NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F076471

Metagenome / Metatranscriptome Family F076471

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F076471
Family Type Metagenome / Metatranscriptome
Number of Sequences 118
Average Sequence Length 45 residues
Representative Sequence MKNNEYDAAEVVEIGQAQAIVLGEKIYLPDLDSSGMEPLDWHYQE
Number of Associated Samples 87
Number of Associated Scaffolds 118

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 82.20 %
% of genes near scaffold ends (potentially truncated) 27.97 %
% of genes from short scaffolds (< 2000 bps) 79.66 %
Associated GOLD sequencing projects 73
AlphaFold2 3D model prediction Yes
3D model pTM-score0.18

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (61.864 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere
(12.712 % of family members)
Environment Ontology (ENVO) Unclassified
(60.169 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(75.424 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 0.00%    β-sheet: 0.00%    Coil/Unstructured: 100.00%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.18
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 118 Family Scaffolds
PF00326Peptidase_S9 33.05
PF00733Asn_synthase 14.41
PF07676PD40 8.47
PF13471Transglut_core3 5.93
PF13537GATase_7 3.39
PF00664ABC_membrane 0.85
PF04542Sigma70_r2 0.85
PF02239Cytochrom_D1 0.85
PF04264YceI 0.85
PF06114Peptidase_M78 0.85
PF13435Cytochrome_C554 0.85

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 118 Family Scaffolds
COG0568DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32)Transcription [K] 0.85
COG1191DNA-directed RNA polymerase specialized sigma subunitTranscription [K] 0.85
COG1595DNA-directed RNA polymerase specialized sigma subunit, sigma24 familyTranscription [K] 0.85
COG2353Polyisoprenoid-binding periplasmic protein YceIGeneral function prediction only [R] 0.85
COG4941Predicted RNA polymerase sigma factor, contains C-terminal TPR domainTranscription [K] 0.85

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms61.86 %
UnclassifiedrootN/A38.14 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2162886013|SwBSRL2_contig_8216588All Organisms → cellular organisms → Bacteria1284Open in IMG/M
3300000953|JGI11615J12901_12717543All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium1055Open in IMG/M
3300001464|JGI12363J15224_100088All Organisms → cellular organisms → Bacteria22413Open in IMG/M
3300002568|C688J35102_120683876All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium1348Open in IMG/M
3300002899|JGIcombinedJ43975_10098589Not Available533Open in IMG/M
3300003203|JGI25406J46586_10007123All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae5124Open in IMG/M
3300003267|soilL1_10042251All Organisms → cellular organisms → Bacteria4934Open in IMG/M
3300003267|soilL1_10073571All Organisms → cellular organisms → Bacteria5496Open in IMG/M
3300003319|soilL2_10066406All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia5485Open in IMG/M
3300004156|Ga0062589_100284112All Organisms → cellular organisms → Bacteria1267Open in IMG/M
3300004156|Ga0062589_101870991Not Available604Open in IMG/M
3300004479|Ga0062595_100168157All Organisms → cellular organisms → Bacteria1306Open in IMG/M
3300004479|Ga0062595_102268508Not Available534Open in IMG/M
3300004480|Ga0062592_100797542Not Available837Open in IMG/M
3300004801|Ga0058860_10580202Not Available556Open in IMG/M
3300005289|Ga0065704_10230684All Organisms → cellular organisms → Bacteria1044Open in IMG/M
3300005289|Ga0065704_10550260All Organisms → cellular organisms → Bacteria570Open in IMG/M
3300005290|Ga0065712_10023927All Organisms → cellular organisms → Bacteria2731Open in IMG/M
3300005293|Ga0065715_10137379All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Poribacteria → unclassified Candidatus Poribacteria → Candidatus Poribacteria bacterium1907Open in IMG/M
3300005293|Ga0065715_10524557Not Available761Open in IMG/M
3300005331|Ga0070670_100035022All Organisms → cellular organisms → Bacteria4321Open in IMG/M
3300005334|Ga0068869_100833170All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium795Open in IMG/M
3300005334|Ga0068869_101087579Not Available699Open in IMG/M
3300005338|Ga0068868_101513401Not Available629Open in IMG/M
3300005345|Ga0070692_10577683Not Available740Open in IMG/M
3300005345|Ga0070692_10887254Not Available615Open in IMG/M
3300005347|Ga0070668_102110602Not Available520Open in IMG/M
3300005353|Ga0070669_100029712All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Poribacteria → unclassified Candidatus Poribacteria → Candidatus Poribacteria bacterium3942Open in IMG/M
3300005355|Ga0070671_100298297All Organisms → cellular organisms → Bacteria1372Open in IMG/M
3300005364|Ga0070673_102203394Not Available524Open in IMG/M
3300005441|Ga0070700_100658534Not Available828Open in IMG/M
3300005444|Ga0070694_100022478All Organisms → cellular organisms → Bacteria4041Open in IMG/M
3300005459|Ga0068867_100599100All Organisms → cellular organisms → Bacteria961Open in IMG/M
3300005459|Ga0068867_101975093Not Available551Open in IMG/M
3300005539|Ga0068853_100469971All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium1184Open in IMG/M
3300005543|Ga0070672_101096752Not Available707Open in IMG/M
3300005546|Ga0070696_102008337Not Available502Open in IMG/M
3300005564|Ga0070664_101768427Not Available586Open in IMG/M
3300005578|Ga0068854_100701890All Organisms → cellular organisms → Bacteria873Open in IMG/M
3300005615|Ga0070702_100159688All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Poribacteria → unclassified Candidatus Poribacteria → Candidatus Poribacteria bacterium1456Open in IMG/M
3300005617|Ga0068859_100147216All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium2430Open in IMG/M
3300005617|Ga0068859_100188283All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Poribacteria → unclassified Candidatus Poribacteria → Candidatus Poribacteria bacterium2148Open in IMG/M
3300005617|Ga0068859_100298248All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Poribacteria → unclassified Candidatus Poribacteria → Candidatus Poribacteria bacterium1705Open in IMG/M
3300005617|Ga0068859_101201769All Organisms → cellular organisms → Bacteria835Open in IMG/M
3300005617|Ga0068859_103172280Not Available500Open in IMG/M
3300005618|Ga0068864_100792826All Organisms → cellular organisms → Bacteria931Open in IMG/M
3300005840|Ga0068870_10581899Not Available758Open in IMG/M
3300005841|Ga0068863_100473025All Organisms → cellular organisms → Bacteria1232Open in IMG/M
3300005841|Ga0068863_100557696All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium1132Open in IMG/M
3300005842|Ga0068858_100334999All Organisms → cellular organisms → Bacteria1447Open in IMG/M
3300005843|Ga0068860_102644383Not Available521Open in IMG/M
3300006169|Ga0082029_1586324All Organisms → cellular organisms → Bacteria1331Open in IMG/M
3300006358|Ga0068871_100968512All Organisms → cellular organisms → Bacteria791Open in IMG/M
3300006755|Ga0079222_10062986All Organisms → cellular organisms → Bacteria1785Open in IMG/M
3300009174|Ga0105241_10429806All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium1164Open in IMG/M
3300009176|Ga0105242_12830347Not Available535Open in IMG/M
3300009545|Ga0105237_10558204All Organisms → cellular organisms → Bacteria1152Open in IMG/M
3300009545|Ga0105237_11207271All Organisms → cellular organisms → Bacteria763Open in IMG/M
3300009551|Ga0105238_10000779All Organisms → cellular organisms → Bacteria33108Open in IMG/M
3300009840|Ga0126313_10018255All Organisms → cellular organisms → Bacteria4616Open in IMG/M
3300010042|Ga0126314_10333616Not Available1086Open in IMG/M
3300010044|Ga0126310_10555247Not Available849Open in IMG/M
3300010044|Ga0126310_11209035Not Available607Open in IMG/M
3300010045|Ga0126311_10000025All Organisms → cellular organisms → Bacteria88634Open in IMG/M
3300010045|Ga0126311_10102651All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Poribacteria → unclassified Candidatus Poribacteria → Candidatus Poribacteria bacterium1966Open in IMG/M
3300010045|Ga0126311_10518713All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium934Open in IMG/M
3300010371|Ga0134125_12849144Not Available525Open in IMG/M
3300010397|Ga0134124_10006123All Organisms → cellular organisms → Bacteria9648Open in IMG/M
3300010397|Ga0134124_11147616Not Available795Open in IMG/M
3300010399|Ga0134127_10031090All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium4264Open in IMG/M
3300010400|Ga0134122_10471641All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium1128Open in IMG/M
3300010400|Ga0134122_12391316Not Available575Open in IMG/M
3300010401|Ga0134121_10001137All Organisms → cellular organisms → Bacteria → Acidobacteria25818Open in IMG/M
3300011332|Ga0126317_10608402Not Available683Open in IMG/M
3300012212|Ga0150985_118879352Not Available636Open in IMG/M
3300012469|Ga0150984_112805259Not Available599Open in IMG/M
3300013297|Ga0157378_11197669Not Available799Open in IMG/M
3300013297|Ga0157378_11213561All Organisms → cellular organisms → Bacteria794Open in IMG/M
3300013306|Ga0163162_10003205All Organisms → cellular organisms → Bacteria15652Open in IMG/M
3300013306|Ga0163162_13438188Not Available505Open in IMG/M
3300014325|Ga0163163_12059557Not Available630Open in IMG/M
3300014326|Ga0157380_12812780Not Available553Open in IMG/M
3300014745|Ga0157377_10540061All Organisms → cellular organisms → Bacteria822Open in IMG/M
3300014745|Ga0157377_11354501Not Available559Open in IMG/M
3300014968|Ga0157379_10642914All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium993Open in IMG/M
3300018476|Ga0190274_11226580All Organisms → cellular organisms → Bacteria835Open in IMG/M
3300018476|Ga0190274_13777597Not Available512Open in IMG/M
3300025900|Ga0207710_10002173All Organisms → cellular organisms → Bacteria9219Open in IMG/M
3300025900|Ga0207710_10209350All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium965Open in IMG/M
3300025904|Ga0207647_10069457All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Poribacteria → unclassified Candidatus Poribacteria → Candidatus Poribacteria bacterium2130Open in IMG/M
3300025911|Ga0207654_10019148All Organisms → cellular organisms → Bacteria3606Open in IMG/M
3300025913|Ga0207695_11490457Not Available557Open in IMG/M
3300025914|Ga0207671_11040373All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium644Open in IMG/M
3300025923|Ga0207681_10144706All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Poribacteria → unclassified Candidatus Poribacteria → Candidatus Poribacteria bacterium1774Open in IMG/M
3300025923|Ga0207681_10276177All Organisms → cellular organisms → Bacteria1321Open in IMG/M
3300025924|Ga0207694_10079529All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Poribacteria → unclassified Candidatus Poribacteria → Candidatus Poribacteria bacterium2571Open in IMG/M
3300025925|Ga0207650_10753318Not Available824Open in IMG/M
3300025926|Ga0207659_10607301All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium933Open in IMG/M
3300025930|Ga0207701_10332110All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium1317Open in IMG/M
3300025931|Ga0207644_10883054Not Available749Open in IMG/M
3300025935|Ga0207709_10154106All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium1595Open in IMG/M
3300025935|Ga0207709_10690912All Organisms → cellular organisms → Bacteria816Open in IMG/M
3300025941|Ga0207711_10026872All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium4831Open in IMG/M
3300025941|Ga0207711_11005745All Organisms → cellular organisms → Bacteria773Open in IMG/M
3300025942|Ga0207689_11016752Not Available699Open in IMG/M
3300025945|Ga0207679_10402456All Organisms → cellular organisms → Bacteria1204Open in IMG/M
3300025960|Ga0207651_11583980Not Available590Open in IMG/M
3300025960|Ga0207651_11878952Not Available539Open in IMG/M
3300025981|Ga0207640_11629617Not Available582Open in IMG/M
3300026041|Ga0207639_10462288All Organisms → cellular organisms → Bacteria1154Open in IMG/M
3300026089|Ga0207648_10174674All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium1900Open in IMG/M
3300026089|Ga0207648_10399012All Organisms → cellular organisms → Bacteria1246Open in IMG/M
3300026095|Ga0207676_12173675Not Available553Open in IMG/M
3300028379|Ga0268266_10431866All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales → Sphingobacteriaceae → Mucilaginibacter1250Open in IMG/M
3300028380|Ga0268265_10363043All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium1326Open in IMG/M
3300028380|Ga0268265_12386473Not Available535Open in IMG/M
3300028381|Ga0268264_10068770All Organisms → cellular organisms → Bacteria2994Open in IMG/M
3300028381|Ga0268264_10178259All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium1928Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere12.71%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere10.17%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere7.63%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere6.78%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil5.93%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil5.93%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere5.08%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil4.24%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere4.24%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere3.39%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere3.39%
Sugarcane Root And Bulk SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil2.54%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere2.54%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere2.54%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.69%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Switchgrass Rhizosphere1.69%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.69%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere1.69%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere1.69%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere1.69%
SoilEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil0.85%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.85%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere0.85%
Termite NestEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Termite Nest0.85%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.85%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil0.85%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere0.85%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.85%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil0.85%
Host-AssociatedHost-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated0.85%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere0.85%
Tabebuia Heterophylla RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere0.85%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere0.85%
Switchgrass RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere0.85%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere0.85%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2162886013Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk SoilEnvironmentalOpen in IMG/M
3300000953Soil microbial communities from Great Prairies - Kansas Corn soilEnvironmentalOpen in IMG/M
3300001464Forest soil microbial communities from Browns Valley, California, USA, that are Nitrogen fertilized - NN91EnvironmentalOpen in IMG/M
3300002568Grasslands soil microbial communities from Hopland, California, USA - 2EnvironmentalOpen in IMG/M
3300002899Soil microbial communities from Manhattan, Kansas, USA - Combined assembly of Kansas soil 100-500um Nextera (ASSEMBLY_DATE=20140607)EnvironmentalOpen in IMG/M
3300003203Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2Host-AssociatedOpen in IMG/M
3300003267Sugarcane bulk soil Sample L1EnvironmentalOpen in IMG/M
3300003319Sugarcane bulk soil Sample L2EnvironmentalOpen in IMG/M
3300004156Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1EnvironmentalOpen in IMG/M
3300004479Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAsEnvironmentalOpen in IMG/M
3300004480Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4EnvironmentalOpen in IMG/M
3300004801Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300005289Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2Host-AssociatedOpen in IMG/M
3300005290Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1Host-AssociatedOpen in IMG/M
3300005293Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1Host-AssociatedOpen in IMG/M
3300005331Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaGHost-AssociatedOpen in IMG/M
3300005334Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2Host-AssociatedOpen in IMG/M
3300005338Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2Host-AssociatedOpen in IMG/M
3300005345Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaGEnvironmentalOpen in IMG/M
3300005347Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaGHost-AssociatedOpen in IMG/M
3300005353Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaGHost-AssociatedOpen in IMG/M
3300005355Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaGHost-AssociatedOpen in IMG/M
3300005364Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaGHost-AssociatedOpen in IMG/M
3300005441Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaGEnvironmentalOpen in IMG/M
3300005444Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaGEnvironmentalOpen in IMG/M
3300005459Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2Host-AssociatedOpen in IMG/M
3300005539Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2Host-AssociatedOpen in IMG/M
3300005543Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaGHost-AssociatedOpen in IMG/M
3300005546Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaGEnvironmentalOpen in IMG/M
3300005564Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaGHost-AssociatedOpen in IMG/M
3300005578Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2Host-AssociatedOpen in IMG/M
3300005615Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaGEnvironmentalOpen in IMG/M
3300005617Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2Host-AssociatedOpen in IMG/M
3300005618Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2Host-AssociatedOpen in IMG/M
3300005840Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2Host-AssociatedOpen in IMG/M
3300005841Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2Host-AssociatedOpen in IMG/M
3300005842Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2Host-AssociatedOpen in IMG/M
3300005843Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2Host-AssociatedOpen in IMG/M
3300006169Termite nest microbial communities from Madurai, IndiaEnvironmentalOpen in IMG/M
3300006358Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2Host-AssociatedOpen in IMG/M
3300006755Agricultural soil microbial communities from Georgia to study Nitrogen management - GA PlitterEnvironmentalOpen in IMG/M
3300009174Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaGHost-AssociatedOpen in IMG/M
3300009176Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaGHost-AssociatedOpen in IMG/M
3300009545Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaGHost-AssociatedOpen in IMG/M
3300009551Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaGHost-AssociatedOpen in IMG/M
3300009840Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105AEnvironmentalOpen in IMG/M
3300010042Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105BEnvironmentalOpen in IMG/M
3300010044Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60EnvironmentalOpen in IMG/M
3300010045Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61EnvironmentalOpen in IMG/M
3300010371Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1EnvironmentalOpen in IMG/M
3300010397Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4EnvironmentalOpen in IMG/M
3300010399Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3EnvironmentalOpen in IMG/M
3300010400Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2EnvironmentalOpen in IMG/M
3300010401Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1EnvironmentalOpen in IMG/M
3300011332Soil microbial communities from California, USA to study soil gas exchange rates - SR-CA-SC2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012212Combined assembly of Hopland grassland soilHost-AssociatedOpen in IMG/M
3300012469Combined assembly of Soil carbon rhizosphereHost-AssociatedOpen in IMG/M
3300013297Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaGHost-AssociatedOpen in IMG/M
3300013306Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaGHost-AssociatedOpen in IMG/M
3300014325Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaGHost-AssociatedOpen in IMG/M
3300014326Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaGHost-AssociatedOpen in IMG/M
3300014745Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaGHost-AssociatedOpen in IMG/M
3300014968Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaGHost-AssociatedOpen in IMG/M
3300018476Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 TEnvironmentalOpen in IMG/M
3300025900Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025904Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025911Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025913Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025914Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025923Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025924Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025925Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025926Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025930Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes)EnvironmentalOpen in IMG/M
3300025931Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025935Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025941Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025942Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025945Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025960Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025981Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026041Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026089Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026095Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028379Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300028380Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028381Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes)Host-AssociatedOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
SwBSRL2_0019.000021102162886013Switchgrass RhizosphereMKKNEYDAAEVVEIGLAQAVVLGQKTVDLDLDSTGMDPIDRRYEE
JGI11615J12901_1271754333300000953SoilMKNNEYDAAEVVEIGQAQAIVLGEKIYLPDLDSSG
JGI12363J15224_10008833300001464SoilMKQNEYDAAEVVEIGPAQSIVLGEKVSIPDLDSTGGEPMEWQYKD*
C688J35102_12068387633300002568SoilMKKNEYDAAEVVELGEVRSIVLGHKTVTPELDSTAMEPMDRQYEE*
JGIcombinedJ43975_1009858923300002899SoilMKNNEYDAAEVVEIGQAQAIVLGEKIYLPDLDSSGMEPLDWHYQE*
JGI25406J46586_1000712353300003203Tabebuia Heterophylla RhizosphereMKKNEYDAAEVVEIGAAQAVVLGQKILLPDFDSSGMDPIDRHYEE*
soilL1_1004225143300003267Sugarcane Root And Bulk SoilMKKNEYDAAEVVELGEARSVVLGQKAITLDLDSSGMEPMDRQYED*
soilL1_1007357133300003267Sugarcane Root And Bulk SoilMKKNEYDAAEVVEIGLAQAVVLGQKTIELDLDSTGMDPIDRHYEE*
soilL2_1006640633300003319Sugarcane Root And Bulk SoilMKNNEYDAAAVVEIGQAQSLVLGTKTVDPDLDSTLMEPIDCRYQE*
Ga0062589_10028411223300004156SoilMKQNEYNAAEVVELGPAQAIVLGEKIFVPDLDSTGGEPMEWRYQE*
Ga0062589_10187099113300004156SoilAAEVVEIGAARAIVQGEKTVVPDLDSSGMEPIQRHYEEG*
Ga0062595_10016815723300004479SoilMKNNEYDAAEVVEIGEAHSVVLGVKTVDPGLDSSGMEPIDRWYQE*
Ga0062595_10226850833300004479SoilMKNNEYDAAEVVEIGKAQSVVLGTKTIVPDLDSSGMEPIERWYVE*
Ga0062592_10079754213300004480SoilMKNNEYDAAEVVEIGQAQAIVLGSKTAMPDFDSTLMDPLDHHYEE*
Ga0058860_1058020223300004801Host-AssociatedMKKNEYDAAEVVEIGEAQSVVLGVKINEPGLDFMEPWDLRYEP*
Ga0065704_1023068423300005289Switchgrass RhizosphereMKKNEYDAAEVVEIGLAQAVVLGQKTVDLDLDSTGMDPIDRRYEE*
Ga0065704_1055026023300005289Switchgrass RhizosphereMKNNEYDAAEVVEIGPAQAIVLGEKTIVPDLDSTLMEPIDQHYQE*
Ga0065712_1002392743300005290Miscanthus RhizosphereMKKNEYDAAEVVELGEAQSVVLGGKILMPGLDNPGMEPFDRQYEE*
Ga0065715_1013737923300005293Miscanthus RhizosphereMKNNEYNAAEVVEIGEAHSVVLGVKTVDPGLDSSGMEPIDRWYQE*
Ga0065715_1052455713300005293Miscanthus RhizosphereMKKNEYDAAEVVELGEAQSVVLGGKILMPGLDNPGMEPFDRQ
Ga0070670_10003502253300005331Switchgrass RhizosphereMKKNEYDAAEVVEIGEARSVVLGYKTSVPELDCPGMEPFDRQYQE*
Ga0068869_10083317033300005334Miscanthus RhizosphereMKNNEYDAAEVVEIGQAQAIVLGEKIYLPDLDSSGMEPLD
Ga0068869_10108757923300005334Miscanthus RhizosphereMKTNEYDAAEVVEIGPAQEIVLGGKIGMVGLDSSGMEPIDRVYEDD*
Ga0068868_10151340123300005338Miscanthus RhizosphereNAAEVVELGPAQAIVLGEKIFVPDLDSTGGEPMEWRYQE*
Ga0070692_1057768333300005345Corn, Switchgrass And Miscanthus RhizosphereMKKNEYDAAEVVEIGEARSVVLGEKLLMPGLDSSGMEPIDRQYQE*
Ga0070692_1088725433300005345Corn, Switchgrass And Miscanthus RhizosphereMKNNEYNAAEVVEIGAAQAIVRGEKTIDPDLDSTLMEPIEQH
Ga0070668_10211060223300005347Switchgrass RhizosphereMKNNEYDAAEVVEIGQAQAIVLGEKINLPDLDSLGVEPMDWRYQE*
Ga0070669_10002971233300005353Switchgrass RhizosphereMKNNEYDAAEVAEIGQAQAIVLGEKTIVPDLDSTLLEPLEQHYQE*
Ga0070671_10029829723300005355Switchgrass RhizosphereMKNNEYDAAEVVEIGQAQAIVLGEKINLPDLDSLGVEPMDWHYQE*
Ga0070673_10220339423300005364Switchgrass RhizosphereMKQNEYNAAEVVELGPAQAIVLGEKIFVPDLDSTGGEPMEW
Ga0070700_10065853423300005441Corn, Switchgrass And Miscanthus RhizosphereMKQNEYNAAEVVEIGPAQAIVLGQKIDERDFDSLGVEPMDWQYKD*
Ga0070694_10002247813300005444Corn, Switchgrass And Miscanthus RhizosphereEMKNNEYDAAEVVEIGQAQAIVLGEKIYLPDLDSSGMEPLDWHYQE*
Ga0068867_10059910023300005459Miscanthus RhizosphereRKMKQNEYNAAEVVEIGPAQEIVLGEKIDVRDFDSLTMDPFDWRYVEP*
Ga0068867_10197509333300005459Miscanthus RhizosphereMKKNEYDAAEVVEIGPARAIVLGSKILMPDLDSSGMDPIDRHYEE*
Ga0068853_10046997123300005539Corn RhizosphereMKNNEYNAAEVVEIGAAQAIVRGEKTIDPDLDSTLMEPIEQHYQP*
Ga0070672_10109675223300005543Miscanthus RhizosphereMKNNEYDAAEVVEIGAAQAIVRGEKTIDPDLDSTLMEPIEQHYQP*
Ga0070696_10200833723300005546Corn, Switchgrass And Miscanthus RhizosphereRRLEMKNNEYDAAEVVEIGQAQAIVLGEKIYLPDLDSSGMEPLDWHYQE*
Ga0070664_10176842713300005564Corn RhizosphereMKQNEYDAAEVVEVGKAQSVVLGEKTPVIELDSAGMEPPERQYLW*
Ga0068854_10070189023300005578Corn RhizosphereMKKNEYDAAEVVEIGPARAIVLGSKILMPDLDSSGMDPMDRHYEE*
Ga0070702_10015968823300005615Corn, Switchgrass And Miscanthus RhizosphereSRKMKQNEYNAAEVVELGPAQAIVLGEKIFVPDLDSTGGEPMEWRYQE*
Ga0068859_10014721623300005617Switchgrass RhizosphereMKHNEYNAAEVVELGPAQAIVLGEKIFVPDLDSTGGEPMDWRYEE*
Ga0068859_10018828323300005617Switchgrass RhizosphereAEVVEIGQAQAIVLGEKIYLPDLDSSGMEPLDWHYQE*
Ga0068859_10029824823300005617Switchgrass RhizosphereSGVRKMKNNEYDAAEVVEIGQAQAIVLGSKTAMPDFDSTLMDPLDHHYEE*
Ga0068859_10120176923300005617Switchgrass RhizosphereVRRLEMKNNEYDAAEVVEIGEAHSVVLGVKTVDPGLDSSGMEPIDRWYQE*
Ga0068859_10317228013300005617Switchgrass RhizosphereMKQNEYNAAEVIEIGPAQAIVLGEKIPVPDLDSTGGEPMEWRYQE*
Ga0068864_10079282623300005618Switchgrass RhizosphereKMKQNEYNAAEVVELGPAQAIVLGEKIFVPDLDSTGGEPMDWRYQE*
Ga0068870_1058189923300005840Miscanthus RhizosphereMKHNEYNAAEVVELGPAQAIVLGEKIFVPDLDSTGGEPMDWRYQE*
Ga0068863_10047302523300005841Switchgrass RhizosphereVVELGPAQAIVLGEKIFVPDLDSTGGEPMEWRYQE*
Ga0068863_10055769623300005841Switchgrass RhizosphereMKQNEYNAAEVVELGPAQAIVLGEKIFVPDLDSTGGEPMDWRYQE*
Ga0068858_10033499933300005842Switchgrass RhizosphereMKKNEYDAAEVVELGEARSVVLGGKILMPGLDNPGMEPFDRQYEE*
Ga0068860_10264438313300005843Switchgrass RhizosphereMKNNEYDAAEVVEIGAAQALVLGVKTIDPDLDSTLMEPLEKHYQE*
Ga0082029_158632423300006169Termite NestMKKNEYDAAEVVELGAAQSVVLGEKTWVPELDSSGMEPLDRQFVE*
Ga0068871_10096851223300006358Miscanthus RhizosphereEVVELGPAQAIVLGEKIFVPDLDSTGGEPMDWRYEE*
Ga0079222_1006298613300006755Agricultural SoilMKQNEYDAAEVVELGPAREIVLGEKISVPDLDSTGGEPMEWRYKE*
Ga0105241_1042980623300009174Corn RhizosphereMKQNEYNAAEVVELGPAQAIVLGEKIPVPDLDSTGGEPMEWRY
Ga0105242_1283034723300009176Miscanthus RhizosphereMKQNEYNAAEVVELGPAQAIVLGEKIIVLDLDSTGGEPMEWRYQE*
Ga0105237_1055820423300009545Corn RhizosphereMKQNEYNAAEVVEIGPAQEIVLGEKIDVRDFDSLTMDPFDWRYVEP*
Ga0105237_1120727113300009545Corn RhizosphereVRRLEMKNNEYDAAEVVEIGQAQAIVLGEKIYLPDLDSSGMEPLDWHYQE*
Ga0105238_10000779103300009551Corn RhizosphereMKQNEYNAAEVVEIGPAQAIVLGQKIDERDLDSLGVDPMDWQYKE*
Ga0126313_1001825533300009840Serpentine SoilMKKNEYDAAEVVEIGDAQSVVLGGKTIVLDFDWTGMEPIERRYEI*
Ga0126314_1033361643300010042Serpentine SoilMKNNEYNAAEVVEIGPAQAIVLGGKILMSGPDSSGMEPFDRVYEAE*
Ga0126310_1055524723300010044Serpentine SoilMQKNEYNAAEVVEIGKAKSVVLGGKTIIPDLDSSGMEPLDVRYEE*
Ga0126310_1120903513300010044Serpentine SoilMEKNEYDAAEVIEIGEAQSVVLGIKVSVPDLDSSLMEPIERRYQE*
Ga0126311_10000025443300010045Serpentine SoilMKQNEYDAAEVVEIGSARAVVLGEKVNIPDLDSTGGEPMEWQYKD*
Ga0126311_1010265123300010045Serpentine SoilMKKNEYDAAEVVEIGEAQSVVLGGKTSVPELDCAGMDPFDRQYEY*
Ga0126311_1051871313300010045Serpentine SoilMKNNEYDAAEAVEIGQAAALVLGEKILVPDLDSSGGEPIDFHYRVDF*
Ga0134125_1284914423300010371Terrestrial SoilMKQNEYDAAEVVEIGPARAIVLGEKVSIPDLDSTGGEPMEWQYKD*
Ga0134124_1000612313300010397Terrestrial SoilMKNNEYNAAEVVEIGAAQAIVRGEKTIDPDLDSTLMDPIEQHYQP*
Ga0134124_1114761623300010397Terrestrial SoilMKQNEYNAAEVVEIGPARAIVLGEKIPVPDLDSTGGEPMEWQYKE*
Ga0134127_1003109023300010399Terrestrial SoilMKKNEYDAAEVVEIGEARSVVLGTKVFVPELDSSGMEPIQRRYEE*
Ga0134122_1047164113300010400Terrestrial SoilMKQNEYDAAEVVEIGAARAIVLGEKINVPDLDSTGGEPMQWQYKD*
Ga0134122_1239131613300010400Terrestrial SoilMKQNDYDAAEVVELGPAEAIVLGEKISVPDLDFTGGDPMEWRYRE*
Ga0134121_1000113793300010401Terrestrial SoilMKNNEYDAAEVVEIGQAQAIVLGEKTIVPDLDSTLMEPLEQHYQE*
Ga0126317_1060840223300011332SoilMKKNEYDAAEVVELGEARSIVLGEKILMPGLDSSGMEPFDRQYQE*
Ga0150985_11887935223300012212Avena Fatua RhizosphereMKKNEYDAAEVVELGEVRSIVLGHKTVTPELDSTAMEPMDRLYEE*
Ga0150984_11280525923300012469Avena Fatua RhizosphereMKKNEYDAAEVVEIGEARAIVLGQKILMQGLDSSGMEPIDRQYEE*
Ga0157378_1119766923300013297Miscanthus RhizosphereMKQNEYDAAEVVEIGPARAIVLGEKVSIPDLDSTGGEPMQWQYKD*
Ga0157378_1121356123300013297Miscanthus RhizosphereAEVVEIGEARAVVLGRKIDTLDLDFSGMDPMDRQYEL*
Ga0163162_1000320553300013306Switchgrass RhizosphereMKQNEYNAAEVVEIGPAQAIVLGQKIIVPDLDSTGGEPMEWRYEE*
Ga0163162_1343818813300013306Switchgrass RhizosphereMKKNEYDAAEVVEIGEAHSVVLGVKTVDPGLDSSGMEPIDRWYQE*
Ga0163163_1205955713300014325Switchgrass RhizosphereMKNNEYDASEVVEIGAAQAIVRGEKTIDPDLDSTLMEPIEQHYQP*
Ga0157380_1281278013300014326Switchgrass RhizosphereMKNNEYDAAEVVEIGQAQAIVLGEKIYLPDLDSSGMEPLDWHYQE
Ga0157377_1054006123300014745Miscanthus RhizosphereSGVRRLEMKNNEYDAAEVVEIGPAQEIVLGEKILAQGLDSSGMEPIDRQYQE*
Ga0157377_1135450123300014745Miscanthus RhizosphereMKDNEYDAAEVVEIGPAQEIVLGGKIMLAGLDSSGMEPMDRVYEDW*
Ga0157379_1064291413300014968Switchgrass RhizosphereMKNNEYDAAEVVEIGAAQAIVRGEKTIDPDLDSTLMEPI
Ga0190274_1122658013300018476SoilMKKNEYDAAEVVEVGDAQSVVLGGKTTVLELDWTGMEPIQRRYEF
Ga0190274_1377759723300018476SoilMKKNEYDAAEVVEIGEAQSVVLGGKTIDQDVDWSGMEPLDRHYEF
Ga0207710_1000217343300025900Switchgrass RhizosphereMKNNEYNAAEVVEIGAAQAIVRGEKTIDPDLDSTLMEPIEQHYQP
Ga0207710_1020935023300025900Switchgrass RhizosphereMKQNEYNAAEVVELGPAQAIVLGEKIFVPDLDSTGGEPMDWRYQE
Ga0207647_1006945743300025904Corn RhizosphereMKNNEYDAAEVVEIGEAHSVVLGVKTVDPGLDSSGMEPIDRWYQE
Ga0207654_1001914823300025911Corn RhizosphereMKQNEYDAAEVVEIGPAQSIVLGEKVSIPDLDSTGGEPMEWQYKD
Ga0207695_1149045723300025913Corn RhizosphereMKKNEYDAAEVVEIGPARAIVLGSKILMPDLDSSGMDPMDRHYEE
Ga0207671_1104037323300025914Corn RhizosphereMKKNEYDAAEVVEIGEAHSVVLGVKTVDPGLDSSGMEPIDRWYQE
Ga0207681_1014470623300025923Switchgrass RhizosphereMKNNEYDAAEVAEIGQAQAIVLGEKTIVPDLDSTLLEPLEQHYQE
Ga0207681_1027617723300025923Switchgrass RhizosphereMKNNEYDAAEVVEIGQAQAIVLGSKTAMPDFDSTLMDPLDHHYEE
Ga0207694_1007952923300025924Corn RhizosphereMKQNEYNAAEVVEIGPAQAIVLGQKIDERDLDSLGVDPMDWQYKE
Ga0207650_1075331823300025925Switchgrass RhizosphereMKKNEYDAAEVVEIGEARSVVLGYKTSVPELDCPGMEPFDRQYQE
Ga0207659_1060730113300025926Miscanthus RhizosphereMKNNEYDAAEVVEIGQAQAIVLGSKTAMPDFDSTL
Ga0207701_1033211023300025930Corn, Switchgrass And Miscanthus RhizosphereMKNNEYDAAEVVEIGQAQAIVLGEKINLPDLDSLGVEPMDWRYQE
Ga0207644_1088305423300025931Switchgrass RhizosphereMKNNEYDAAEVVEIGQAQAIVLGEKINLPDLDSLGVEPMDWHYQE
Ga0207709_1015410623300025935Miscanthus RhizosphereMKKNEYDAAEVVEIGPARAIVLGSKILMPDLDSSGMDPIDRHYEE
Ga0207709_1069091223300025935Miscanthus RhizosphereMKQNEYNAAEVVELGPAQAIVLGEKIFVPDLDSTGGEPMEWRYQE
Ga0207711_1002687223300025941Switchgrass RhizosphereMKHNEYNAAEVVELGPAQAIVLGEKIFVPDLDSTGGEPMDWRYEE
Ga0207711_1100574513300025941Switchgrass RhizosphereAAEVVELGEAQSVVLGGKILMPGLDNPGMEPFDRQYEE
Ga0207689_1101675223300025942Miscanthus RhizosphereMKTNEYDAAEVVEIGPAQEIVLGGKIGMVGLDSSGMEPIDRVYEDD
Ga0207679_1040245623300025945Corn RhizosphereMKQNEYNAAEVVEIGPAQEIVLGEKIDVRDFDSLIMDTFDWRYLEP
Ga0207651_1158398023300025960Switchgrass RhizosphereMKKNEYDAAEVVEIGEAQSVVLGVKINEPGLDFMEPWDLRYEP
Ga0207651_1187895213300025960Switchgrass RhizosphereMKKNEYDAAEVVEIGEARAIVLGQKILMPDLDSSGMEPID
Ga0207640_1162961713300025981Corn RhizosphereMKNNEYDAAEVVEIGKAQSVVLGTKTIVPDLDSSGMEPIERWYVE
Ga0207639_1046228813300026041Corn RhizosphereGVRRLEMKNNEYDAAEVVEIGKAQSVVLGTKTIVPDLDSSGMEPIERWYVE
Ga0207648_1017467423300026089Miscanthus RhizosphereMKHNEYNAAEVVELGPAQAIVLGEKIFVPDLDSTGGEPMEWRYQE
Ga0207648_1039901213300026089Miscanthus RhizospherePLSRVRRLEMKNNEYDAAEVVEIGQAQAIVLGEKIYLPDLDSSGMEPLDWHYQE
Ga0207676_1217367513300026095Switchgrass RhizosphereMKKNEYDAAEVVEIGEARSVVMGQKILLPDLDSSGMDPVDRHYEE
Ga0268266_1043186633300028379Switchgrass RhizosphereMKNNEYNAAEVVEIGAAQAIVRGEKTIDPDLDSTLMEPI
Ga0268265_1036304323300028380Switchgrass RhizosphereMKQNEYNAAEVVEIGPAQAIVLGQKIDERDFDSLGVEPMDWQYKE
Ga0268265_1238647313300028380Switchgrass RhizosphereNDMKKNEYDAAEVVELGEAQSVVLGGKILMPGLDNPGMEPFDRQYEE
Ga0268264_1006877013300028381Switchgrass RhizosphereKMKQNEYNAAEVVEIGPAQAIVLGQKIDERDFDSLGVEPMDWQYKD
Ga0268264_1017825923300028381Switchgrass RhizosphereMKQNEYNAAEVVEIGPAQAIVLGQKIDERDFDSLGVEPMDWQYK

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.