NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F076307

Metagenome / Metatranscriptome Family F076307

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F076307
Family Type Metagenome / Metatranscriptome
Number of Sequences 118
Average Sequence Length 41 residues
Representative Sequence MPSSAVRTFTDPDDYTAAIRQGTSELTVTERGDFTAKLT
Number of Associated Samples 90
Number of Associated Scaffolds 118

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 96.40 %
% of genes near scaffold ends (potentially truncated) 92.37 %
% of genes from short scaffolds (< 2000 bps) 86.44 %
Associated GOLD sequencing projects 81
AlphaFold2 3D model prediction Yes
3D model pTM-score0.32

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (58.475 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(46.610 % of family members)
Environment Ontology (ENVO) Unclassified
(58.475 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(50.847 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 13.43%    β-sheet: 0.00%    Coil/Unstructured: 86.57%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.32
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 118 Family Scaffolds
PF12833HTH_18 72.03
PF00501AMP-binding 0.85
PF07690MFS_1 0.85
PF01609DDE_Tnp_1 0.85
PF13463HTH_27 0.85
PF14559TPR_19 0.85
PF08388GIIM 0.85
PF03992ABM 0.85
PF13683rve_3 0.85
PF13495Phage_int_SAM_4 0.85
PF08299Bac_DnaA_C 0.85

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 118 Family Scaffolds
COG0593Chromosomal replication initiation ATPase DnaAReplication, recombination and repair [L] 0.85
COG3039Transposase and inactivated derivatives, IS5 familyMobilome: prophages, transposons [X] 0.85
COG3293TransposaseMobilome: prophages, transposons [X] 0.85
COG3385IS4 transposase InsGMobilome: prophages, transposons [X] 0.85
COG5421TransposaseMobilome: prophages, transposons [X] 0.85
COG5433Predicted transposase YbfD/YdcC associated with H repeatsMobilome: prophages, transposons [X] 0.85
COG5659SRSO17 transposaseMobilome: prophages, transposons [X] 0.85


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms58.47 %
UnclassifiedrootN/A41.53 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2035918004|FACENC_F56XM5W01BM0JLAll Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0017520Open in IMG/M
3300004091|Ga0062387_100353403All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria971Open in IMG/M
3300004092|Ga0062389_102601520All Organisms → cellular organisms → Bacteria → Proteobacteria673Open in IMG/M
3300004152|Ga0062386_100774447All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales790Open in IMG/M
3300005332|Ga0066388_107109462All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria563Open in IMG/M
3300005363|Ga0008090_15218699All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0017650Open in IMG/M
3300005556|Ga0066707_10436489All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria850Open in IMG/M
3300005764|Ga0066903_101310175All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1354Open in IMG/M
3300005764|Ga0066903_103024193All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0017911Open in IMG/M
3300006176|Ga0070765_100314071All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD00171451Open in IMG/M
3300006804|Ga0079221_10947877All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria638Open in IMG/M
3300006954|Ga0079219_10926658All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0017709Open in IMG/M
3300009012|Ga0066710_104817073Not Available505Open in IMG/M
3300010359|Ga0126376_11704004All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria665Open in IMG/M
3300010361|Ga0126378_12096481All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria645Open in IMG/M
3300010376|Ga0126381_101964218All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria843Open in IMG/M
3300010376|Ga0126381_102902646All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium683Open in IMG/M
3300010376|Ga0126381_103621502Not Available605Open in IMG/M
3300010379|Ga0136449_102059297All Organisms → cellular organisms → Bacteria840Open in IMG/M
3300011120|Ga0150983_11755777All Organisms → cellular organisms → Bacteria762Open in IMG/M
3300011271|Ga0137393_10368521All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1228Open in IMG/M
3300012198|Ga0137364_11076165All Organisms → cellular organisms → Bacteria606Open in IMG/M
3300012210|Ga0137378_11362567All Organisms → cellular organisms → Bacteria624Open in IMG/M
3300012362|Ga0137361_10897354All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria804Open in IMG/M
3300012971|Ga0126369_10865185Not Available988Open in IMG/M
3300014495|Ga0182015_10882394Not Available561Open in IMG/M
3300016270|Ga0182036_11551700All Organisms → cellular organisms → Bacteria557Open in IMG/M
3300016319|Ga0182033_10025471All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales3689Open in IMG/M
3300016319|Ga0182033_10487884All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1057Open in IMG/M
3300016341|Ga0182035_10872531Not Available793Open in IMG/M
3300016341|Ga0182035_12014727All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria525Open in IMG/M
3300016357|Ga0182032_11966134All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria513Open in IMG/M
3300016371|Ga0182034_11811138Not Available538Open in IMG/M
3300016404|Ga0182037_10244662Not Available1416Open in IMG/M
3300016404|Ga0182037_11533813Not Available591Open in IMG/M
3300016445|Ga0182038_10667876All Organisms → cellular organisms → Bacteria902Open in IMG/M
3300016445|Ga0182038_10941333Not Available763Open in IMG/M
3300018060|Ga0187765_10670450Not Available677Open in IMG/M
3300020582|Ga0210395_10489287Not Available926Open in IMG/M
3300021170|Ga0210400_10770669Not Available789Open in IMG/M
3300021171|Ga0210405_10441702All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1023Open in IMG/M
3300021178|Ga0210408_10326214All Organisms → cellular organisms → Bacteria1224Open in IMG/M
3300021178|Ga0210408_11106596All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria609Open in IMG/M
3300021477|Ga0210398_11613768All Organisms → cellular organisms → Bacteria502Open in IMG/M
3300021478|Ga0210402_11588343All Organisms → cellular organisms → Bacteria581Open in IMG/M
3300021560|Ga0126371_11156250All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales912Open in IMG/M
3300021953|Ga0213880_10178605All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria590Open in IMG/M
3300027812|Ga0209656_10141665All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1215Open in IMG/M
3300027812|Ga0209656_10209696All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria940Open in IMG/M
3300027829|Ga0209773_10046238All Organisms → cellular organisms → Bacteria → Proteobacteria1750Open in IMG/M
3300027829|Ga0209773_10418138Not Available555Open in IMG/M
3300028906|Ga0308309_10877839All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium779Open in IMG/M
3300031231|Ga0170824_105528871Not Available633Open in IMG/M
3300031543|Ga0318516_10635165Not Available608Open in IMG/M
3300031543|Ga0318516_10683394All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium583Open in IMG/M
3300031561|Ga0318528_10533843Not Available630Open in IMG/M
3300031572|Ga0318515_10214633Not Available1032Open in IMG/M
3300031573|Ga0310915_10451683All Organisms → cellular organisms → Bacteria913Open in IMG/M
3300031573|Ga0310915_10543877Not Available824Open in IMG/M
3300031573|Ga0310915_11085236Not Available556Open in IMG/M
3300031680|Ga0318574_10154531Not Available1304Open in IMG/M
3300031680|Ga0318574_10932264All Organisms → cellular organisms → Bacteria509Open in IMG/M
3300031719|Ga0306917_11473918Not Available524Open in IMG/M
3300031723|Ga0318493_10518305Not Available660Open in IMG/M
3300031724|Ga0318500_10369120Not Available711Open in IMG/M
3300031724|Ga0318500_10649693All Organisms → cellular organisms → Bacteria536Open in IMG/M
3300031736|Ga0318501_10724012Not Available549Open in IMG/M
3300031747|Ga0318502_10256910All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1021Open in IMG/M
3300031763|Ga0318537_10049270Not Available1526Open in IMG/M
3300031778|Ga0318498_10193480Not Available923Open in IMG/M
3300031778|Ga0318498_10250566All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria798Open in IMG/M
3300031780|Ga0318508_1067089Not Available968Open in IMG/M
3300031796|Ga0318576_10031109All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales2209Open in IMG/M
3300031799|Ga0318565_10217147All Organisms → cellular organisms → Bacteria930Open in IMG/M
3300031819|Ga0318568_10110378All Organisms → cellular organisms → Bacteria → Proteobacteria1654Open in IMG/M
3300031833|Ga0310917_10304581All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1078Open in IMG/M
3300031879|Ga0306919_11537533All Organisms → cellular organisms → Bacteria500Open in IMG/M
3300031890|Ga0306925_10558216All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1213Open in IMG/M
3300031893|Ga0318536_10046678All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2080Open in IMG/M
3300031896|Ga0318551_10246234All Organisms → cellular organisms → Bacteria998Open in IMG/M
3300031897|Ga0318520_10674036All Organisms → cellular organisms → Bacteria645Open in IMG/M
3300031910|Ga0306923_10153889All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD00172626Open in IMG/M
3300031912|Ga0306921_10140342All Organisms → cellular organisms → Bacteria → Proteobacteria2822Open in IMG/M
3300031912|Ga0306921_10775862All Organisms → cellular organisms → Bacteria1096Open in IMG/M
3300031941|Ga0310912_11193387Not Available579Open in IMG/M
3300031942|Ga0310916_10835944Not Available774Open in IMG/M
3300031942|Ga0310916_11206302All Organisms → cellular organisms → Bacteria625Open in IMG/M
3300031942|Ga0310916_11649290Not Available520Open in IMG/M
3300031946|Ga0310910_10405626All Organisms → cellular organisms → Bacteria1080Open in IMG/M
3300031946|Ga0310910_10421212Not Available1058Open in IMG/M
3300031981|Ga0318531_10439354Not Available591Open in IMG/M
3300032001|Ga0306922_10571068Not Available1201Open in IMG/M
3300032025|Ga0318507_10137397Not Available1040Open in IMG/M
3300032025|Ga0318507_10332422Not Available661Open in IMG/M
3300032039|Ga0318559_10135029All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1114Open in IMG/M
3300032043|Ga0318556_10000556All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales10792Open in IMG/M
3300032043|Ga0318556_10156606Not Available1177Open in IMG/M
3300032059|Ga0318533_10118420All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1849Open in IMG/M
3300032059|Ga0318533_10901017All Organisms → cellular organisms → Bacteria649Open in IMG/M
3300032066|Ga0318514_10597717Not Available587Open in IMG/M
3300032068|Ga0318553_10198090Not Available1047Open in IMG/M
3300032090|Ga0318518_10013309All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales3466Open in IMG/M
3300032094|Ga0318540_10037872All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2119Open in IMG/M
3300032094|Ga0318540_10428435Not Available639Open in IMG/M
3300032180|Ga0307471_100723061All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1161Open in IMG/M
3300032180|Ga0307471_102424831All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria663Open in IMG/M
3300032261|Ga0306920_100812929Not Available1371Open in IMG/M
3300032828|Ga0335080_11374383All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium703Open in IMG/M
3300033158|Ga0335077_11536694Not Available636Open in IMG/M
3300033290|Ga0318519_10012163Not Available3577Open in IMG/M
3300033290|Ga0318519_10190534All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1166Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil46.61%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil18.64%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil6.78%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil5.93%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil3.39%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil2.54%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil1.69%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil1.69%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil1.69%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil1.69%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.85%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil0.85%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil0.85%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.85%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil0.85%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland0.85%
PalsaEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa0.85%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil0.85%
Exposed RockEnvironmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Exposed Rock0.85%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere0.85%
Tropical Rainforest SoilEnvironmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Tropical Rainforest Soil0.85%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2035918004Soil microbial communities from sample at FACE Site 2 North Carolina CO2-EnvironmentalOpen in IMG/M
3300004091Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3EnvironmentalOpen in IMG/M
3300004092Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3EnvironmentalOpen in IMG/M
3300004152Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3EnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005363Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome F II A100 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300005556Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156EnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300006176Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5EnvironmentalOpen in IMG/M
3300006358Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2Host-AssociatedOpen in IMG/M
3300006804Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200EnvironmentalOpen in IMG/M
3300006954Agricultural soil microbial communities from Georgia to study Nitrogen management - GA ControlEnvironmentalOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300010359Tropical forest soil microbial communities from Panama - MetaG Plot_15EnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010379Sb_50d combined assemblyEnvironmentalOpen in IMG/M
3300011120Combined assembly of Microbial Forest Soil metaTEnvironmentalOpen in IMG/M
3300011271Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaGEnvironmentalOpen in IMG/M
3300012198Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012210Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012362Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaGEnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300014495Permafrost microbial communities from Stordalen Mire, Sweden - 712P3M metaGEnvironmentalOpen in IMG/M
3300016270Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080EnvironmentalOpen in IMG/M
3300016319Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00HEnvironmentalOpen in IMG/M
3300016341Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170EnvironmentalOpen in IMG/M
3300016357Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000EnvironmentalOpen in IMG/M
3300016371Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172EnvironmentalOpen in IMG/M
3300016404Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082EnvironmentalOpen in IMG/M
3300016445Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108EnvironmentalOpen in IMG/M
3300018060Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MGEnvironmentalOpen in IMG/M
3300020581Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-MEnvironmentalOpen in IMG/M
3300020582Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-OEnvironmentalOpen in IMG/M
3300021170Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-MEnvironmentalOpen in IMG/M
3300021171Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-MEnvironmentalOpen in IMG/M
3300021178Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-MEnvironmentalOpen in IMG/M
3300021477Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-OEnvironmentalOpen in IMG/M
3300021478Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-MEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300021953Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R07EnvironmentalOpen in IMG/M
3300027812Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 (SPAdes)EnvironmentalOpen in IMG/M
3300027829Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM1 (SPAdes)EnvironmentalOpen in IMG/M
3300028906Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2)EnvironmentalOpen in IMG/M
3300031231Coassembly Site 11 (all samples) - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031543Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20EnvironmentalOpen in IMG/M
3300031561Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26EnvironmentalOpen in IMG/M
3300031572Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19EnvironmentalOpen in IMG/M
3300031573Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111EnvironmentalOpen in IMG/M
3300031680Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22EnvironmentalOpen in IMG/M
3300031719Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2)EnvironmentalOpen in IMG/M
3300031723Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23EnvironmentalOpen in IMG/M
3300031724Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20EnvironmentalOpen in IMG/M
3300031736Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21EnvironmentalOpen in IMG/M
3300031744Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2)EnvironmentalOpen in IMG/M
3300031747Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22EnvironmentalOpen in IMG/M
3300031763Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f29EnvironmentalOpen in IMG/M
3300031778Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f24EnvironmentalOpen in IMG/M
3300031780Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f21EnvironmentalOpen in IMG/M
3300031796Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24EnvironmentalOpen in IMG/M
3300031799Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f21EnvironmentalOpen in IMG/M
3300031805Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23EnvironmentalOpen in IMG/M
3300031819Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21EnvironmentalOpen in IMG/M
3300031833Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178EnvironmentalOpen in IMG/M
3300031879Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2)EnvironmentalOpen in IMG/M
3300031890Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2)EnvironmentalOpen in IMG/M
3300031893Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28EnvironmentalOpen in IMG/M
3300031896Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19EnvironmentalOpen in IMG/M
3300031897Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16EnvironmentalOpen in IMG/M
3300031910Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2)EnvironmentalOpen in IMG/M
3300031912Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2)EnvironmentalOpen in IMG/M
3300031941Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080EnvironmentalOpen in IMG/M
3300031942Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176EnvironmentalOpen in IMG/M
3300031946Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172EnvironmentalOpen in IMG/M
3300031981Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f25EnvironmentalOpen in IMG/M
3300032001Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2)EnvironmentalOpen in IMG/M
3300032025Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20EnvironmentalOpen in IMG/M
3300032039Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21EnvironmentalOpen in IMG/M
3300032043Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24EnvironmentalOpen in IMG/M
3300032059Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27EnvironmentalOpen in IMG/M
3300032066Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18EnvironmentalOpen in IMG/M
3300032068Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21EnvironmentalOpen in IMG/M
3300032076Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2)EnvironmentalOpen in IMG/M
3300032090Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22EnvironmentalOpen in IMG/M
3300032094Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f25EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M
3300032828Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4EnvironmentalOpen in IMG/M
3300033158Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1EnvironmentalOpen in IMG/M
3300033290Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
FACENCA_29963802035918004SoilMPSSAVRTFTDPDDYAAAQRGVKSELTLIGRGHFTAK
Ga0062387_10035340323300004091Bog Forest SoilMPSSAVRTFTDSDDYTSAIRNTRAELTVIGRGHFTASVTR
Ga0062389_10260152023300004092Bog Forest SoilVPSNVLRTFSDPDDYAETIGATRAEMTVMGRGKFTAQLTRIDLHRLRMIQFSDNLP
Ga0062386_10077444713300004152Bog Forest SoilMLSSAVRTFTDPDAYAAAIRAGPVELTVTENTAFTAKLTRVDLHRLWMQ
Ga0066388_10710946213300005332Tropical Forest SoilMPSSVVRTFSDADDYVAAIRQGTVEATVTGRGDFAAKLTKIDLHRLW
Ga0008090_1521869913300005363Tropical Rainforest SoilMPSSAVRTFSDPDEYAAAIRAANPELTVTEPGKFTAKLIRIDL
Ga0066707_1043648923300005556SoilMPASVVQTFTDPDDYAAAIHPSVVALTVSGRGHFTAR
Ga0066903_10131017533300005764Tropical Forest SoilMPSSAVLTFSDPDDFATAVRGGRVEFTITGRGVFAAKIVR
Ga0066903_10302419313300005764Tropical Forest SoilMPSSAVRTFSDPDEYAAAIRQGNVELTITERGHFEAKLIRIDLPRL
Ga0070765_10031407113300006176SoilMPSSAVHTFTDPDDYAAAIRAGTVELTVNGRGDFTAKL
Ga0068871_10195942623300006358Miscanthus RhizosphereMPSTTVRTFTDPDELAASARQGNVELTVTGKGTFRTELVRIDLHR
Ga0079221_1094787723300006804Agricultural SoilMPSSAVRTFTDPDDYAAAIRHGTYNLTVTECGDFGAKLTRIDLHRL*
Ga0079219_1092665813300006954Agricultural SoilMLSSAVRTFSDPDQYAAAIRATTVELTEIGSKQFNANLIRID
Ga0066710_10481707313300009012Grasslands SoilMPSSAVRTFTDPHDYAAAIRATRAELTVMGRGRFTAKLTRIDLHRMEMPRFFDNL
Ga0126376_1170400423300010359Tropical Forest SoilMPSSTARTFSDPDDYAAAIRQGTVETTITERGCFNA
Ga0126378_1209648133300010361Tropical Forest SoilMPSSAVRTFTDPDDYAAAIRATKAEVVVTGWGQFTA
Ga0126381_10196421813300010376Tropical Forest SoilMPSSAVQTFSDPDDYAASIRAGTAELTVTERGQFAAKLVKIDLHRLW
Ga0126381_10290264623300010376Tropical Forest SoilMPSSAVRTFTDPYEYAAEFRATTAEWTITERGQFTAKLTRI
Ga0126381_10357981323300010376Tropical Forest SoilMPSSAVHTFTDPDDYTAAFRTTTAECAITGRGRFAA
Ga0126381_10362150213300010376Tropical Forest SoilMPSSAVRTFSDPDDYAAAIRATKAEVVITGRGQFT
Ga0136449_10205929713300010379Peatlands SoilMPSSNVRSFTDPDRYAAAIRQGMVEMTVTGRGQFAAQ
Ga0150983_1175577713300011120Forest SoilMPSSAVRTFTDPDDYATSIRATRAEMTVMGRGHFTANLT
Ga0137393_1036852143300011271Vadose Zone SoilMPSSSVRRFSDPDDYAASIRATRAELTVVGRGSFTAKLV
Ga0137364_1107616513300012198Vadose Zone SoilMPSSAVRTFSDPDDYAAAIRQGTYELTVTERGDFTASLTRIDLHH
Ga0137378_1136256723300012210Vadose Zone SoilMSSSAVRTFTDPDDYAASARATRAELTVTGRGEFAA
Ga0137361_1089735413300012362Vadose Zone SoilMPSSAVRTFIDSDDYVSAIRATRAEMTVTGRGRFRAKL
Ga0126369_1086518513300012971Tropical Forest SoilMPSSAVQTFSDPDDYAVAIRQGTVETTITERGRFNAKI
Ga0182015_1088239413300014495PalsaMLSSAVRTFTDPDDYAASVRATTVELTIIERGLFAAKL
Ga0182036_1155170023300016270SoilMPSSAVRTFTDPDEYAAVIRQGTVEPTTTGHGQFTAKLTRIDL
Ga0182033_1002547113300016319SoilMPSSAVRTFTDHDEYAAVIRNTTAEMTITGRGVFNAKLT
Ga0182033_1048788423300016319SoilMPSSAVRTYSDPEDYVAGIRQGTYELTVTERGRFAAKLTRIDLHRLWMQ
Ga0182035_1087253113300016341SoilMPSSVVQTFTDPDDYATAIRNTKAELTITERGHFSGKLTRIDLH
Ga0182035_1201472713300016341SoilMPESAVRTFSDPDDYAASIRSGSTEVTVVGSGQFTAKLISLGL
Ga0182032_1196613423300016357SoilMPSSAVRTFSDPEEYAASTRATRAELTVTGRGRFTAKLIRI
Ga0182034_1181113813300016371SoilMPSNAVQTFTDPDDFEASIRAGEVEVTVTGRGQFCAEATRIE
Ga0182037_1024466233300016404SoilMPSSVVQTFTDPDDYATAIRNTKAELTITERGHFSGKL
Ga0182037_1153381323300016404SoilMPESAVRTFSDPDDYAASITGGTVQLTAVERGDFHAKLTGIYL
Ga0182038_1066787623300016445SoilMPSSAVRTFTDPDEYAAVIRNTTAEMTITGRGVFNAK
Ga0182038_1094133313300016445SoilMPSSAVRTFSDPDDYASWIRNTQAEMTVTGRGQFAGKLTRIDFHRLWIQR
Ga0187765_1067045013300018060Tropical PeatlandMPSSAVRTFSDPDQYAASIRQGTVDLTITERGQFKAKLVRI
Ga0210399_1006692243300020581SoilMPLSAMQTFSDPDEYAAAIRAANTEFAVTGRGHFTAKLIR
Ga0210395_1048928723300020582SoilMPSSAVRTFTDPDDYAAAIRQGTYELTVTERGHFTAE
Ga0210400_1077066913300021170SoilMPDSAVRTFTDADDYGSAMRATRAEMTVMGRGRFTA
Ga0210405_1044170223300021171SoilMPSSAVRTFTDPDDYTAAIRQGTSELTVTERGDFTAKLT
Ga0210408_1032621413300021178SoilMPLSAVRTFTDPDDYAAAIRQGTYELTVTERGEFTAKLTRI
Ga0210408_1110659613300021178SoilMPSSAVRTFTDPDDYAAAQRGVKSELTVIGRGHFTAK
Ga0210398_1161376813300021477SoilVPSSVVRTFTDPDDYTTSLRGVTSELTILGRGCFAAQLVGVNLQ
Ga0210402_1158834323300021478SoilMPSSTVRNFTDPDDYAAAIRQGTHELTVTERGHFTATLTRIDLHRL
Ga0126371_1115625013300021560Tropical Forest SoilMPSSAVRRFADPDDYAAAIRQGNVELAVTQRGVFAAK
Ga0213880_1017860523300021953Exposed RockMPSSAVRTFSDPYDYAAAMRAATTELTVTGRGRFAAKLIRIDLHRMWMQRLSDSLPRVLHAAH
Ga0209656_1014166513300027812Bog Forest SoilMPSSDVRAFSDPDDYATAIRATKAEMTVTGRGRFAAKLVRIDLH
Ga0209656_1020969623300027812Bog Forest SoilMPSSMVGSFTDPDDYAAAIRATTAELTVTGRGQFA
Ga0209773_1004623813300027829Bog Forest SoilMPSSTVRTFTDPEDYAAAIRQGTVELTVTRPGNFTANL
Ga0209773_1041813823300027829Bog Forest SoilMPSSAVRNFSDPDDYAAAIRATTSELTLVGRGRFT
Ga0308309_1087783913300028906SoilMPSSAVRTFTDPDDYAAAQRGVKSELTLIGRGHFTA
Ga0170824_10552887113300031231Forest SoilMPSSAVRTFSHPDDYTAAMRATRAELTVTGRGDFTAKLIR
Ga0318516_1063516523300031543SoilMPSSVVQTFTDPDDYATAIRNTKAELTITERGHFSGKLTRIDLHRL
Ga0318516_1068339423300031543SoilMPSSAVRTFTDPDDYAASMRRATAVLTVTEHGDFNAKLSRIDLH
Ga0318528_1053384313300031561SoilMPSSAVRTFTDPDDYATAFRTTRAECTITGRGRFTAKL
Ga0318515_1021463313300031572SoilMPSSVVRTFSDADDYAAAIRQGTVEVTVTGRGNFAAKLTK
Ga0310915_1045168313300031573SoilMPSSAVRTYSDPEDYVAGIRQGTYELTVTERGRFTAKLTRIDLH
Ga0310915_1054387713300031573SoilMPSSVVRTFSDADDYAAAIRQGTVEVTVTGRGNFAAKLTKIDLHRL
Ga0310915_1108523613300031573SoilMPSSAVRTFTDPDEYAAVIRQGTVEPTTTGHGQFTAKLTRIDLHRLWM
Ga0318574_1015453123300031680SoilMPSSAVRTFSDPDDYAASIRGGTVEMTVVGRGDFSAKLTRIQLHRLW
Ga0318574_1093226413300031680SoilMPSSAVRTYSDPEDYVAGIRQGTYELTVTERGRFAAKLTRIDLH
Ga0306917_1147391813300031719SoilMPSSAVRTFSDPDDYAASIRNTKAEVTVTGRGQFTA
Ga0318493_1051830513300031723SoilMPSSALRTFSDPDDYAALIRNTKAEFTITERGHFSAKLTRID
Ga0318500_1036912023300031724SoilMPSSALRTFSDPDDYAALIRNTKAEFTITERGHFSA
Ga0318500_1064969323300031724SoilMPSSAVRTFSDPDEFSASVRGGTLESTITERGNFNATQVRIDL
Ga0318501_1072401223300031736SoilMPSSAVRTFTDPDDYADLIRNTKAEFTITERGHFS
Ga0306918_1144654113300031744SoilMPSSAVCKFTDPDDYTAAILGTTAELTVTERGDFAAEIVRI
Ga0318502_1025691013300031747SoilMPSSAVRTFSDPDDYAASIRGTSAEMTVMGRGHFRAKLIQ
Ga0318537_1004927023300031763SoilMPSSAVRTFTDADDYAACIRNSTAEMTITGRGIFNAKLTRIDLHRL
Ga0318498_1019348013300031778SoilMPSSALRTFSDPDDYAALIRNTKAEFTITERGHFSAKLTRIDLHRLWMQ
Ga0318498_1025056623300031778SoilMPSSAVQIFSDPDDYASSIRATTIEMMVMERGRFTAK
Ga0318508_106708923300031780SoilMPSSALRTFSDPDDYAALIRNTKAEFTITERGHFSAKLT
Ga0318576_1003110933300031796SoilMPSSALRTFSDPDDYAALIRNTKAEFTITERGHFSAKLTRI
Ga0318565_1021714723300031799SoilMPSSAVRTFIDSDDYAAAIRATRAEITVTGRGHFTAKLTGSTCIAC
Ga0318497_1039496713300031805SoilMPSSTVRTFTDPDAYAAAFRAGTHELTITKRGQFAAK
Ga0318568_1011037833300031819SoilMPSSVVRTFSDADDYAAAIRQGTVEVTVTGRGNFAAKLTKIDLHRLWM
Ga0310917_1030458123300031833SoilMPSSAVRTFTDPDDYAASIRAGEVELTVIGRGQFSAKGTR
Ga0306919_1153753313300031879SoilMPSSAVRTYSDPEDYVAGIRQGTYELTVTERGRFA
Ga0306925_1055821613300031890SoilMPSSAVRTFSDPDDYAASIRNTKAEVTVTGRGQFTAKIISIGLHRLW
Ga0318536_1004667833300031893SoilMPSSAVRTFSDPDDYAAYIRNSTAEMIITGRGAFKAKLTRIDLHSLW
Ga0318551_1024623413300031896SoilMPSSAVRTYSDPEDYVAGIRQGTYELTVTERGRFTAKLTRIDLHRLW
Ga0318520_1067403623300031897SoilMPSSAVRTFTDPDEYAAVIRQGTVEPTTTGQGQFTA
Ga0306923_1015388933300031910SoilMPSSAVRTFTEPDDYAAAIRYSTTEITVTGRGQFAAKFIRVD
Ga0306921_1014034243300031912SoilMPSSAVRTFTDADDYAACIRNSTAEMTITGRGIFNAKLT
Ga0306921_1077586213300031912SoilMLSSDVRSFTDPDSYAAAIRQGTVELTLTGRGQFAAQLI
Ga0306921_1218549713300031912SoilMPSSAVRTFTDPDEYAASIRGGEVELTVAARGDFRAKLIRIDLHCLWM
Ga0310912_1119338713300031941SoilMPSSAVQTFSDPEAYTASIRSTKAELTVLGRGQFAAKLSRI
Ga0310916_1083594413300031942SoilMPSSAVRTFTDPDDYAALIRNTKAEFTITERGHFSAKLTRID
Ga0310916_1120630223300031942SoilMPSSAVRTYSDPEDYVAGIRQGTYELTVTERGRFTAKLTRIDL
Ga0310916_1164929013300031942SoilMPESAVRTFSDPDDYAASHFSLSEVTLVGRGRFTAKLTRID
Ga0310910_1040562623300031946SoilMPSSAVRTYSDPEDYVAGIRQGTYELTVTERGRFTAK
Ga0310910_1042121213300031946SoilMPSSVVQTFTDPDDYATAIRNTKAELTITERGHFSGKLTRID
Ga0318531_1043935413300031981SoilMPSSAVRTFSDPDDYATSIRATKAEVTVSGRGKFTAK
Ga0306922_1057106823300032001SoilMPESAVRTFSDPDDYAASITGGTVQLTAVERGDFHAKLTGIYLQ
Ga0318507_1013739713300032025SoilMPSSAVRTFTDPDEYVAVIRQGTVEPTTTGHGQFTAKLTRIDLHRLW
Ga0318507_1033242223300032025SoilMPSSAVRTFTDADDYAACIRNSTAEMTITGRGIFNAKLTRIDLHR
Ga0318559_1013502913300032039SoilMPSSAVRTYSDPEDYVAGIRQGTYELTVTERGRFTAKLTR
Ga0318556_10000556153300032043SoilMPSSAVRTFSDPDDYAASIRGGTVEMTVVGRGDFSAKLTRIQLHRL
Ga0318556_1015660613300032043SoilMPSSALRTFSDPDDYAALIRNTKAEFTITERGHFSAKLTRIDLHR
Ga0318533_1011842043300032059SoilMPSTAVRTFSDPDDYAASIRGTSAEMTVVGRGHFKAKLTQIELH
Ga0318533_1090101713300032059SoilMPSSAVRTYSDPEDYVAGIRQGTYELTVTERGRFTAKLT
Ga0318514_1059771723300032066SoilMPSSAVRTFTDLDDYAACIRNTTAEMTITGRGVFNAKLTRIDLHRLW
Ga0318553_1019809013300032068SoilMPSSAVRTFSDPDDYAASIRGGTVEMTVVGRGDFSA
Ga0306924_1143921723300032076SoilMPSSAVHTFTDPDDYTAAFRTTTAECAITGRGRFAAKL
Ga0318518_1001330943300032090SoilMPSSAVRTFTDADDYAACIRNSTAEMTITGRGIFNAKLTRIDLH
Ga0318540_1003787213300032094SoilMPSSAVRTFTDPDDHAASIRAGDVEVTVTGRGQFC
Ga0318540_1042843513300032094SoilMPSSAVHTFTDPAEYAEAIRQGTYELTVTERGDFIADLTRIDLH
Ga0307471_10072306113300032180Hardwood Forest SoilMPSSAVRTFTDPDDYAAAQRGVKSELTVIGRGHFTAKL
Ga0307471_10242483123300032180Hardwood Forest SoilMPSSAVRTFTDPGDYAAAQRGVKSELTVIGRGHFTAKLIGI
Ga0306920_10081292933300032261SoilMPSSAVRTFSDPDDYAAAIRQGTVELTITRRGQFSAKL
Ga0335080_1137438323300032828SoilMPSSAVRTFTDPDDYAVSARGTTAELSVTGRGVFRAKRIL
Ga0335077_1153669413300033158SoilMPSSSVQTFTDPDDYAGSLQATTVELTIIERGSFAAKLTRVK
Ga0318519_1001216323300033290SoilMPSSAVQTFTDPGDYATAIRNTKAELTITGRGHFSPNFTLF
Ga0318519_1019053423300033290SoilMPSSAVRTFSDPDDYAASIRGTSAEMTVIGRGHFEAK


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.