTSIQVNWDNRVDL
Ga0209668_1001615613300027899Freshwater Lake SedimentMLGIYVGVPEDVLLQYKQDALGDLGKAITSYSDSGTSVNKVFGMPPAQRIQEINYALSRIDPKKYGGAHTSVQINWDMRVDL
Ga0209668_1087185613300027899Freshwater Lake SedimentMLGLFVGLPEDTLLQYKQEALADMGKSVTSYSDSGTSVNKQWGIPPQTRLLEINYALSKIDSTRYGGAH
Ga0209668_1101493923300027899Freshwater Lake SedimentMLGIYVGVPEDVLLQYKQEALGDLGKAVTSYSDSGTSVNKQFGMPPAQRLQEINYALSRIDPKKYGGAHTSVQKNWDMRVDL
Ga0209253_1003786433300027900Freshwater Lake SedimentMLGIYLGVSEDVLLQYKQEALGDLGKAVTSYSDSGTSVNKQFGMPPQQRLLEINYALSRIDPKKYGGAHTSVQKNWDMRVDL
Ga0209253_1034899923300027900Freshwater Lake SedimentMALGIYVGVPEDVLLQYKQEALADLGKAVTSYSDSGTSVNKQFGMPPRDRLLEINYALSRIDPKRYGGAHTSVQITWDSRVDL
Ga0247723_100230923300028025Deep Subsurface SedimentMLGIYVGVSEDVLLQYKQEALGDLGKAVTSYSDSGTSVNKQFGMPPQQRLQEINYALSRIDPKKYGGAHTSVQKNWDMRVDL
Ga0238435_10145533300029349FreshwaterMLGIYVGVPEDVLLQYKQEALGQLGLAVTSYSDSGTSVNKQFGMPAPQRLQEINYALSRIDPKKYGGAHTSVQITWDTRVDL
Ga0238435_10406023300029349FreshwaterMLGIYLGVSEDVLLQYKQEALGQLGLAVTSYSDSGTSVNKQFGMPPERRLQEINYALSRIDPKKYGGAHTSVQKNWDMRVDL
Ga0315288_1010944823300031772SedimentLPRNSYMCALGIYVGVPEETLLQYKADALADLGKAVTSYSDSGTSVNKQFGMPPATRLLEINYALSRISPTLYGGAHTSIQVNWDSRVDL
Ga0315288_1093786323300031772SedimentMLGLFVGLPEDTLLQYKQEALSQMGLAVTSYSDSGTSVNKTFGLPVAQRIQEINYALSLIDSSRYGGAHTSIQVNWDNRVDL
Ga0315290_1105488123300031834SedimentMCALGIYVGVPEETLLQYKAQALADLGLAVTSYSDSGTSVNKQFGLPPATRILEINYALSRISPTLYGGAHTSIQVNWDNRVDL
Ga0315297_1062877323300031873SedimentYMCALGIYVGVPEETLLQYKAQALADLGLAVTSYSDSGTSVNKQFGLPPATRILEINYALSRISPTLYGGAHTSIQVNWDNRVDL
Ga0315284_1016979523300032053SedimentMCALGIYVGVPEETLLQYKADALADLGKAVTSYSDSGTSVNKQFGMPPATRLLEINYALSRISPTLYGGAHTSIQVNWDSRVDL
Ga0315271_1036537723300032256SedimentLGIYVGVPEETLLAYKAQALADLGLAVTSYSDSGTSVNKQFGLPPATRILEINYALSRISPTLYGGAHTSIQVNWDNRVDL
Ga0315286_1115667533300032342SedimentCALGIYVGVPEETLLQYTAQALADLGLSVTSYSDSGTSVNKQFGLPPATRILEINYALSRISPTLYGGAHTSIQVNWDNRVDL
Ga0315273_1176886413300032516SedimentTLLAYKAQALADLGLAVTSYSDSGTSVNKQFGLPPATRILEINYALSRISPTLYGGAHTSIQVNWDNRVDL
Ga0315273_1195984223300032516SedimentMALGIYVGVPEETLLAYKAQALADLGLAVTSYSDSGTSVNKQFGLPPATRILEINYALSRISPTLYGG
Ga0335003_0072590_1_2253300033995FreshwaterPEDVLLQYKQEALGDLGKAVTSYSDSGTSVNKQFGMPPAQRLQEINYALSRIDPKKYGGAHTSVQITWDSRVDL
Ga0334979_0156645_1014_12623300033996FreshwaterMLGIYVGVPEDVLLQYKQEALADLGKAVTSYSDSGTSVNKQFGMPPDRRIQEINYALSRIDPKKYGGAHTSVQINWDTRVDL
Ga0334983_0004510_3869_41203300034060FreshwaterMALGIYVGVPEETLLAYKAQALADLGLAVTSYSDYGTSVNKQFGLPPATRILEINYALSRISPTLYGGAHTSIQVNWDNRVDL
Ga0334990_0001566_10649_108973300034068FreshwaterMLGIYVGVPEDVLLQYKQEALGDLGKAVTSYSDSGTSVNKQFGLPPAQRIQEINYALSRIDSKRYGGAHTSVQKNWDMRVDL
Ga0335012_0153303_1046_12523300034093FreshwaterMLGIYVGVPEDVLLQYKQEALGDLGKAVTSYSDSGTSVNKQFGMPPAQRLQEINYALSRIDPKKYGGAH
Ga0335065_0139574_1315_15633300034200FreshwaterMLGIYVGVPEDVLLQYKQEALGDLGKAVTSYSDSGTSVNKQFGMPPAQRLQEINYALSRIDPKKYGGAHTSVQINWDTRVDL
Ga0335065_0453538_3_2513300034200FreshwaterMLGIYVGVSEDVLLQYKQEALGQLGLAVTSYSDSGTSVNKQFGMPPERRLQEINYALSRIDPKKYGGAHTSVQITWDSRVDL
Ga0335013_0569185_216_4643300034284FreshwaterMLGIYVGVPEDVLLQYKQEALADLGKAVTSYSDSGTSVNKQFGMPPDRRIQEINYALSRIDPKKYGGAHTSVQKNWDMRVDL


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.