NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F076476

Metagenome Family F076476

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F076476
Family Type Metagenome
Number of Sequences 118
Average Sequence Length 45 residues
Representative Sequence KIALNDFWNNNFKTQDGRKYVGDVGDGRSSVSVTNFSGQITFLRR
Number of Associated Samples 93
Number of Associated Scaffolds 118

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Unclassified
% of genes with valid RBS motifs 0.85 %
% of genes near scaffold ends (potentially truncated) 97.46 %
% of genes from short scaffolds (< 2000 bps) 90.68 %
Associated GOLD sequencing projects 81
AlphaFold2 3D model prediction Yes
3D model pTM-score0.22

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Unclassified (50.000 % of family members)
NCBI Taxonomy ID N/A
Taxonomy N/A

Most Common Ecosystem
GOLD Ecosystem Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere
(9.322 % of family members)
Environment Ontology (ENVO) Unclassified
(51.695 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(71.186 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 4.11%    β-sheet: 27.40%    Coil/Unstructured: 68.49%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.22
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 118 Family Scaffolds
PF00692dUTPase 8.47
PF04389Peptidase_M28 1.69
PF01593Amino_oxidase 0.85
PF01370Epimerase 0.85
PF08899DUF1844 0.85
PF13393tRNA-synt_His 0.85

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 118 Family Scaffolds
COG0717dCTP deaminaseNucleotide transport and metabolism [F] 8.47
COG0756dUTP pyrophosphatase (dUTPase)Defense mechanisms [V] 8.47

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms50.00 %
UnclassifiedrootN/A50.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2162886011|MRS1b_contig_4784216All Organisms → cellular organisms → Bacteria3816Open in IMG/M
3300003319|soilL2_10006913All Organisms → cellular organisms → Bacteria19670Open in IMG/M
3300004156|Ga0062589_100669545Not Available915Open in IMG/M
3300004156|Ga0062589_101378920Not Available686Open in IMG/M
3300004156|Ga0062589_101499240Not Available663Open in IMG/M
3300004480|Ga0062592_100243382Not Available1312Open in IMG/M
3300004643|Ga0062591_100119110Not Available1760Open in IMG/M
3300004643|Ga0062591_102681754All Organisms → cellular organisms → Bacteria → Acidobacteria526Open in IMG/M
3300005290|Ga0065712_10482272Not Available660Open in IMG/M
3300005290|Ga0065712_10655094Not Available565Open in IMG/M
3300005331|Ga0070670_101720113Not Available577Open in IMG/M
3300005332|Ga0066388_108464613Not Available512Open in IMG/M
3300005336|Ga0070680_100495540Not Available1045Open in IMG/M
3300005345|Ga0070692_10100116Not Available1587Open in IMG/M
3300005353|Ga0070669_100375043Not Available1159Open in IMG/M
3300005440|Ga0070705_100244580Not Available1256Open in IMG/M
3300005444|Ga0070694_101064132All Organisms → cellular organisms → Bacteria → Acidobacteria674Open in IMG/M
3300005457|Ga0070662_101868967All Organisms → cellular organisms → Bacteria → Acidobacteria519Open in IMG/M
3300005459|Ga0068867_102072391All Organisms → cellular organisms → Bacteria → Acidobacteria539Open in IMG/M
3300005468|Ga0070707_101406058All Organisms → cellular organisms → Bacteria → Acidobacteria664Open in IMG/M
3300005535|Ga0070684_101058555All Organisms → cellular organisms → Bacteria → Acidobacteria762Open in IMG/M
3300005539|Ga0068853_102049651All Organisms → cellular organisms → Bacteria → Acidobacteria555Open in IMG/M
3300005545|Ga0070695_101852663All Organisms → cellular organisms → Bacteria → Acidobacteria506Open in IMG/M
3300005546|Ga0070696_101534648All Organisms → cellular organisms → Bacteria → Acidobacteria571Open in IMG/M
3300005547|Ga0070693_100352564Not Available1007Open in IMG/M
3300005547|Ga0070693_100392687Not Available960Open in IMG/M
3300005547|Ga0070693_100810586Not Available695Open in IMG/M
3300005564|Ga0070664_102225863Not Available520Open in IMG/M
3300005577|Ga0068857_100649502Not Available1000Open in IMG/M
3300005577|Ga0068857_101440119All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium671Open in IMG/M
3300005578|Ga0068854_100741505Not Available851Open in IMG/M
3300005578|Ga0068854_101068070Not Available718Open in IMG/M
3300005614|Ga0068856_101625273All Organisms → cellular organisms → Bacteria → Acidobacteria659Open in IMG/M
3300005617|Ga0068859_101376478Not Available778Open in IMG/M
3300005719|Ga0068861_100343943Not Available1306Open in IMG/M
3300005840|Ga0068870_10239572Not Available1119Open in IMG/M
3300005841|Ga0068863_102464973Not Available530Open in IMG/M
3300005842|Ga0068858_100092028Not Available2822Open in IMG/M
3300005842|Ga0068858_101018905All Organisms → cellular organisms → Bacteria → Acidobacteria812Open in IMG/M
3300005888|Ga0075289_1015327Not Available1059Open in IMG/M
3300006169|Ga0082029_1081510Not Available1100Open in IMG/M
3300006806|Ga0079220_11574641All Organisms → cellular organisms → Bacteria → Acidobacteria568Open in IMG/M
3300006844|Ga0075428_100055283All Organisms → cellular organisms → Bacteria4349Open in IMG/M
3300006854|Ga0075425_102561748All Organisms → cellular organisms → Bacteria → Acidobacteria564Open in IMG/M
3300006954|Ga0079219_10839294Not Available730Open in IMG/M
3300006969|Ga0075419_10734023Not Available702Open in IMG/M
3300006969|Ga0075419_10878049Not Available646Open in IMG/M
3300009094|Ga0111539_10341111All Organisms → cellular organisms → Bacteria1744Open in IMG/M
3300009101|Ga0105247_10231294Not Available1255Open in IMG/M
3300009101|Ga0105247_11682597All Organisms → cellular organisms → Bacteria → Acidobacteria524Open in IMG/M
3300009147|Ga0114129_10092754All Organisms → cellular organisms → Bacteria4183Open in IMG/M
3300009147|Ga0114129_12264642All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium653Open in IMG/M
3300009148|Ga0105243_11693509All Organisms → cellular organisms → Bacteria → Acidobacteria661Open in IMG/M
3300009156|Ga0111538_12190217Not Available694Open in IMG/M
3300009156|Ga0111538_12538798Not Available643Open in IMG/M
3300009162|Ga0075423_10947727Not Available913Open in IMG/M
3300009176|Ga0105242_11241273Not Available766Open in IMG/M
3300009177|Ga0105248_13325726All Organisms → cellular organisms → Bacteria → Acidobacteria511Open in IMG/M
3300010036|Ga0126305_10595230Not Available743Open in IMG/M
3300010039|Ga0126309_10878317All Organisms → cellular organisms → Bacteria → Acidobacteria592Open in IMG/M
3300010360|Ga0126372_10180725All Organisms → cellular organisms → Bacteria1731Open in IMG/M
3300010396|Ga0134126_12352795All Organisms → cellular organisms → Bacteria → Acidobacteria580Open in IMG/M
3300010397|Ga0134124_11124628Not Available803Open in IMG/M
3300010397|Ga0134124_11162284Not Available790Open in IMG/M
3300010397|Ga0134124_11352741Not Available737Open in IMG/M
3300010399|Ga0134127_11369456Not Available778Open in IMG/M
3300010399|Ga0134127_11886653All Organisms → cellular organisms → Bacteria → Acidobacteria674Open in IMG/M
3300010399|Ga0134127_12709012All Organisms → cellular organisms → Bacteria → Acidobacteria575Open in IMG/M
3300010399|Ga0134127_12907460All Organisms → cellular organisms → Bacteria → Acidobacteria558Open in IMG/M
3300010400|Ga0134122_10326691Not Available1327Open in IMG/M
3300010403|Ga0134123_11328020Not Available756Open in IMG/M
3300012484|Ga0157333_1037795Not Available509Open in IMG/M
3300012927|Ga0137416_10646955All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium925Open in IMG/M
3300012930|Ga0137407_10862508All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium856Open in IMG/M
3300012948|Ga0126375_11287301Not Available613Open in IMG/M
3300013306|Ga0163162_11175621All Organisms → cellular organisms → Bacteria → Acidobacteria870Open in IMG/M
3300013306|Ga0163162_13181129All Organisms → cellular organisms → Bacteria → Acidobacteria527Open in IMG/M
3300014326|Ga0157380_11182437Not Available808Open in IMG/M
3300014326|Ga0157380_12542958All Organisms → cellular organisms → Bacteria → Acidobacteria578Open in IMG/M
3300014497|Ga0182008_10179129Not Available1072Open in IMG/M
3300014745|Ga0157377_11713143All Organisms → cellular organisms → Bacteria → Acidobacteria507Open in IMG/M
3300014968|Ga0157379_10572374Not Available1052Open in IMG/M
3300015245|Ga0137409_10173790All Organisms → cellular organisms → Bacteria1956Open in IMG/M
3300015262|Ga0182007_10326396All Organisms → cellular organisms → Bacteria → Acidobacteria570Open in IMG/M
3300015371|Ga0132258_10914620All Organisms → cellular organisms → Bacteria2215Open in IMG/M
3300015373|Ga0132257_100003633All Organisms → cellular organisms → Bacteria14378Open in IMG/M
3300019360|Ga0187894_10266344Not Available805Open in IMG/M
3300025313|Ga0209431_10916351All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium627Open in IMG/M
3300025908|Ga0207643_10464313Not Available807Open in IMG/M
3300025911|Ga0207654_10386216Not Available971Open in IMG/M
3300025922|Ga0207646_11086857All Organisms → cellular organisms → Bacteria → Acidobacteria704Open in IMG/M
3300025923|Ga0207681_10366185Not Available1157Open in IMG/M
3300025925|Ga0207650_10205944All Organisms → cellular organisms → Bacteria1578Open in IMG/M
3300025925|Ga0207650_10747602Not Available827Open in IMG/M
3300025925|Ga0207650_10777902All Organisms → cellular organisms → Bacteria → Acidobacteria811Open in IMG/M
3300025926|Ga0207659_11526404All Organisms → cellular organisms → Bacteria → Acidobacteria571Open in IMG/M
3300025941|Ga0207711_10306409Not Available1466Open in IMG/M
3300025942|Ga0207689_10536243All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium982Open in IMG/M
3300025960|Ga0207651_11016411All Organisms → cellular organisms → Bacteria → Acidobacteria741Open in IMG/M
3300025972|Ga0207668_10613800All Organisms → cellular organisms → Bacteria949Open in IMG/M
3300025981|Ga0207640_10489955Not Available1021Open in IMG/M
3300025981|Ga0207640_10886225All Organisms → cellular organisms → Bacteria → Acidobacteria778Open in IMG/M
3300025981|Ga0207640_12107436All Organisms → cellular organisms → Bacteria → Acidobacteria511Open in IMG/M
3300025986|Ga0207658_11665812All Organisms → cellular organisms → Bacteria → Acidobacteria583Open in IMG/M
3300026035|Ga0207703_11161539All Organisms → cellular organisms → Bacteria → Acidobacteria742Open in IMG/M
3300026078|Ga0207702_11442921All Organisms → cellular organisms → Bacteria → Acidobacteria682Open in IMG/M
3300026088|Ga0207641_10081939All Organisms → cellular organisms → Bacteria2803Open in IMG/M
3300026095|Ga0207676_12268126Not Available541Open in IMG/M
3300026116|Ga0207674_10056470All Organisms → cellular organisms → Bacteria3987Open in IMG/M
3300026118|Ga0207675_100403457Not Available1347Open in IMG/M
3300026118|Ga0207675_102348443Not Available546Open in IMG/M
3300026469|Ga0257169_1075414All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium548Open in IMG/M
3300028381|Ga0268264_11842278All Organisms → cellular organisms → Bacteria → Acidobacteria615Open in IMG/M
3300032002|Ga0307416_100845117All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium1013Open in IMG/M
3300032005|Ga0307411_10081943All Organisms → cellular organisms → Bacteria2223Open in IMG/M
3300032012|Ga0310902_10525420Not Available775Open in IMG/M
3300032126|Ga0307415_101888905Not Available579Open in IMG/M
3300033412|Ga0310810_10229831All Organisms → cellular organisms → Bacteria2063Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere9.32%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere9.32%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil8.47%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere8.47%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere8.47%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere7.63%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil5.08%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere3.39%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere3.39%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil2.54%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere2.54%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere2.54%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere2.54%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.69%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil1.69%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil1.69%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil1.69%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere1.69%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere1.69%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.69%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.69%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere1.69%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere1.69%
Termite NestEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Termite Nest0.85%
Sugarcane Root And Bulk SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil0.85%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.85%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil0.85%
Rice Paddy SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil0.85%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.85%
SoilEnvironmental → Terrestrial → Soil → Loam → Unclassified → Soil0.85%
Microbial Mat On RocksEnvironmental → Terrestrial → Cave → Unclassified → Unclassified → Microbial Mat On Rocks0.85%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.85%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.85%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.85%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2162886011Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1Host-AssociatedOpen in IMG/M
3300003319Sugarcane bulk soil Sample L2EnvironmentalOpen in IMG/M
3300004156Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1EnvironmentalOpen in IMG/M
3300004480Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4EnvironmentalOpen in IMG/M
3300004643Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3EnvironmentalOpen in IMG/M
3300005290Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1Host-AssociatedOpen in IMG/M
3300005331Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaGHost-AssociatedOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005336Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaGEnvironmentalOpen in IMG/M
3300005345Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaGEnvironmentalOpen in IMG/M
3300005353Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaGHost-AssociatedOpen in IMG/M
3300005440Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaGEnvironmentalOpen in IMG/M
3300005444Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaGEnvironmentalOpen in IMG/M
3300005457Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaGHost-AssociatedOpen in IMG/M
3300005459Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2Host-AssociatedOpen in IMG/M
3300005468Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaGEnvironmentalOpen in IMG/M
3300005535Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaGEnvironmentalOpen in IMG/M
3300005539Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2Host-AssociatedOpen in IMG/M
3300005545Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaGEnvironmentalOpen in IMG/M
3300005546Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaGEnvironmentalOpen in IMG/M
3300005547Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaGEnvironmentalOpen in IMG/M
3300005564Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaGHost-AssociatedOpen in IMG/M
3300005577Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2Host-AssociatedOpen in IMG/M
3300005578Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2Host-AssociatedOpen in IMG/M
3300005614Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2Host-AssociatedOpen in IMG/M
3300005617Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2Host-AssociatedOpen in IMG/M
3300005719Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2Host-AssociatedOpen in IMG/M
3300005840Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2Host-AssociatedOpen in IMG/M
3300005841Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2Host-AssociatedOpen in IMG/M
3300005842Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2Host-AssociatedOpen in IMG/M
3300005888Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_80N_103EnvironmentalOpen in IMG/M
3300006169Termite nest microbial communities from Madurai, IndiaEnvironmentalOpen in IMG/M
3300006806Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100EnvironmentalOpen in IMG/M
3300006844Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2Host-AssociatedOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006954Agricultural soil microbial communities from Georgia to study Nitrogen management - GA ControlEnvironmentalOpen in IMG/M
3300006969Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3Host-AssociatedOpen in IMG/M
3300009094Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009101Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaGHost-AssociatedOpen in IMG/M
3300009147Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)Host-AssociatedOpen in IMG/M
3300009148Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaGHost-AssociatedOpen in IMG/M
3300009156Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300009176Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaGHost-AssociatedOpen in IMG/M
3300009177Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaGHost-AssociatedOpen in IMG/M
3300010036Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot26EnvironmentalOpen in IMG/M
3300010039Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot56EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010396Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2EnvironmentalOpen in IMG/M
3300010397Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4EnvironmentalOpen in IMG/M
3300010399Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3EnvironmentalOpen in IMG/M
3300010400Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2EnvironmentalOpen in IMG/M
3300010403Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3EnvironmentalOpen in IMG/M
3300012484Unplanted soil (control) microbial communities from North Carolina - M.Soil.2.old.190510EnvironmentalOpen in IMG/M
3300012927Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012930Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012948Tropical forest soil microbial communities from Panama - MetaG Plot_14EnvironmentalOpen in IMG/M
3300013306Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaGHost-AssociatedOpen in IMG/M
3300014326Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaGHost-AssociatedOpen in IMG/M
3300014497Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaGHost-AssociatedOpen in IMG/M
3300014745Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaGHost-AssociatedOpen in IMG/M
3300014968Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaGHost-AssociatedOpen in IMG/M
3300015245Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015262Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaGHost-AssociatedOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300019360White microbial mat communities from a lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - GBC170108-1 metaGEnvironmentalOpen in IMG/M
3300025313Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_3 (SPAdes)EnvironmentalOpen in IMG/M
3300025908Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025911Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025922Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025923Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025925Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025926Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025941Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025942Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025960Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025972Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025981Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025986Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026035Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026078Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026088Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026095Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026116Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026118Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026469Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-17-BEnvironmentalOpen in IMG/M
3300028381Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300032002Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3Host-AssociatedOpen in IMG/M
3300032005Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1Host-AssociatedOpen in IMG/M
3300032012Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D3EnvironmentalOpen in IMG/M
3300032126Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2Host-AssociatedOpen in IMG/M
3300033412Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NCEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
MRS1b_0421.000028602162886011Miscanthus RhizosphereLNDFWNNNFKTQDGRKYVGDVGDGRSSVSVTNFSGQITFLRR
soilL2_10006913233300003319Sugarcane Root And Bulk SoilRKIALNDFWNSNFKNQDGRKLVGDVGDGRSSVSVMNFSGQITFLRR*
Ga0062589_10066954523300004156SoilNDFWNNGFKTQDGRKYVGDVGDGRSSVSVTNFSGSITFMRK*
Ga0062589_10137892023300004156SoilALNDFWNSNFKSQDGRKIVGDVGDGRSSVSIINFSGQITFLRR*
Ga0062589_10149924023300004156SoilFWNNNFKTQDGRKYVGDVGDGRSSVSVTNFSGQITFLRR*
Ga0062592_10024338213300004480SoilPARRILLNDFWNNNMKTQDGRKIVGDVGDGRSSVSVTNFSGQITFMRR*
Ga0062591_10011911033300004643SoilSPARRILLNDFWNNNMKTQDGRKIVGDVGDGRSSVSVTNFSGQITFMRR*
Ga0062591_10268175423300004643SoilASPARKITLGDFWNNGFKTQDGRRYVGDVGDGRSSVSVTNFSGQITFLRK*
Ga0065712_1048227213300005290Miscanthus RhizosphereALNDFWNNNLKTHDGRKYVGDVGDGRSSVSIINFSGQITFMRR*
Ga0065712_1065509413300005290Miscanthus RhizosphereIALNDFWNSNFKNQDGRKLVGDVGDGRSSVSVMNFSGQITFMRR*
Ga0070670_10172011323300005331Switchgrass RhizosphereALNDFWNSNFKNQDGRKLVGDVGDGRSSVSVMNFSGQITFLRR*
Ga0066388_10846461313300005332Tropical Forest SoilPARKITLGEFWNNGFKTQDGRRYVGDVGDGRSSVSVTNFSGQITFLRK*
Ga0070680_10049554023300005336Corn RhizosphereVSLGQFWNNNFRTQDGRRYVGDVGDGRSSVSVTNFSGGITFLRR*
Ga0070692_1010011643300005345Corn, Switchgrass And Miscanthus RhizosphereSPARRIALNDFWNNNFKSQDGRRITGDVGDGRSSVSVTNFSGQITFMRK*
Ga0070669_10037504313300005353Switchgrass RhizosphereVAASPARRIALNDFWNDNFKSQDARRYVGDVGDGRSSVSVTNFSGQITFLRR*
Ga0070705_10024458013300005440Corn, Switchgrass And Miscanthus RhizosphereRLVAASPMRKIALNNFWNNNFKTQDGRKYVGDVGDGRSSVSVTNFSGQITFLRR*
Ga0070694_10106413223300005444Corn, Switchgrass And Miscanthus RhizosphereSPARKIALNDFWNNNFKTQDGRKYVGDVGDGRSSVSIINFSGQITFLRR*
Ga0070662_10186896723300005457Corn RhizosphereLNDFWNKNFKSQDGRKIVGDVGDGRSSVSIINFSGQITFLRK*
Ga0068867_10207239123300005459Miscanthus RhizosphereSPARKIALNDFWNKNFQSQDGRKIVGDVGDGRSSVSIINFSGQITFLRK*
Ga0070707_10140605813300005468Corn, Switchgrass And Miscanthus RhizosphereFWNNGFKTQDGRKYVGDVGDGRSSVSVTNFSGSITFLRK*
Ga0070684_10105855523300005535Corn RhizosphereSPARKIALGDFWNNGFKTQDGRKYTGDVGDGRSSVSVTNFSGQITFLRK*
Ga0068853_10204965113300005539Corn RhizosphereIALNDFWNNNFKTQDGRKYVGDVGDGRSSVSVTNFSGQITFMRR*
Ga0070695_10185266323300005545Corn, Switchgrass And Miscanthus RhizosphereFWNNGFKTQDGRRYVGDVGDGRSSVSVTNFSGQITFLRK*
Ga0070696_10153464813300005546Corn, Switchgrass And Miscanthus RhizospherePTKQIKLNDFWNNGFKTQDGRKYVGDVGDGRSSVSVTNFSGSITFLRK*
Ga0070693_10035256423300005547Corn, Switchgrass And Miscanthus RhizosphereDFWNNGFKTQDGRKYVGDVGDGRSSVSVTNFSGQITFLRK*
Ga0070693_10039268713300005547Corn, Switchgrass And Miscanthus RhizosphereRKIALNDFWNKNFKSTDGRKIVGDVGDGRSSVSIINFSGQITFLRR*
Ga0070693_10081058613300005547Corn, Switchgrass And Miscanthus RhizosphereKQIKLNDFWNNGFKTQDGRKYVGDVGDGRSSVSVTNFSGSITFLRK*
Ga0070664_10222586313300005564Corn RhizosphereSPARKIALNDFWNSNFKNQDGRKLVGDVGDGRSSVSVMNFSGQITFMRR*
Ga0068857_10064950223300005577Corn RhizosphereKIALNDFWNKNFKSQDGRKIVGDVGDGRSSVSIINFSGQITFLRK*
Ga0068857_10144011933300005577Corn RhizospherePTRRIALGDFWNNGFKTQDGRRYTGDVGDGRSSVSVTNFSGQITFLRK*
Ga0068854_10074150513300005578Corn RhizosphereLVAASPAKKIALGDFWNNGFKTQDGRKYVGDVGDGRSSVSVTNFSGQITFLRK*
Ga0068854_10106807013300005578Corn RhizosphereDFWNNNFKTQDGRKYVGDVGDGRSSVSIINFSGQITFLRR*
Ga0068856_10162527323300005614Corn RhizosphereASPTKQIKLNDFWNNGFKTQDGRKYVGDVGDGRSSVSVTNFSGSITFLRK*
Ga0068859_10137647823300005617Switchgrass RhizosphereFKTQDGRKYVGDVGDGRSSVSVTNFSGQITFLRR*
Ga0068861_10034394333300005719Switchgrass RhizosphereILLNDFWNNNMKTQDGRKIVGDVGDGRSSVSVTNFSGQITFMRR*
Ga0068870_1023957223300005840Miscanthus RhizosphereKIALNDFWNNNFKTQDGRKYVGDVGDGRSSVSVTNFSGQITFLRR*
Ga0068863_10246497313300005841Switchgrass RhizosphereALNDFWNKNFKSQDGRKIVGDVGDGRSSVSIINFSGQITFLRR*
Ga0068858_10009202813300005842Switchgrass RhizosphereQFWNDGFKTQDGRRYFGDVGDGRSSVSVTNFSGAITFLRR*
Ga0068858_10101890523300005842Switchgrass RhizosphereLVAASPARKIALGDFWNNGFKTQDGRKYTGDVGDGRSSVSVTNFSGQITFLRK*
Ga0075289_101532713300005888Rice Paddy SoilRIALNDFWNSNFKSQDGRKIVGDVGDGRSSVSIINFSGQITFLRR*
Ga0082029_108151013300006169Termite NestLNDFWNNNFKTQDGRKYVGDVGDGRSSVSVTNFSGQITFMRR*
Ga0079220_1157464113300006806Agricultural SoilKLNDFWNNGFKTQDGRKYVGDVGDGRSSVSVTNFSGSITFLRK*
Ga0075428_10005528353300006844Populus RhizosphereFWNNGFKTQDGRKYVGDVGDGRSSVSVTNFTGQITFMRK*
Ga0075425_10256174823300006854Populus RhizosphereKQIKLNDFWNNGFRTQDGRKYVGDVGDGRSSVSVTNFSGSITFLRK*
Ga0079219_1083929413300006954Agricultural SoilLVAASPARRIALNDFWNNNFKTQDGRKYVGDVGDGRSSVSVTNFSGQITFLRK*
Ga0075419_1073402323300006969Populus RhizosphereDFWNSNFKNQDGRKLVGDVGDGRSSVSVMNFSGQITFLRR*
Ga0075419_1087804913300006969Populus RhizosphereTLGQFWNDNFKTQDGRRYVGDVGDGRSSVSVTNFSGAITFIRR*
Ga0111539_1034111113300009094Populus RhizosphereSAAKKVSLGQFWNNNFRTQDGRRYVGDVGDGRSSVSVTNFSGSITFLRR*
Ga0105247_1023129413300009101Switchgrass RhizosphereAASPARRIALNDFWNSNFKSQDGRKIVGDVGDGRSSVSIINFSGQITFLRR*
Ga0105247_1168259723300009101Switchgrass RhizosphereAASPTKQIKLNDFWNNGFKTQDGRKYVGDVGDGRSSVSVTNFSGSITFLRK*
Ga0114129_1009275453300009147Populus RhizosphereWNNNMKTHDGRRIVGDVGDGRSSVSVTNFSGQITFLRR*
Ga0114129_1226464223300009147Populus RhizosphereRLVVASPAKKITLGQFWNSNFKTQDGRRYVGDVGDGRSSVSVTNFSGAITFIRR*
Ga0105243_1169350923300009148Miscanthus RhizosphereIALNDFWNNNFKNQDGRKLVGDVGDGRSSVSVMNFSGQITFLRR*
Ga0111538_1219021713300009156Populus RhizosphereQFWNNGFKTTGDGRRVIGDVGDGRSSVSVINFSGSITFLRK*
Ga0111538_1253879813300009156Populus RhizosphereKIALNDFWNNNFKTQDGRKYVGDVGDGRSSVSIINFSGQITFLRR*
Ga0075423_1094772713300009162Populus RhizosphereIALNDFWNNNFKTQDGRKYVGDVGDGRSSVSIINFSGQITFLRR*
Ga0105242_1124127323300009176Miscanthus RhizosphereFLEYYFKTQDGRKYVGDVGDGRSSVSIINFSGQITFLRR*
Ga0105248_1332572613300009177Switchgrass RhizosphereAASPARKIALNDFWNNNFKTQDGRKYVGDVGDGRSSVSVTNFSGQITFLRR*
Ga0126305_1059523023300010036Serpentine SoilRIALGDFWNNGFKTQDGRKYVGDVGDGRSSVSVTNFSGQITFFRR*
Ga0126309_1087831723300010039Serpentine SoilLNDFWNKNFKTQDGRKMVGDVGDGRSSVSIINFSGQITFLRR*
Ga0126372_1018072513300010360Tropical Forest SoilNDFWNSNFKSQDGRKIVGDVGDGRSSVSIINFSGQITFLRR*
Ga0134126_1235279513300010396Terrestrial SoilIALNDFWNKNFKTQDGRKVVGDVGDGRSSVSIINFSGQITFMRR*
Ga0134124_1112462813300010397Terrestrial SoilAASPARKIALGEFWNNGFKTQDGRRYVGDVGDGRSSVSVTNFSGQITFLRK*
Ga0134124_1116228413300010397Terrestrial SoilPARRIALNDFWNSNFKSQDGRKVVGDVGDGRASVSIINFNGQISFMRR*
Ga0134124_1135274113300010397Terrestrial SoilARRIALNDFWNNNFKTQDGRKYVGDVGDGRSSVSVTNFSGQITFMRR*
Ga0134127_1136945613300010399Terrestrial SoilNNNFKTQDGRKYVGDVGDGRSSVSIINFSGQITFLRR*
Ga0134127_1188665313300010399Terrestrial SoilSAAKKVSLGQFWNNNFRTQDGRRYVGDVGDGRSSVSVTNFSGGITFLRR*
Ga0134127_1270901213300010399Terrestrial SoilRRIALNDFWNNNFKTQDGRRYVGDVGDGRSSVSVTNFSGQITFLRR*
Ga0134127_1290746023300010399Terrestrial SoilFWNNGFKTQDGRKYVGDVGDGRSSVSVTNFSGQITFLRK*
Ga0134122_1032669113300010400Terrestrial SoilRKITLNQFWNNGFKTLGDGRRVIGDVGDGRSSVSVMNFSGSITFLRK*
Ga0134123_1132802023300010403Terrestrial SoilWNDGFKTQDGRRYFGDVGDGRSSVSVTNFSGAITFLRR*
Ga0157333_103779523300012484SoilWNTNFKKLGDGRKFVGDVGDGRASVSVTNFSGGITFIRR*
Ga0137416_1064695513300012927Vadose Zone SoilFWNDGFKAFSDGRRYIGDVGDGRSSVSVTTFSGTITFMRK*
Ga0137407_1086250813300012930Vadose Zone SoilPFWNDGFKALGDGRKYVGDVGDGRSSVSVTTFSGTITFMRR*
Ga0126375_1128730113300012948Tropical Forest SoilFWNNGFKTLGDGRRLVGDVGDGRSSVSVTNFSGQITFMRR*
Ga0163162_1117562113300013306Switchgrass RhizosphereKIALGDFWNNGFKTQDGRKYTGDVGDGRSSVSVTNFSGQITFLRK*
Ga0163162_1318112913300013306Switchgrass RhizosphereLVAASPARKIALNDFWNNNFKTQDGRKYVGDVGDGRYSVSVTNFRGQITFLRR*
Ga0157380_1118243713300014326Switchgrass RhizosphereRLEAASPARKIALNDFWNNNFKTQDGRKYVGDVGDGRSSVSVTNFSGQITFLRR*
Ga0157380_1254295813300014326Switchgrass RhizosphereASPARRIALNDFWNNNLKTHDGRTYVGDVGDGRSSVSIINFSGQITFMRR*
Ga0182008_1017912923300014497RhizosphereDFWNNNFKTQDGRKIVGDVGDGRSSVSVTNFSGQITFLRR*
Ga0157377_1171314323300014745Miscanthus RhizosphereRIALNDFWNNNFKTQDGRKYVGDVGDGRSSVSVTNFSGQITFLRR*
Ga0157379_1057237423300014968Switchgrass RhizosphereLEAASPARRIALNDFWNSNFKSQDGRKIVGDVGDGRSSVSIINFSGQITFLRR*
Ga0137409_1017379013300015245Vadose Zone SoilNGFKALGDGRKYVGDVGDGRSSVSVTTFSGTITFMRR*
Ga0182007_1032639613300015262RhizosphereRLVAASPARRIALNDFWNNNFKTQDGRKIVGDVGDGRSSVSVTNFSGQITFLRR*
Ga0132258_1091462043300015371Arabidopsis RhizosphereLNDFWNNNFKTQDGRKYVGDVGDGRSSVSVTNFSGQITFLRR*
Ga0132257_100003633173300015373Arabidopsis RhizosphereFWNDGFKTQDGRRYFGDVGDGRSSVSVTNFSGAITFLRR*
Ga0187894_1026634423300019360Microbial Mat On RocksNNGLKTQDGRKYVGDVGDGRSSVSVTNFSGSITFMRR
Ga0209431_1091635113300025313SoilKKFVLGQFWNSGFKTLGDGRKYMGDVGDGRSSVTVTNFRGSITFLRR
Ga0207643_1046431323300025908Miscanthus RhizosphereAASPARKIALNDFWNNNFKTQDGRKYVGDVGDGRSSVSVTNFSGQITFLRR
Ga0207654_1038621623300025911Corn RhizosphereIALNDFWNQNFKTQDGRKYVGDVGDGRSSVSIINFSGQITFLRR
Ga0207646_1108685713300025922Corn, Switchgrass And Miscanthus RhizosphereMLARTAAEGVKLNDFWNNGFKTQDGRKYVGDVGDGRSSVSVTNFSGSITFLRK
Ga0207681_1036618523300025923Switchgrass RhizosphereVAASPARRIALNDFWNDNFKSQDARRYVGDVGDGRSSVSVTNFSGQITFLRR
Ga0207650_1020594413300025925Switchgrass RhizosphereNFKSQDGRKIVGDVGDGRSSVSIINFSGQITFLRR
Ga0207650_1074760223300025925Switchgrass RhizosphereNNMKTQDGRKIVGDVGDGRSSVSVTNFSGQITFLRR
Ga0207650_1077790223300025925Switchgrass RhizosphereGDFWNDGFKTQDGRKYVGDVGDGRSSVSVTNFNGSITFMRR
Ga0207659_1152640413300025926Miscanthus RhizosphereASPARKIALNDFWNKNFKSQDGRKIVGDVGDGRSSVSIINFSGQITFLRK
Ga0207711_1030640923300025941Switchgrass RhizosphereFWNNGFKTQDGRKYVGDVGDGRSSVSVTNFSGQITFLRK
Ga0207689_1053624323300025942Miscanthus RhizosphereMVATSPARKIKLGDFWNDGFKTQDGRKYVGDVGDGRSSVSVTNFNGSITFMRR
Ga0207651_1101641113300025960Switchgrass RhizosphereDRFKTQDGRRYVGDVGDGRSSVSVTNFSGQITFLRK
Ga0207668_1061380013300025972Switchgrass RhizosphereVAASPARKIALGDFWNNGFKTQDGRKYTGDVGDGRSSVSVTNFSGQITFLRK
Ga0207640_1048995513300025981Corn RhizosphereFRLVAASPTKQIKLNDFWNNGFKTQDGRKYVGDVGDGRSSVSVTNFSGSITFLRR
Ga0207640_1088622533300025981Corn RhizosphereIALNDFWNSNFKNQDGRKLVGDVGDGRSSVSVMNFSGQITFLRR
Ga0207640_1210743623300025981Corn RhizosphereALNDFWNSNFKSQDGRKIVGDVGDGRSSVSIINFSGQITFLRR
Ga0207658_1166581213300025986Switchgrass RhizosphereSPAKRVNLGDFWNDRFKTQDGRRYVGDVGDGRSSVSVTNFSGQITFLRK
Ga0207703_1116153913300026035Switchgrass RhizosphereSPARKIKLGDFWNDGFKTQDGRKYVGDVGDGRSSVSVTNFNGSITFMRR
Ga0207702_1144292123300026078Corn RhizosphereRRIALNDFWNKNFKTQDGRKVVGDVGDGRSSVSIINFSGQITFMRR
Ga0207641_1008193913300026088Switchgrass RhizosphereNNNFKTQDGRKYVGDVGDGRSSVSVTNFSGQITFLRR
Ga0207676_1226812623300026095Switchgrass RhizosphereWNNNFKTQDGRKYVGDVGDGRSSVSVTNFSGQITFLRR
Ga0207674_1005647013300026116Corn RhizosphereRLEAASQARRIALNDFWNDRLKTHDGRKYVGDVGDGRSSVSIINFSGQITFMRR
Ga0207675_10040345733300026118Switchgrass RhizosphereILLNDFWNNNMKTQDGRKIVGDVGDGRSSVSVTNFSGQITFMRR
Ga0207675_10234844323300026118Switchgrass RhizosphereIKLNDFWNNGFKTQDGRKYVGDVGDGRSSVSVTNFSGQITFLRK
Ga0257169_107541413300026469SoilLVAASSAKRIAIGPFWNDGFKALGDGRKYVGDVGDGRSSVSVTTFSGTITFMRR
Ga0268264_1184227823300028381Switchgrass RhizosphereRLEAASPARKIALNDFWNNNFKTQDGRKYVGDVGDGRSSVSIINFSGQITFLRR
Ga0307416_10084511713300032002RhizosphereASPARKIALGDFWNNGFKTQDGRKYVGDVGDGRSSVSVTNFGGQITFLRR
Ga0307411_1008194313300032005RhizosphereWNNNFKTQDGRKYVGDVGDGRSSVSVTNFSGQITFMRR
Ga0310902_1052542013300032012SoilLGQFWNNNFRTQDGRRYVGDVGDGRSSVSVTNFSGAITFLRR
Ga0307415_10188890523300032126RhizosphereWNNGFKTQDGRKYVGDVGDGRSSVSVTNFSGQITFLRK
Ga0310810_1022983113300033412SoilLVAASPARRIALNDFWNNNFKTQDGRKYVGDVGDGRSSVSVTNFSGQITFMRR

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.