Basic Information | |
---|---|
Family ID | F076561 |
Family Type | Metagenome |
Number of Sequences | 118 |
Average Sequence Length | 49 residues |
Representative Sequence | VTKMLSRTSLRRLLATGLALGVLAAVTPATGLASNPGGGGHPIGKSR |
Number of Associated Samples | 95 |
Number of Associated Scaffolds | 118 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 45.76 % |
% of genes near scaffold ends (potentially truncated) | 49.15 % |
% of genes from short scaffolds (< 2000 bps) | 86.44 % |
Associated GOLD sequencing projects | 84 |
AlphaFold2 3D model prediction | No |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (57.627 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere (21.186 % of family members) |
Environment Ontology (ENVO) | Unclassified (32.203 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (61.017 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Fibrous | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 42.55% β-sheet: 0.00% Coil/Unstructured: 57.45% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 118 Family Scaffolds |
---|---|---|
PF00196 | GerE | 17.80 |
PF13191 | AAA_16 | 6.78 |
PF01391 | Collagen | 2.54 |
PF13417 | GST_N_3 | 1.69 |
PF12862 | ANAPC5 | 1.69 |
PF00211 | Guanylate_cyc | 1.69 |
PF00072 | Response_reg | 0.85 |
PF00730 | HhH-GPD | 0.85 |
PF14015 | DUF4231 | 0.85 |
PF12895 | ANAPC3 | 0.85 |
PF13428 | TPR_14 | 0.85 |
PF00696 | AA_kinase | 0.85 |
PF08797 | HIRAN | 0.85 |
COG ID | Name | Functional Category | % Frequency in 118 Family Scaffolds |
---|---|---|---|
COG2114 | Adenylate cyclase, class 3 | Signal transduction mechanisms [T] | 1.69 |
COG0122 | 3-methyladenine DNA glycosylase/8-oxoguanine DNA glycosylase | Replication, recombination and repair [L] | 0.85 |
COG0177 | Endonuclease III | Replication, recombination and repair [L] | 0.85 |
COG1059 | Thermostable 8-oxoguanine DNA glycosylase | Replication, recombination and repair [L] | 0.85 |
COG1194 | Adenine-specific DNA glycosylase, acts on AG and A-oxoG pairs | Replication, recombination and repair [L] | 0.85 |
COG2231 | 3-Methyladenine DNA glycosylase, HhH-GPD/Endo3 superfamily | Replication, recombination and repair [L] | 0.85 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 57.63 % |
Unclassified | root | N/A | 42.37 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000956|JGI10216J12902_103399583 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 676 | Open in IMG/M |
3300000956|JGI10216J12902_105150271 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1712 | Open in IMG/M |
3300000956|JGI10216J12902_107972049 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 658 | Open in IMG/M |
3300000956|JGI10216J12902_113220082 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 739 | Open in IMG/M |
3300002911|JGI25390J43892_10050980 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 977 | Open in IMG/M |
3300004114|Ga0062593_102976042 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 542 | Open in IMG/M |
3300004114|Ga0062593_102977723 | Not Available | 542 | Open in IMG/M |
3300005186|Ga0066676_11052326 | Not Available | 539 | Open in IMG/M |
3300005187|Ga0066675_10066554 | All Organisms → cellular organisms → Bacteria | 2278 | Open in IMG/M |
3300005332|Ga0066388_100273914 | All Organisms → cellular organisms → Bacteria | 2330 | Open in IMG/M |
3300005336|Ga0070680_100767877 | Not Available | 830 | Open in IMG/M |
3300005337|Ga0070682_101492791 | Not Available | 581 | Open in IMG/M |
3300005339|Ga0070660_100828248 | Not Available | 779 | Open in IMG/M |
3300005356|Ga0070674_100517794 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 996 | Open in IMG/M |
3300005364|Ga0070673_100150868 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1968 | Open in IMG/M |
3300005364|Ga0070673_100283625 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1453 | Open in IMG/M |
3300005406|Ga0070703_10016205 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei | 2138 | Open in IMG/M |
3300005434|Ga0070709_10261001 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_20CM_4_68_12 | 1251 | Open in IMG/M |
3300005434|Ga0070709_10310863 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1153 | Open in IMG/M |
3300005435|Ga0070714_100021102 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 5325 | Open in IMG/M |
3300005436|Ga0070713_102394526 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 510 | Open in IMG/M |
3300005437|Ga0070710_10869869 | Not Available | 648 | Open in IMG/M |
3300005438|Ga0070701_10475204 | Not Available | 807 | Open in IMG/M |
3300005441|Ga0070700_100215944 | Not Available | 1356 | Open in IMG/M |
3300005467|Ga0070706_100231318 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1726 | Open in IMG/M |
3300005467|Ga0070706_100546470 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1077 | Open in IMG/M |
3300005467|Ga0070706_100722025 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 924 | Open in IMG/M |
3300005518|Ga0070699_100118430 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2328 | Open in IMG/M |
3300005546|Ga0070696_100802959 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 774 | Open in IMG/M |
3300005549|Ga0070704_100478065 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_20CM_4_68_12 | 1077 | Open in IMG/M |
3300005556|Ga0066707_10361673 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_20CM_4_68_12 | 948 | Open in IMG/M |
3300005558|Ga0066698_10450982 | Not Available | 878 | Open in IMG/M |
3300005617|Ga0068859_102563821 | Not Available | 561 | Open in IMG/M |
3300005719|Ga0068861_101265911 | Not Available | 716 | Open in IMG/M |
3300005937|Ga0081455_10809182 | Not Available | 588 | Open in IMG/M |
3300006034|Ga0066656_10578516 | Not Available | 728 | Open in IMG/M |
3300006046|Ga0066652_102006366 | Not Available | 515 | Open in IMG/M |
3300006058|Ga0075432_10185727 | Not Available | 816 | Open in IMG/M |
3300006163|Ga0070715_10171743 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1080 | Open in IMG/M |
3300006175|Ga0070712_101440486 | Not Available | 601 | Open in IMG/M |
3300006358|Ga0068871_102403391 | Not Available | 503 | Open in IMG/M |
3300006852|Ga0075433_10426477 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_20CM_4_68_12 | 1169 | Open in IMG/M |
3300006852|Ga0075433_10464414 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1115 | Open in IMG/M |
3300006881|Ga0068865_100265026 | Not Available | 1362 | Open in IMG/M |
3300007076|Ga0075435_100320142 | All Organisms → cellular organisms → Bacteria | 1327 | Open in IMG/M |
3300009012|Ga0066710_100087010 | All Organisms → cellular organisms → Bacteria | 4109 | Open in IMG/M |
3300009012|Ga0066710_100651152 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1603 | Open in IMG/M |
3300009012|Ga0066710_100803013 | Not Available | 1442 | Open in IMG/M |
3300009090|Ga0099827_11919940 | Not Available | 516 | Open in IMG/M |
3300009098|Ga0105245_13278466 | Not Available | 501 | Open in IMG/M |
3300009137|Ga0066709_100300586 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2179 | Open in IMG/M |
3300009137|Ga0066709_100515781 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Rhizocola → Rhizocola hellebori | 1686 | Open in IMG/M |
3300009137|Ga0066709_101978003 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 808 | Open in IMG/M |
3300009147|Ga0114129_10846102 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1163 | Open in IMG/M |
3300009148|Ga0105243_10340586 | Not Available | 1373 | Open in IMG/M |
3300009176|Ga0105242_12320532 | Not Available | 583 | Open in IMG/M |
3300009545|Ga0105237_11803878 | Not Available | 619 | Open in IMG/M |
3300010046|Ga0126384_10648157 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 930 | Open in IMG/M |
3300010159|Ga0099796_10547844 | Not Available | 520 | Open in IMG/M |
3300010301|Ga0134070_10167570 | Not Available | 794 | Open in IMG/M |
3300010322|Ga0134084_10232905 | Not Available | 658 | Open in IMG/M |
3300010333|Ga0134080_10113544 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1124 | Open in IMG/M |
3300010399|Ga0134127_10413065 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_20CM_4_68_12 | 1338 | Open in IMG/M |
3300010401|Ga0134121_12008707 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_20CM_4_68_12 | 611 | Open in IMG/M |
3300010403|Ga0134123_11167787 | Not Available | 798 | Open in IMG/M |
3300012198|Ga0137364_10194063 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_20CM_4_68_12 | 1486 | Open in IMG/M |
3300012198|Ga0137364_11440583 | Not Available | 509 | Open in IMG/M |
3300012200|Ga0137382_10470063 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_20CM_4_68_12 | 891 | Open in IMG/M |
3300012201|Ga0137365_10096604 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium | 2224 | Open in IMG/M |
3300012206|Ga0137380_10555843 | Not Available | 1007 | Open in IMG/M |
3300012207|Ga0137381_10532872 | Not Available | 1024 | Open in IMG/M |
3300012209|Ga0137379_10319563 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1463 | Open in IMG/M |
3300012349|Ga0137387_11030246 | Not Available | 589 | Open in IMG/M |
3300012356|Ga0137371_10101975 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2234 | Open in IMG/M |
3300012357|Ga0137384_10226667 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1561 | Open in IMG/M |
3300012951|Ga0164300_10228484 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 930 | Open in IMG/M |
3300012960|Ga0164301_11252991 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_20CM_4_68_12 | 599 | Open in IMG/M |
3300012984|Ga0164309_10563465 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 883 | Open in IMG/M |
3300012984|Ga0164309_11869286 | Not Available | 515 | Open in IMG/M |
3300012989|Ga0164305_10233264 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_20CM_4_68_12 | 1317 | Open in IMG/M |
3300012989|Ga0164305_11080435 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 688 | Open in IMG/M |
3300013105|Ga0157369_12501471 | Not Available | 523 | Open in IMG/M |
3300013297|Ga0157378_12265645 | Not Available | 595 | Open in IMG/M |
3300014326|Ga0157380_10986583 | Not Available | 875 | Open in IMG/M |
3300014745|Ga0157377_10884941 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 666 | Open in IMG/M |
3300015371|Ga0132258_10023816 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 13456 | Open in IMG/M |
3300015371|Ga0132258_10034334 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 11387 | Open in IMG/M |
3300017657|Ga0134074_1228276 | Not Available | 666 | Open in IMG/M |
3300018027|Ga0184605_10003997 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 5180 | Open in IMG/M |
3300018027|Ga0184605_10004371 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 5000 | Open in IMG/M |
3300018027|Ga0184605_10341192 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Kribbellaceae → Kribbella → unclassified Kribbella → Kribbella sp. VKM Ac-2527 | 677 | Open in IMG/M |
3300018431|Ga0066655_10639670 | Not Available | 719 | Open in IMG/M |
3300018433|Ga0066667_10236329 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1373 | Open in IMG/M |
3300018433|Ga0066667_11967836 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 536 | Open in IMG/M |
3300025885|Ga0207653_10003880 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 4700 | Open in IMG/M |
3300025898|Ga0207692_10649955 | Not Available | 681 | Open in IMG/M |
3300025898|Ga0207692_10757821 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_20CM_4_68_12 | 633 | Open in IMG/M |
3300025898|Ga0207692_10931499 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 572 | Open in IMG/M |
3300025905|Ga0207685_10248973 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 858 | Open in IMG/M |
3300025906|Ga0207699_11038243 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_20CM_4_68_12 | 606 | Open in IMG/M |
3300025907|Ga0207645_11017027 | Not Available | 561 | Open in IMG/M |
3300025910|Ga0207684_10606798 | Not Available | 934 | Open in IMG/M |
3300025918|Ga0207662_10737601 | Not Available | 692 | Open in IMG/M |
3300025927|Ga0207687_10227297 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_20CM_4_68_12 | 1472 | Open in IMG/M |
3300025929|Ga0207664_11234636 | Not Available | 666 | Open in IMG/M |
3300025931|Ga0207644_10499946 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1003 | Open in IMG/M |
3300025937|Ga0207669_10772533 | Not Available | 795 | Open in IMG/M |
3300025939|Ga0207665_10039446 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 3148 | Open in IMG/M |
3300025939|Ga0207665_10720778 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 785 | Open in IMG/M |
3300025961|Ga0207712_12043085 | Not Available | 513 | Open in IMG/M |
3300026041|Ga0207639_12002008 | Not Available | 540 | Open in IMG/M |
3300026075|Ga0207708_11951053 | Not Available | 514 | Open in IMG/M |
3300026528|Ga0209378_1153141 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_20CM_4_68_12 | 913 | Open in IMG/M |
3300026547|Ga0209156_10335264 | Not Available | 665 | Open in IMG/M |
3300028592|Ga0247822_11964999 | Not Available | 502 | Open in IMG/M |
3300028711|Ga0307293_10164240 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 707 | Open in IMG/M |
3300028828|Ga0307312_10049191 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2513 | Open in IMG/M |
3300034820|Ga0373959_0220587 | Not Available | 508 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 21.19% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 10.17% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 10.17% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 8.47% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 6.78% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 4.24% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 3.39% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 3.39% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 2.54% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.54% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 2.54% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 2.54% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.69% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.69% |
Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 1.69% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.69% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.69% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.69% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.85% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.85% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.85% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.85% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.85% |
Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.85% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.85% |
Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.85% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.85% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.85% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.85% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.85% |
Rhizosphere Soil | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil | 0.85% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.85% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
3300002911 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm | Environmental | Open in IMG/M |
3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Environmental | Open in IMG/M |
3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Environmental | Open in IMG/M |
3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Host-Associated | Open in IMG/M |
3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Host-Associated | Open in IMG/M |
3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Host-Associated | Open in IMG/M |
3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Environmental | Open in IMG/M |
3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Environmental | Open in IMG/M |
3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Environmental | Open in IMG/M |
3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
3300006058 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Host-Associated | Open in IMG/M |
3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Environmental | Open in IMG/M |
3300010301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09082015 | Environmental | Open in IMG/M |
3300010322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300010333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Host-Associated | Open in IMG/M |
3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Host-Associated | Open in IMG/M |
3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
3300017657 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09212015 | Environmental | Open in IMG/M |
3300018027 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coex | Environmental | Open in IMG/M |
3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) | Environmental | Open in IMG/M |
3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026528 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 (SPAdes) | Environmental | Open in IMG/M |
3300026547 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes) | Environmental | Open in IMG/M |
3300028592 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Cellulose_Day30 | Environmental | Open in IMG/M |
3300028711 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_150 | Environmental | Open in IMG/M |
3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Host-Associated | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI10216J12902_1033995831 | 3300000956 | Soil | VIDRGKEVTTMLSKTSLRRLCAAVLMFGVLAAVTPAAGLAANPGGGGRPTGQSQ* |
JGI10216J12902_1051502711 | 3300000956 | Soil | VSDRRKEVTKLFSKTNLRRLVAAGFVLGALAAVSPAAGLASNPGGGPHPVGKSR* |
JGI10216J12902_1079720491 | 3300000956 | Soil | MLSRTSLRRLLATGLALGVLAAVAPAAGLASNPGGGPHPTAHSR* |
JGI10216J12902_1132200822 | 3300000956 | Soil | MLSKTRLRRLLAVGLALGVLAAVTPSAGLAQNGGGGPIATG* |
JGI25390J43892_100509801 | 3300002911 | Grasslands Soil | MLSRTSLRRLLATGLALGVLAAVTPATGLASNPGGGGHPIGKSR |
Ga0062593_1029760422 | 3300004114 | Soil | MLSKTSLRRLLATGLALGVLAAVAPAAGLASNPGGGGHPIGKSR* |
Ga0062593_1029777231 | 3300004114 | Soil | SLRRLLATGLALGVLAAVAPAAGLASNPGGGPRPTAHSR* |
Ga0066676_110523262 | 3300005186 | Soil | MLSRTSLRRLLATGLALGVLAAVTPATGLASNPGGGGHPIGKSR* |
Ga0066675_100665542 | 3300005187 | Soil | MFSRANLRRLLATGLVLGVLAAVTPAAGLASNPGGGGHPVGSSR* |
Ga0066388_1002739142 | 3300005332 | Tropical Forest Soil | VSNRRKEVTKLFSKTSLRRLVAGTLVLGALAAVSPAAGLASNPGGGGRPVKTSR* |
Ga0070680_1007678771 | 3300005336 | Corn Rhizosphere | VIDQGEEVTKMLSRTSLRRLLATGLALGVLAAVTPATGLASNPGGGGHPIGKSR* |
Ga0070682_1014927911 | 3300005337 | Corn Rhizosphere | EAVIDQGKEVTKMLSRTSLRRLLATGLALGVLAAVTPATGLASNPGGGGHPIGKSR* |
Ga0070660_1008282481 | 3300005339 | Corn Rhizosphere | MSDRGKEVTEMLSRTSLRRLLATGLALGVLAAVTPATGLASNPGGGGHPIGKSR* |
Ga0070674_1005177942 | 3300005356 | Miscanthus Rhizosphere | VIDKGEEVTKMLSRTSLRRLLATGLALGVLAAVTPATGLASNPGGGGHPIGKSR* |
Ga0070673_1001508681 | 3300005364 | Switchgrass Rhizosphere | MSDRGKEVTEMLSRTSLRRLLATGLALGVLAAVTPATGLASNPGGGGHP |
Ga0070673_1002836251 | 3300005364 | Switchgrass Rhizosphere | VIDQGEEVTKMLSRTSLRRLLATGLALGVLAAVTPATGLASNPGGGGHP |
Ga0070703_100162051 | 3300005406 | Corn, Switchgrass And Miscanthus Rhizosphere | MLSRTSLRRLLATGLALGVLAAVAPAAGLASNPGGGGHPIGKSR* |
Ga0070709_102610011 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MSDRGKEVTKMLSRTSLRRLLATGLALGVLAAVTPATGLASNPGGGGHPIGKSR* |
Ga0070709_103108632 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | VIDKGEEVTKMLSRTSLRRLLATGLALGVLAAVTPATGLASNPGG |
Ga0070714_1000211022 | 3300005435 | Agricultural Soil | MISKASLRRLIAVGLTLGALAAVAPAAGLASNPGGGGGAPIGKSR* |
Ga0070713_1023945262 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MLSRTSLRRLLATGLALGVLAAVTPATGLASNPGGGGHPIG |
Ga0070710_108698692 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | VTKMLSRTSLRRLLATGLALGVLAAVTPATGLASNPGGGGHPIGKSR* |
Ga0070701_104752041 | 3300005438 | Corn, Switchgrass And Miscanthus Rhizosphere | MLSRTNLRRLLATGLALGVLAAVTPAAGLASNPGGGGHPIGKSR* |
Ga0070700_1002159442 | 3300005441 | Corn, Switchgrass And Miscanthus Rhizosphere | IDRGKEVTEMLSRTSLRRLLATGLALGVLAAVTPATGLASNPGGGGHPIGKSR* |
Ga0070706_1002313181 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | GKEVTEMLSRTSLRRLLATGLALGVLAAVTPAAGLASNPGGGGHPIGKSR* |
Ga0070706_1005464702 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | ILVSMSDRGKEVTEMLSRTSLRRLLATGLALGVLAAVTPATGLASNPGGGGHPIGKSR* |
Ga0070706_1007220252 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | VIDQGEEVTKMLSRTSLRRLLATGLALGVLAAVTPATGLASNPG |
Ga0070699_1001184302 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | EAVIDQRKEVTEMLSRTTLRRLLATGLALGVLAAVAPAAGLASNPGGGPRPTAHSR* |
Ga0070696_1008029591 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | MSDRGKEVTEMLSRTSLRRLLATGLALGVLAAVAPAAGLASNPGGGGHPIGKSR* |
Ga0070704_1004780651 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | MLSRTSLRRLLATGLALGVLAAVTPATGLASNPGGGGHPIGKS |
Ga0066707_103616731 | 3300005556 | Soil | MNDRGKEVTKMLSRTSLRRLLATGLALGVLAAVTPAAGLASNPGGGGHPVGTSR* |
Ga0066698_104509821 | 3300005558 | Soil | MLTTTSLRRLLATGLALGVLAAVTPATGLASNPGGGGHPIGKSR* |
Ga0068859_1025638212 | 3300005617 | Switchgrass Rhizosphere | MLSRTNLRRLLATGLALGVLAAVTPATGLASNPGGGGHPIGKSR* |
Ga0068861_1012659113 | 3300005719 | Switchgrass Rhizosphere | LRRLLATGLALGVLAAVTPAAGLASNPGGGGHPIGKSR* |
Ga0081455_108091821 | 3300005937 | Tabebuia Heterophylla Rhizosphere | VIDEAKEVTGMHSKTSLRRLLAVGLTLGALAAATPAAGLAANPGGGGHPVGKSR* |
Ga0066656_105785162 | 3300006034 | Soil | GKEVTKMLSRTSLRRLLATGLALGVLAAVTPATGLASNPGGGGHPIGKSR* |
Ga0066652_1020063662 | 3300006046 | Soil | MSDRRKEVTKLFSKTSLRRLLAGTLVLGALAAVSPAAGLASNPGGGPRPVGKSR* |
Ga0075432_101857271 | 3300006058 | Populus Rhizosphere | MLSSTSLRRLLATGLALGVLAAVTPATGLASNPGGGGHPIGKKPMN* |
Ga0070715_101717432 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | PRIARLSPRPLLSSVDRVIDERKEVANMISKASLRRLIAVGLTLGALAAVAPAAGLASNPGGGGGAPIGKSR* |
Ga0070712_1014404861 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | LATGLALGVLAAVTPATGLASNPGGGGHPIGKSR* |
Ga0068871_1024033911 | 3300006358 | Miscanthus Rhizosphere | VIDQGEEVTKMLSSTSLRRLLATGLALGVLAAVTPATGLASNPGGGGHPIGKSR* |
Ga0075433_104264773 | 3300006852 | Populus Rhizosphere | MLSRTSLRRLLATGLALGVLAAVTPATGLASNPGGGGHPIGK |
Ga0075433_104644142 | 3300006852 | Populus Rhizosphere | VIDHGEEVTKMLSRTSLRRLLATGLALGVLAAVTPATGLASNPGGGGHPIGKSR* |
Ga0068865_1002650262 | 3300006881 | Miscanthus Rhizosphere | LRRLLATGLALGVLAAVTPATGLASNPGGGGHPIGKSR* |
Ga0075435_1003201423 | 3300007076 | Populus Rhizosphere | MLSSTSLRRLLATGLALGVLAAVTPATGLASNPGGGGHPIGKSR* |
Ga0066710_1000870102 | 3300009012 | Grasslands Soil | MLSRTSLRRLLATGLALGVLAAVTPATGLASNPGGRGHPIGKSR |
Ga0066710_1006511521 | 3300009012 | Grasslands Soil | ISDRGKEAIRMFSRANLRRLLATGLVLGVLAAVTPAAGLASNPGGGHPVGSSR |
Ga0066710_1008030132 | 3300009012 | Grasslands Soil | MLSRTSLRRLLATGVALGVLAAGTPATGLASNPGGGGHPIGKSR |
Ga0099827_119199401 | 3300009090 | Vadose Zone Soil | MSDRGKEVTKMLSRTSLRRLLATGLALGVLAAVAPAAGLASNPGGGGHPIGKSR* |
Ga0105245_132784661 | 3300009098 | Miscanthus Rhizosphere | MLSRTNLRRLLATGLALGVLAAVAPAAGLASNPGGGGHPIGKSR* |
Ga0066709_1003005862 | 3300009137 | Grasslands Soil | MSDRREEVTKLFSKTSLRRLLATGLALGVLAAVTPAAGLASNPGGGGHPVGKSR* |
Ga0066709_1005157811 | 3300009137 | Grasslands Soil | MSDRGKEVTKMLSRTSLRRLLATGLALGVLAAVTPATGLASNPGGGGHP |
Ga0066709_1019780031 | 3300009137 | Grasslands Soil | TKMLSRTSLRRLLATGLALGVLAAVTPATGLASNPGGGGHPIGKSR* |
Ga0114129_108461021 | 3300009147 | Populus Rhizosphere | RRLLATGLALGVLAAVTPATGLASNPGGGGHPIGKSR* |
Ga0105243_103405862 | 3300009148 | Miscanthus Rhizosphere | MSDRGKEVTEMFSRTSLRRLLATGLALGVLAAVTPATGLASNPGGGGHTIGKSR* |
Ga0105242_123205321 | 3300009176 | Miscanthus Rhizosphere | MLSRTSLRRLFATGLALGVLAAVTPAAGLASNPGGGGHPIGKSR* |
Ga0105237_118038782 | 3300009545 | Corn Rhizosphere | MLSRTNLRRVLATGLALGVLAAVTPAAGLASNPGGGGHPIGKSR* |
Ga0126384_106481573 | 3300010046 | Tropical Forest Soil | VAAKPTVDPVSDRRKEVTKLFSKTSLRRLVAGGLVLGALAAVSPAAGLASNPGGGPRPVGKPMK* |
Ga0099796_105478441 | 3300010159 | Vadose Zone Soil | RTSLRRLLATGLALGVLAAVTPAAGLASNPGGGGHPIGKSR* |
Ga0134070_101675702 | 3300010301 | Grasslands Soil | MSDRGKEVTKMLSRTSLRRLLATGLALGVLAAVTPATGLASNPGGGGHPIGKRR* |
Ga0134084_102329052 | 3300010322 | Grasslands Soil | SDRRKEVTKLFSMTNLRRLVAAGFVLGALAAVSPAAGLASNPGGGPHPVGKSR* |
Ga0134080_101135442 | 3300010333 | Grasslands Soil | DQGKEVTKMSSKRSLRRLIAVGFALGVLAAMTPAAGLASNPGGGPHPIVHSR* |
Ga0134127_104130652 | 3300010399 | Terrestrial Soil | MSDRGNEVTKMLSRTSLRRLLATGLALGVLAAVTPATGLASNPGGGGHPIGKSR* |
Ga0134121_120087071 | 3300010401 | Terrestrial Soil | MSDRGKEVTKMLSRTSLRRLLATGLALGVLAAVTPATGLASNPGGGGHPIGKSR |
Ga0134123_111677872 | 3300010403 | Terrestrial Soil | ARPSVEAVIDRGKEVTEMLSRTSLRRLLATGLALGVLAAVTPAAGLASNPGGGGHPIGKSR* |
Ga0137364_101940631 | 3300012198 | Vadose Zone Soil | MNDRGKEVTKMLSRTSLRRLLATGLALGVLAAVTPAAGLASNPGGGGHPIGKSR* |
Ga0137364_114405832 | 3300012198 | Vadose Zone Soil | MSDRGKEVTKMLSRTSLRRLLATGLALGVLAAVTPATGLASNPGGGGHPI |
Ga0137382_104700632 | 3300012200 | Vadose Zone Soil | MNDRGKEVTKMLSRTSLRRLLATGLALGVLAAVTPATGLASNPGGGGHPIGKSR* |
Ga0137365_100966042 | 3300012201 | Vadose Zone Soil | MFSRTSLRRLLATGLALGVLAAVTPAAGLASNPGGGGHPIGKSQ* |
Ga0137380_105558432 | 3300012206 | Vadose Zone Soil | MSDRGKEVTKMLTTTSLRRLLATGLALGVLAAVTPATGLASNPGGGGHPIGKSR* |
Ga0137381_105328722 | 3300012207 | Vadose Zone Soil | MSDRGKEVTKMLTTTSLRRLLATGLALGVLAAVTPAAGLASNPGGGGHPIGKSR* |
Ga0137379_103195632 | 3300012209 | Vadose Zone Soil | VIDQGKEVTKMLSRTSLRRLLATGLALGVLAAVTPATGLASNPGGGGHPIGKSR* |
Ga0137387_110302461 | 3300012349 | Vadose Zone Soil | MSDRGKEVTKMLTTTSLRRLLATGLASNPGGGGHPIGKSR* |
Ga0137371_101019752 | 3300012356 | Vadose Zone Soil | RLLATGLALGVLAAGTPATGLAANPGGGGHPIGKSR* |
Ga0137384_102266671 | 3300012357 | Vadose Zone Soil | SLRRLLATGLALGVLAAVTPATGLASNPGGGGHPIGKSR* |
Ga0164300_102284842 | 3300012951 | Soil | MSDRGKEVTKMLSKTSLRRLLATGLALGVLAAVTPAAGLASNPGGGGHPIGKSR* |
Ga0164301_112529911 | 3300012960 | Soil | MSDRGKEVTKMLSRTSLRRLLATGLALGVLAAVTPAAGLASNPGGGGHP |
Ga0164309_105634651 | 3300012984 | Soil | EVTEMLSRTSLRRLLATGLALGVLAAVAPAAGLASNPGGGGHPIGKSR* |
Ga0164309_118692861 | 3300012984 | Soil | MSDRGKEGTKMLSRTSLRRLLAAGLALGVLAAVAPAAGLASNPGGGGHPIGKSR* |
Ga0164305_102332643 | 3300012989 | Soil | MSDRGKEVTKMLSRTSLRRLLATGLALGVLAAVTPAAGLASNPGGGGHPIGK |
Ga0164305_110804352 | 3300012989 | Soil | RLIATGLALGVLAAVTPAAGLASNPGGGGHPIGKSR* |
Ga0157369_125014711 | 3300013105 | Corn Rhizosphere | ERVLRSSRPRATEEKEVTKMLSRTNLRRLLATGLALGVLAAVTPAAGLASNPGGGGHPIGKSR* |
Ga0157378_122656451 | 3300013297 | Miscanthus Rhizosphere | TEMLSRTSLRRLLATGLALGVLAAVAPAAGLASNPGGGGHPIGKSR* |
Ga0157380_109865832 | 3300014326 | Switchgrass Rhizosphere | RVLRSSRPRATEEKEVTKMLSRTNLRRLLATGLALGVLAAVTPAAGLASNPGGGGHPIGKSR* |
Ga0157377_108849412 | 3300014745 | Miscanthus Rhizosphere | VIDQRKEVTEMLSRTTLRRLLATGLALGVLAAVAPAAGLASNPGG |
Ga0132258_100238168 | 3300015371 | Arabidopsis Rhizosphere | VIDERKEVANMISKASLRRLIAVGLTLGALAAVAPAAGLASNPGGGGGAPIGKSR* |
Ga0132258_1003433411 | 3300015371 | Arabidopsis Rhizosphere | VSDRRKEVTKLFSKTSLRRLVAGVLVLGALAAVSPAAGLASNPGGGPRPVGKSR* |
Ga0134074_12282761 | 3300017657 | Grasslands Soil | MLTTTSVRRLLATGLALGVLAAVTPATGLASNPGGGGHPIGKSQ |
Ga0184605_100039972 | 3300018027 | Groundwater Sediment | MTDRRREVTEVFSKTRLRRQLATGLVLGVLAAVAPATGLAQNGGGGPVPIGRNR |
Ga0184605_100043713 | 3300018027 | Groundwater Sediment | MLSKTSLRRLCAAVLMFGVLAAVTPAAGLAANPGGGGRPTGQSQ |
Ga0184605_103411922 | 3300018027 | Groundwater Sediment | MLSKTRLRRLLAVGLALGVLAAVTPAAGLAENIGGGPVATG |
Ga0066655_106396701 | 3300018431 | Grasslands Soil | MLSRTSLRRLLATGLALGVLAAVTPAAGLASNPGGGGHPVGKSR |
Ga0066667_102363292 | 3300018433 | Grasslands Soil | MFSRANLRRLLATGLVLGVLAAVTPAAGLASNPGGGHPVGSSR |
Ga0066667_119678361 | 3300018433 | Grasslands Soil | MMLSKTSLRRLCAAALMIGVLAAVTPAAGLAANPGGGGRPTGQSR |
Ga0207653_100038802 | 3300025885 | Corn, Switchgrass And Miscanthus Rhizosphere | MLSRTSLRRLLATGLALGVLAAVTPAAGLASNPGGGGHPIGKSR |
Ga0207692_106499552 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | RPLLSSVDRVIDERKEVANMISKASLRRLIAVGLTLGALAAVAPAAGLASNPGGGGGAPIGKSR |
Ga0207692_107578212 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | MLSRTSLRRLLATGLALGVLAAVTPATGLASNPGGGGHTI |
Ga0207692_109314991 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | MLSSTSLRRLLATGLALGVLAAVTPATGLASNPGGGGHPIGKSR |
Ga0207685_102489731 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | KEVANMISKASLRRLIAVGLTLGALAAVAPAAGLASNPGGGGGAPIGKSR |
Ga0207699_110382431 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | MLSRTSLRRLLATGLALGVLAAVTPATGLASNPGGGGHPI |
Ga0207645_110170272 | 3300025907 | Miscanthus Rhizosphere | RATEEKEVTKMLSRTNLRRLLATGLALGVLAAVTPAAGLASNPGGGGHPIGKSR |
Ga0207684_106067981 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | ILVSMSDRGKEVTEMLSRTSLRRLLATGLALGVLAAVTPATGLASNPGGGGHPIGKSR |
Ga0207662_107376011 | 3300025918 | Switchgrass Rhizosphere | MLSRTNLRRLLATGLALGVLAAVTPATSLASNPGGGGHPIGKSR |
Ga0207687_102272973 | 3300025927 | Miscanthus Rhizosphere | MLSRTNLRRLLATGLALGVLAAVTPAAGLASNPGGGGHPIGK |
Ga0207664_112346362 | 3300025929 | Agricultural Soil | SLRRLLATGLALGVLAAVTPATGLASNPGGGGHPIGKSR |
Ga0207644_104999461 | 3300025931 | Switchgrass Rhizosphere | VIDQGEEVTKMLSRTSLRRLLATGLALGVLAAVTPATGLASNPGGGGHPIGKSG |
Ga0207669_107725331 | 3300025937 | Miscanthus Rhizosphere | AVIDKGEEVTKMLSRTSLRRLLATGLALGVLAAVTPATGLASNPGGGGHPIGKSR |
Ga0207665_100394465 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | MLSRTSLRRLLATGLALGVLAAVTPATGLASNPGGGGHP |
Ga0207665_107207781 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | MLSSTSLRRLLATGLALGVLAAVTPATGLASNPGGGGHP |
Ga0207712_120430851 | 3300025961 | Switchgrass Rhizosphere | NAARPSVEALIDRGKEVTEMLSRTSLRRLLATGLALGVLAAVAPAAGLASNPGGGGHPIGKSR |
Ga0207639_120020081 | 3300026041 | Corn Rhizosphere | VIDQGEEVTKMLSRTSLRRLLATGLALGVLAAVAPAAGLASNPGGGGHPIGKSR |
Ga0207708_119510531 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | DPNAARPSVEAVIDRGKEVTEMLSRTSLRRLLATGLALGVLAAVTPAAGLASNPGGGGHPIGKSR |
Ga0209378_11531412 | 3300026528 | Soil | MNDRGKEVTKMLSRTSLRRLLATGLALGVLAAVTPAAGLASNPGGGGHPVGTSR |
Ga0209156_103352641 | 3300026547 | Soil | MFSRANLRRLLATGLVLGVLAAVTPAAGLASNPGGGGHPVGSSR |
Ga0247822_119649992 | 3300028592 | Soil | SLRRLLATGLALGVLAAVAPAAGLASNPGGGGHPIGKSR |
Ga0307293_101642402 | 3300028711 | Soil | MLSKTRLSRLLAVGLALGVLAAVTPAAGLAENIGGGPVATG |
Ga0307312_100491911 | 3300028828 | Soil | VFSKTRLRRQLATGLVLGVLAAVAPATGLAQNGGGGPVPIGRNR |
Ga0373959_0220587_399_506 | 3300034820 | Rhizosphere Soil | IAVGLTLGALAAVAPAAGLASNPGGGGGAPIGKSR |
⦗Top⦘ |