NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F076789

Metagenome / Metatranscriptome Family F076789

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F076789
Family Type Metagenome / Metatranscriptome
Number of Sequences 117
Average Sequence Length 38 residues
Representative Sequence MVIIALFGGLVAGGALFAILKNSGSKSTESKYTKLDIG
Number of Associated Samples 82
Number of Associated Scaffolds 117

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 86.32 %
% of genes near scaffold ends (potentially truncated) 13.68 %
% of genes from short scaffolds (< 2000 bps) 64.96 %
Associated GOLD sequencing projects 80
AlphaFold2 3D model prediction Yes
3D model pTM-score0.38

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (58.120 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment
(14.530 % of family members)
Environment Ontology (ENVO) Unclassified
(42.735 % of family members)
Earth Microbiome Project Ontology (EMPO) Unclassified
(41.026 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 45.45%    β-sheet: 0.00%    Coil/Unstructured: 54.55%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.38
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 117 Family Scaffolds
PF00248Aldo_ket_red 14.53
PF11138DUF2911 12.82
PF08547CIA30 12.82
PF00092VWA 3.42
PF01569PAP2 3.42
PF07090GATase1_like 3.42
PF0563523S_rRNA_IVP 1.71
PF00871Acetate_kinase 1.71
PF00420Oxidored_q2 1.71
PF00849PseudoU_synth_2 1.71
PF13519VWA_2 0.85
PF13432TPR_16 0.85
PF00793DAHP_synth_1 0.85
PF13525YfiO 0.85
PF13701DDE_Tnp_1_4 0.85
PF00005ABC_tran 0.85
PF01252Peptidase_A8 0.85
PF02746MR_MLE_N 0.85
PF13374TPR_10 0.85
PF07690MFS_1 0.85
PF13188PAS_8 0.85
PF00326Peptidase_S9 0.85
PF064393keto-disac_hyd 0.85

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 117 Family Scaffolds
COG5426Uncharacterized protein STM3548, contains class I glutamine amidotransferase domainGeneral function prediction only [R] 3.42
COG0282Acetate kinaseEnergy production and conversion [C] 1.71
COG0564Pseudouridine synthase RluA, 23S rRNA- or tRNA-specificTranslation, ribosomal structure and biogenesis [J] 1.71
COG0597Lipoprotein signal peptidaseCell wall/membrane/envelope biogenesis [M] 1.71
COG1187Pseudouridylate synthase RsuA, specific for 16S rRNA U516 and 23S rRNA U2605Translation, ribosomal structure and biogenesis [J] 1.71
COG3426Butyrate kinaseEnergy production and conversion [C] 1.71
COG4948L-alanine-DL-glutamate epimerase or related enzyme of enolase superfamilyCell wall/membrane/envelope biogenesis [M] 1.71

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms58.12 %
UnclassifiedrootN/A41.88 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300004152|Ga0062386_100439853All Organisms → cellular organisms → Bacteria1054Open in IMG/M
3300005541|Ga0070733_10493769Not Available818Open in IMG/M
3300009167|Ga0113563_10458597All Organisms → cellular organisms → Bacteria → Acidobacteria1378Open in IMG/M
3300009547|Ga0116136_1061616Not Available1027Open in IMG/M
3300009549|Ga0116137_1002972All Organisms → cellular organisms → Bacteria → Acidobacteria9523Open in IMG/M
3300009552|Ga0116138_1000028All Organisms → cellular organisms → Bacteria110224Open in IMG/M
3300009643|Ga0116110_1129448Not Available843Open in IMG/M
3300009839|Ga0116223_10338529Not Available892Open in IMG/M
3300010324|Ga0129297_10087589All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1473Open in IMG/M
3300010341|Ga0074045_10163709Not Available1505Open in IMG/M
3300010341|Ga0074045_10734816Not Available626Open in IMG/M
3300010343|Ga0074044_10008564All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae7960Open in IMG/M
3300010343|Ga0074044_11029819Not Available540Open in IMG/M
3300010379|Ga0136449_100546709All Organisms → cellular organisms → Bacteria1993Open in IMG/M
3300010391|Ga0136847_11048274All Organisms → cellular organisms → Bacteria1832Open in IMG/M
3300012931|Ga0153915_10071045All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae3623Open in IMG/M
3300012931|Ga0153915_11739487All Organisms → cellular organisms → Bacteria → Acidobacteria729Open in IMG/M
3300012964|Ga0153916_10121100All Organisms → cellular organisms → Bacteria2513Open in IMG/M
3300014153|Ga0181527_1009885All Organisms → cellular organisms → Bacteria7098Open in IMG/M
3300014153|Ga0181527_1228563Not Available761Open in IMG/M
3300014155|Ga0181524_10191435Not Available1011Open in IMG/M
3300014169|Ga0181531_10577755Not Available696Open in IMG/M
3300014199|Ga0181535_10030550All Organisms → cellular organisms → Bacteria → Acidobacteria4021Open in IMG/M
3300014201|Ga0181537_10765121Not Available656Open in IMG/M
3300014490|Ga0182010_10063201All Organisms → cellular organisms → Bacteria → Terrabacteria group1789Open in IMG/M
3300014491|Ga0182014_10047352All Organisms → cellular organisms → Bacteria3007Open in IMG/M
3300014492|Ga0182013_10388863All Organisms → cellular organisms → Bacteria752Open in IMG/M
3300014498|Ga0182019_11053764Not Available592Open in IMG/M
3300014499|Ga0182012_10063209All Organisms → cellular organisms → Bacteria2915Open in IMG/M
3300014502|Ga0182021_11685107Not Available763Open in IMG/M
3300014502|Ga0182021_12270627Not Available653Open in IMG/M
3300014502|Ga0182021_12709108Not Available596Open in IMG/M
3300014502|Ga0182021_13055012Not Available560Open in IMG/M
3300014654|Ga0181525_10515504Not Available662Open in IMG/M
3300014839|Ga0182027_10219575All Organisms → cellular organisms → Bacteria2193Open in IMG/M
3300016705|Ga0181507_1315815Not Available516Open in IMG/M
3300016728|Ga0181500_1041381Not Available676Open in IMG/M
3300017929|Ga0187849_1000626All Organisms → cellular organisms → Bacteria45810Open in IMG/M
3300017929|Ga0187849_1069846All Organisms → cellular organisms → Bacteria1564Open in IMG/M
3300017934|Ga0187803_10011197All Organisms → cellular organisms → Bacteria3583Open in IMG/M
3300017935|Ga0187848_10215497Not Available820Open in IMG/M
3300017940|Ga0187853_10059646All Organisms → cellular organisms → Bacteria → Terrabacteria group1938Open in IMG/M
3300017940|Ga0187853_10256140Not Available802Open in IMG/M
3300017943|Ga0187819_10566666Not Available645Open in IMG/M
3300017946|Ga0187879_10829538Not Available517Open in IMG/M
3300017948|Ga0187847_10239459All Organisms → cellular organisms → Bacteria → Terrabacteria group988Open in IMG/M
3300017970|Ga0187783_10004324All Organisms → cellular organisms → Bacteria10519Open in IMG/M
3300017972|Ga0187781_10094225Not Available2075Open in IMG/M
3300017972|Ga0187781_10476421Not Available895Open in IMG/M
3300017975|Ga0187782_10178733All Organisms → cellular organisms → Bacteria1585Open in IMG/M
3300017975|Ga0187782_10278561Not Available1260Open in IMG/M
3300017975|Ga0187782_10284413Not Available1246Open in IMG/M
3300017975|Ga0187782_10511197Not Available919Open in IMG/M
3300017975|Ga0187782_11092768Not Available622Open in IMG/M
3300017988|Ga0181520_10008756All Organisms → cellular organisms → Bacteria → Acidobacteria14244Open in IMG/M
3300017998|Ga0187870_1060250All Organisms → cellular organisms → Bacteria1583Open in IMG/M
3300018014|Ga0187860_1395713Not Available519Open in IMG/M
3300018062|Ga0187784_11302197Not Available576Open in IMG/M
3300018088|Ga0187771_10459771All Organisms → cellular organisms → Bacteria1075Open in IMG/M
3300018088|Ga0187771_10462021All Organisms → cellular organisms → Bacteria1073Open in IMG/M
3300018090|Ga0187770_10414119Not Available1060Open in IMG/M
3300018090|Ga0187770_11124844Not Available634Open in IMG/M
3300019256|Ga0181508_1609088Not Available773Open in IMG/M
3300022551|Ga0212089_10056622All Organisms → cellular organisms → Bacteria2254Open in IMG/M
3300027825|Ga0209039_10006523All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae7703Open in IMG/M
3300027896|Ga0209777_10040059All Organisms → cellular organisms → Bacteria4337Open in IMG/M
3300027896|Ga0209777_10611156All Organisms → cellular organisms → Bacteria → Acidobacteria787Open in IMG/M
3300029922|Ga0311363_11238858Not Available625Open in IMG/M
3300031261|Ga0302140_10093427All Organisms → cellular organisms → Bacteria3048Open in IMG/M
3300031524|Ga0302320_11344218Not Available717Open in IMG/M
(restricted) 3300031587|Ga0315308_1133910All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium980Open in IMG/M
3300031707|Ga0315291_10043908All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae5098Open in IMG/M
3300031772|Ga0315288_10077434All Organisms → cellular organisms → Bacteria3868Open in IMG/M
3300031862|Ga0315280_10000511All Organisms → cellular organisms → Bacteria71961Open in IMG/M
3300031862|Ga0315280_10005716All Organisms → cellular organisms → Bacteria → Acidobacteria17586Open in IMG/M
3300031862|Ga0315280_10011156All Organisms → cellular organisms → Bacteria11103Open in IMG/M
(restricted) 3300031877|Ga0315314_1067222All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1635Open in IMG/M
(restricted) 3300031877|Ga0315314_1125730All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1024Open in IMG/M
3300031949|Ga0214473_11881832All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium588Open in IMG/M
3300031952|Ga0315294_10035149All Organisms → cellular organisms → Bacteria → Acidobacteria5398Open in IMG/M
3300031965|Ga0326597_10040458All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae5889Open in IMG/M
3300031965|Ga0326597_12189835Not Available506Open in IMG/M
3300032046|Ga0315289_10253011All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia1867Open in IMG/M
3300032070|Ga0315279_10000227All Organisms → cellular organisms → Bacteria122351Open in IMG/M
3300032156|Ga0315295_12274704All Organisms → cellular organisms → Bacteria502Open in IMG/M
3300032160|Ga0311301_10127591All Organisms → cellular organisms → Bacteria4749Open in IMG/M
3300032160|Ga0311301_10348174All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2321Open in IMG/M
3300032160|Ga0311301_11457235Not Available848Open in IMG/M
3300032163|Ga0315281_12123657Not Available534Open in IMG/M
3300032173|Ga0315268_10006939All Organisms → cellular organisms → Bacteria11995Open in IMG/M
3300032173|Ga0315268_12411961Not Available540Open in IMG/M
3300032401|Ga0315275_11706219All Organisms → cellular organisms → Bacteria671Open in IMG/M
3300032770|Ga0335085_10061108All Organisms → cellular organisms → Bacteria → Acidobacteria5032Open in IMG/M
3300032782|Ga0335082_10887862Not Available754Open in IMG/M
3300032783|Ga0335079_10081605All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia3674Open in IMG/M
3300032783|Ga0335079_11809521All Organisms → cellular organisms → Bacteria594Open in IMG/M
3300032805|Ga0335078_10681788All Organisms → cellular organisms → Bacteria1278Open in IMG/M
3300032805|Ga0335078_11540532Not Available740Open in IMG/M
3300032805|Ga0335078_12483628Not Available535Open in IMG/M
3300032892|Ga0335081_10352089All Organisms → cellular organisms → Bacteria1919Open in IMG/M
3300032892|Ga0335081_10410263Not Available1739Open in IMG/M
3300032895|Ga0335074_11208082Not Available636Open in IMG/M
3300033233|Ga0334722_10010319All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae8681Open in IMG/M
3300033402|Ga0326728_10008750All Organisms → cellular organisms → Bacteria → Acidobacteria24877Open in IMG/M
3300033402|Ga0326728_10122225All Organisms → cellular organisms → Bacteria2986Open in IMG/M
3300033402|Ga0326728_10508388Not Available976Open in IMG/M
3300033402|Ga0326728_11000685Not Available579Open in IMG/M
3300033402|Ga0326728_11014501Not Available573Open in IMG/M
3300033405|Ga0326727_10009416All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia24062Open in IMG/M
3300033405|Ga0326727_10153439All Organisms → cellular organisms → Bacteria2706Open in IMG/M
3300033486|Ga0316624_10005459All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae5916Open in IMG/M
3300033513|Ga0316628_100418432All Organisms → cellular organisms → Bacteria → Acidobacteria1709Open in IMG/M
3300033755|Ga0371489_0000128All Organisms → cellular organisms → Bacteria156782Open in IMG/M
3300033977|Ga0314861_0000186All Organisms → cellular organisms → Bacteria107017Open in IMG/M
3300033977|Ga0314861_0106977All Organisms → cellular organisms → Bacteria1419Open in IMG/M
3300033977|Ga0314861_0151774Not Available1131Open in IMG/M
3300034091|Ga0326724_0054790All Organisms → cellular organisms → Bacteria2864Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment14.53%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland11.11%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland10.26%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil10.26%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil7.69%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog6.84%
FenEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Fen5.98%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil4.27%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland3.42%
Bog Forest SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil3.42%
Freshwater WetlandsEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands2.56%
PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland2.56%
BogEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Bog2.56%
Freshwater Lake SedimentEnvironmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment1.71%
Lake SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Lake Sediment1.71%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil1.71%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment1.71%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.71%
BogEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Bog1.71%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Sediment0.85%
Freshwater WetlandsEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands0.85%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil0.85%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil0.85%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen0.85%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300004152Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3EnvironmentalOpen in IMG/M
3300005541Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1EnvironmentalOpen in IMG/M
3300009167Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG - Illumina Assembly (version 2)EnvironmentalOpen in IMG/M
3300009547Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_40EnvironmentalOpen in IMG/M
3300009549Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_100EnvironmentalOpen in IMG/M
3300009552Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_150EnvironmentalOpen in IMG/M
3300009643Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_40EnvironmentalOpen in IMG/M
3300009839Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaGEnvironmentalOpen in IMG/M
3300010324Lake sediment bacterial and archeal communities from Gulf of Boni, Indonesia to study Microbial Dark Matter (Phase II) - ?I18A1 metaGEnvironmentalOpen in IMG/M
3300010341Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2EnvironmentalOpen in IMG/M
3300010343Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1EnvironmentalOpen in IMG/M
3300010379Sb_50d combined assemblyEnvironmentalOpen in IMG/M
3300010391Freshwater sediment microbial communities from Lake Superior, USA - Station SU-17. Combined Assembly of Gp0155404, Gp0155335, Gp0155336, Gp0155336, Gp0155403, Gp0155406EnvironmentalOpen in IMG/M
3300012931Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaGEnvironmentalOpen in IMG/M
3300012964Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 4 metaGEnvironmentalOpen in IMG/M
3300014153Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_60_metaGEnvironmentalOpen in IMG/M
3300014155Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_60_metaGEnvironmentalOpen in IMG/M
3300014169Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaGEnvironmentalOpen in IMG/M
3300014199Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_30_metaGEnvironmentalOpen in IMG/M
3300014201Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_10_metaGEnvironmentalOpen in IMG/M
3300014490Permafrost microbial communities from Stordalen Mire, Sweden - 611E1M metaGEnvironmentalOpen in IMG/M
3300014491Permafrost microbial communities from Stordalen Mire, Sweden - 612S2D metaGEnvironmentalOpen in IMG/M
3300014492Permafrost microbial communities from Stordalen Mire, Sweden - 612S2M metaGEnvironmentalOpen in IMG/M
3300014498Permafrost microbial communities from Stordalen Mire, Sweden - 812E2M metaGEnvironmentalOpen in IMG/M
3300014499Permafrost microbial communities from Stordalen Mire, Sweden - 612S2S metaGEnvironmentalOpen in IMG/M
3300014502Permafrost microbial communities from Stordalen Mire, Sweden - 612E3M metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300014654Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_10_metaGEnvironmentalOpen in IMG/M
3300014839Permafrost microbial communities from Stordalen Mire, Sweden - 712E1D metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300016705Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016728Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_10_metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300017929Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_100EnvironmentalOpen in IMG/M
3300017934Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_3EnvironmentalOpen in IMG/M
3300017935Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_40EnvironmentalOpen in IMG/M
3300017940Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_100EnvironmentalOpen in IMG/M
3300017943Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4EnvironmentalOpen in IMG/M
3300017946Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10EnvironmentalOpen in IMG/M
3300017948Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_10EnvironmentalOpen in IMG/M
3300017970Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300017972Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300017975Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300017988Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_30_metaGEnvironmentalOpen in IMG/M
3300017998Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_150EnvironmentalOpen in IMG/M
3300018014Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_40EnvironmentalOpen in IMG/M
3300018062Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018088Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MGEnvironmentalOpen in IMG/M
3300018090Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300019256Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_10_metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300022551Boni_combined assemblyEnvironmentalOpen in IMG/M
3300027825Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM1 (SPAdes)EnvironmentalOpen in IMG/M
3300027896Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies -HBP12 HB (SPAdes)EnvironmentalOpen in IMG/M
3300029922III_Fen_E1 coassemblyEnvironmentalOpen in IMG/M
3300031261Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E1_1EnvironmentalOpen in IMG/M
3300031524Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_3EnvironmentalOpen in IMG/M
3300031587 (restricted)Freshwater sediment microbial communities from Lake Towuti, South Sulawesi, Indonesia - TDP3EnvironmentalOpen in IMG/M
3300031707Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_20EnvironmentalOpen in IMG/M
3300031772Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_20EnvironmentalOpen in IMG/M
3300031862Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G06_40EnvironmentalOpen in IMG/M
3300031877 (restricted)Freshwater sediment microbial communities from Lake Towuti, South Sulawesi, Indonesia - TDP9EnvironmentalOpen in IMG/M
3300031949Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT98D197EnvironmentalOpen in IMG/M
3300031952Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_40EnvironmentalOpen in IMG/M
3300031965Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT100D185EnvironmentalOpen in IMG/M
3300032046Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_40EnvironmentalOpen in IMG/M
3300032070Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G06_20EnvironmentalOpen in IMG/M
3300032156Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G14_0EnvironmentalOpen in IMG/M
3300032160Sb_50d combined assembly (MetaSPAdes)EnvironmentalOpen in IMG/M
3300032163Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G07_0EnvironmentalOpen in IMG/M
3300032173Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_topEnvironmentalOpen in IMG/M
3300032401Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G03_0EnvironmentalOpen in IMG/M
3300032770Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5EnvironmentalOpen in IMG/M
3300032782Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1EnvironmentalOpen in IMG/M
3300032783Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3EnvironmentalOpen in IMG/M
3300032805Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2EnvironmentalOpen in IMG/M
3300032892Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5EnvironmentalOpen in IMG/M
3300032895Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3EnvironmentalOpen in IMG/M
3300033233Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_bottomEnvironmentalOpen in IMG/M
3300033402Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB31MNEnvironmentalOpen in IMG/M
3300033405Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB29MYEnvironmentalOpen in IMG/M
3300033486Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_N3_C1_D5_AEnvironmentalOpen in IMG/M
3300033513Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D5_CEnvironmentalOpen in IMG/M
3300033755Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB26FY SIP fractionEnvironmentalOpen in IMG/M
3300033977Tropical peat soil microbial communities from peatlands in Loreto, Peru - SJ75EnvironmentalOpen in IMG/M
3300034091Peat soil microbial communities from McLean, Ithaca, NY, United States - MB00NEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
Ga0062386_10043985313300004152Bog Forest SoilPMVIIALFGGLVAGGALFAILRNSGGKASDSKYTKLNIG*
Ga0070733_1049376923300005541Surface SoilMVIFALFGSLVCGGALFAFVRNAGAKASDSQYTKLDIN*
Ga0113563_1045859723300009167Freshwater WetlandsMVVVAIFGGLVLGGVIFAALKNSGKSEGKSISKLNIGR*
Ga0116136_106161623300009547PeatlandMVIIAVFGGLVVGGALFAILKNSGGKSTDDKYTKLDIG*
Ga0116137_100297293300009549PeatlandMVIIAVFGGLVIGGALFAVLKNSGSKSADSRYTKLDIG*
Ga0116138_1000028483300009552PeatlandMVIIAVFGGLVIGGAIFAVVKNSGGRATNSKYTKLDIG*
Ga0116110_112944823300009643PeatlandMVIIALFGSLVVGGAIFAVLKNSGGKGKESKYTKLDIG*
Ga0116223_1033852923300009839Peatlands SoilMVIIALFGGLVIGGALFAVLKNSGNKSAEGKYTKLDIG*
Ga0129297_1008758913300010324Lake SedimentMVVIAILGGLFVGGAIFAALKNTGKASSSKYTKLNIG*
Ga0074045_1016370923300010341Bog Forest SoilMVIIALFGGLVVGGALFAILKNSGNKAAESKYTKLDIG*
Ga0074045_1073481613300010341Bog Forest SoilMVIIAVFGGLVVGGALFAVLKNAGSKASDDKYTKLDIG*
Ga0074044_1000856463300010343Bog Forest SoilMVIIALFGGLVVGGALLAILKNSGSKGTDSKYTKLNIG*
Ga0074044_1102981923300010343Bog Forest SoilMVIIAMVGGLVVGGALFAILKNSGSNSKESKYTKLDIG*
Ga0136449_10054670923300010379Peatlands SoilVVIIAMFGGLVLGGAIFAVLKNSVGGAKENKPIKLNIG*
Ga0136847_1104827433300010391Freshwater SedimentMVIVAVLGGLIAGGAIFAVVKNSGKSSDDKYTKLKIG*
Ga0153915_1007104533300012931Freshwater WetlandsMVIIAVFGGLVAGGAIFAFLKNSGRKARASYTKLNIV*
Ga0153915_1173948713300012931Freshwater WetlandsMVILAVAGGLFIGGALFAVLKNSGGSDKKYTKLNIG*
Ga0153916_1012110023300012964Freshwater WetlandsMVLIAVVGGLLVGGALFAVLKNSGGSDKKYTKLNIG*
Ga0181527_100988563300014153BogMVIIGLFGGLVIGGALFAILRNSGSKSTESKYTKLDIG*
Ga0181527_122856313300014153BogMVIIAVFGGLVVGGALFAILKNSGGQSTDDKYTKLDIG*
Ga0181524_1019143523300014155BogMVIIALFGGLVVGGALFAVLKNAGGKSAESKYTKLDIG*
Ga0181531_1057775513300014169BogMVIIALFGGLVVGGALFAILKNAGGKSAETKYTKLDIG*
Ga0181535_1003055043300014199BogMVIIAVFGGLVVGGAIFAVLKNSGGKSTEDKYTKLDIG*
Ga0181537_1076512123300014201BogMVIVALFGSLVAGGALFAFIRNAGAKAAESKYTKLDIG*
Ga0182010_1006320123300014490FenMVIIALFGGLVVGGALFAILKSAGGKSAESKYTKLDIG*
Ga0182014_1004735223300014491BogMVIIAMVGGLVVGGALFAILKNAGGKSSESKYTKLDIG*
Ga0182013_1038886323300014492BogMVIIALFGGLVVGGAVFAILKNTGGKSTESKYTKLDIG*
Ga0182019_1105376413300014498FenVLLNPMVIIALFGGLVAGGALFAILKNASGRSAESKYTKLDIG*
Ga0182012_1006320923300014499BogMVIIAMVGGLVVGGALFALLKNAGSKSSESKYTKLDIG*
Ga0182021_1168510713300014502FenMVIIAVFGGLVIGGAIFAALKNSTAKSDDKVTKLRIG*
Ga0182021_1227062723300014502FenMVIIAVFGGLVVGGALFAILKNNGSKSAESKYTKLDIG*
Ga0182021_1270910823300014502FenMVIIAMVGGLFAGGALFAILKNAGNKSSESKYTKLDTG*
Ga0182021_1305501213300014502FenMVIIALFGSLVAGGAFFAFVRNAGAKSAETQYTKLDIG*
Ga0181525_1051550423300014654BogMVIIALFGSLVAGGALFAILKNASGKTSESKYTKLDIG*
Ga0182027_1021957523300014839FenMVIIALFGGLVVGGALFAVLKNTGNKSSEGKYTKLDIG*
Ga0181507_131581513300016705PeatlandFDPMVIIALFGGLVVGGAVFAILKNTGSKATESKYTKLDIG
Ga0181500_104138123300016728PeatlandFFGGFIRPMVIIAAFGGLVVVGALFAILKNSGSKSSDDKYTKLDIG
Ga0187849_100062693300017929PeatlandMVIIAVFGGLVIGGALFAVLKNSGSKSADSRYTKLDIG
Ga0187849_106984613300017929PeatlandMVIIAVFGGLVIGGAIFAVVKNSGGRATNSKYTKLDIG
Ga0187803_1001119743300017934Freshwater SedimentMVIIAMVGGLVVGGALFAILKNMGGKSTESKVTKLDIG
Ga0187848_1021549713300017935PeatlandMVIIALFGSLVVGGAIFAVLKNSGGKGKESKYTKLDIG
Ga0187853_1005964623300017940PeatlandMVIIAVFGGLVVGGALFAILKNSGGKSTDDKYTKLDIG
Ga0187853_1025614023300017940PeatlandMFSFNPMVIIAVFGGLVVGGALFAILKNNGSKSAESKYTKLDIG
Ga0187819_1056666623300017943Freshwater SedimentMVIIALFGGLVIGGALFAVLKNSGNKSAEGKYTKLDIG
Ga0187879_1082953823300017946PeatlandMEVSSDPMVIIALFGGLVVGGAVFAILKNTGGKSTESKYTKLDIG
Ga0187847_1023945913300017948PeatlandMVIIALFGGLVVGGAVFAILKNTGGKSTESKYTKLDIG
Ga0187783_1000432493300017970Tropical PeatlandMVMIALLGGLVAGGAVFAILKNSGVKSTENKYTKLDLG
Ga0187781_1009422523300017972Tropical PeatlandMVIIAVFGGLVVGGALFAVLKNSGSKSAEGKYTKLDIG
Ga0187781_1047642123300017972Tropical PeatlandMVIIALFGGLVVGGALFAILKNSGSKATDSKYTKLNIG
Ga0187782_1017873323300017975Tropical PeatlandEVLLDPMVIIALFGGLVVGGALFAVLKNSGSKSAEGKYTKLDIG
Ga0187782_1027856123300017975Tropical PeatlandMVIIALFGGLVVGGALFAILKNSGSKATESKYTKLNIG
Ga0187782_1028441313300017975Tropical PeatlandMVILGLFGGLVVGGALFAILKNSGGKSSDSKYTKLNIG
Ga0187782_1051119723300017975Tropical PeatlandMIIIVVFGGLVIGGALFAVLKNSGGKSDNKYTKLDIG
Ga0187782_1109276823300017975Tropical PeatlandMVIIALFGGLVVGGALFAILKNSGSKAAESKYTKLNIG
Ga0181520_1000875643300017988BogMVIIAVFGGLVVGGAIFAVLKNSGGKSTEDKYTKLDIG
Ga0187870_106025013300017998PeatlandMVIIAVFGGLVIGGAIFAVLKNSGGRATNSTYTKLDIG
Ga0187860_139571313300018014PeatlandMVIIALFGGLVAGGALFAILKNSGNKAAESKYTKLDI
Ga0187784_1130219723300018062Tropical PeatlandMIIIVVFGGLVIGGALFAVLKNSGGNSDNKYTKLDIG
Ga0187771_1045977123300018088Tropical PeatlandMVIIAVFGGLVVGGALLAVIKNSGSKAKESNYTKLDIG
Ga0187771_1046202113300018088Tropical PeatlandMVIIVVFGGLIAGGALLAMLKNSSAKSKDGRYTKLNIG
Ga0187770_1041411913300018090Tropical PeatlandMVIIAVFGGLVIGGALFAVLKNSGDKSAVSKYTKLDIG
Ga0187770_1112484423300018090Tropical PeatlandMVIIALFGGLVVGGALFAILKNSGGKAAESKYTKLNIV
Ga0181508_160908823300019256PeatlandEVYFFGGFIRPMVIIAAFGGLVVVGALFAILKNSGSKSSDDKYTKLDIG
Ga0212089_1005662223300022551Lake SedimentMVVIAILGGLFVGGAIFAALKNTGKASSSKYTKLNIG
Ga0209039_1000652343300027825Bog Forest SoilMVIIALFGGLVAGGALFAILRNSGGKASDSKYTKLNIG
Ga0209777_1004005933300027896Freshwater Lake SedimentMVIIAVFGGLVVGGALFAILKNNGSKSADSKYTKLDIG
Ga0209777_1061115613300027896Freshwater Lake SedimentMVIIAVFGGLVIGGAIFAAVKNTTSKADDKYTKLKIG
Ga0311363_1123885823300029922FenFIPGGLFNPMVIIAMVGGLVVGGALFALLKNAGGKSSESKYTKLDIG
Ga0302140_1009342723300031261BogMVIIAMVGGLVVGGALFALLKNAGSKSSESKYTKLDIG
Ga0302320_1134421813300031524BogMVIIAMVGGLVVGGALFALLKNAGGKSSERKYTKLDIG
(restricted) Ga0315308_113391023300031587SedimentMVVIAILGGLFVGGAIFAALKNTGKASSSRYTKLNIG
Ga0315291_1004390833300031707SedimentMVILAVAGGLFIGGALFAVLKNSGGSDKKYTKLNIG
Ga0315288_1007743453300031772SedimentMVLIAVAGGLFLGGALFALLKNSGGSDKKYTKLNIG
Ga0315280_10000511463300031862SedimentMVIIAVFSGLVIGGVIFAALKNTGKSASQSKYTKLDIG
Ga0315280_1000571643300031862SedimentMVIIAIVGGLVAGGALFAMLKNAGSSAKSKYTKLNIG
Ga0315280_1001115673300031862SedimentMVIIAVFGGLVIGGAIFAALKNAGSKSDDKYTKLKIG
(restricted) Ga0315314_106722233300031877SedimentMVVIAVLGGLFVGGAIFAALKNTGKASSSKYTKLNIG
(restricted) Ga0315314_112573013300031877SedimentMVIIAVSGGLVIGGAIFAALKSAGSKSDDKYTKLKIG
Ga0214473_1188183223300031949SoilQEQQKTMVILAVAGGLFIGGALFAVLKNSGGLDKKYTKLNIG
Ga0315294_1003514933300031952SedimentMVLIAVGGGLFLGGALFALLKNSGGSDKKYTKLNIG
Ga0326597_1004045843300031965SoilMVIFAVLGGLIAGGAIFAFVKNSGKSSDEKYTKLKIG
Ga0326597_1218983513300031965SoilMVIFAVLGGLIAGGAIFAFVKNSGKSSEEKYTKLKIG
Ga0315289_1025301113300032046SedimentMVIIAVFGGLVIGGAIFAALKNTASKSGDKVTKLRIG
Ga0315279_10000227363300032070SedimentMVIIVVFGGLVVGGVIFAALKNSGKSTSQSKYTKLNIG
Ga0315295_1227470423300032156SedimentMVLIAVAGGLFVGGALFALLKNSGGSDKKYTKLNIG
Ga0311301_1012759123300032160Peatlands SoilMVIIALFGGLVAGGALFAILRNSGGKASESKYTKLNIG
Ga0311301_1034817423300032160Peatlands SoilVVIIAMFGGLVLGGAIFAVLKNSVGGAKENKPIKLNIG
Ga0311301_1145723523300032160Peatlands SoilMVIIAMFGGLVIGGALFAILKNSGSKSGESKYTKLDIG
Ga0315281_1212365713300032163SedimentMVIIAVFGGLVIGGAIFAALKNTTGKSDDKYTKLRIG
Ga0315268_1000693953300032173SedimentMVIIAVFGGLVAGGAIFAFLKNSGKKADKRYTKLNIG
Ga0315268_1241196123300032173SedimentMVIIAVFGGLVIGGAIFAALKNTTSKSDDKYTKLKIG
Ga0315275_1170621913300032401SedimentMVLIAVAGGLFLGGALFAVLKNSGGSDKKYTKLNIG
Ga0335085_1006110813300032770SoilEVSFDPMVIIGLFGGLVIGGALFAILKNSGSKSTESKYTKLDIG
Ga0335082_1088786213300032782SoilMVIIALFGGLVVGGALFALLKNGGSKSAESKYTKLDIG
Ga0335079_1008160523300032783SoilMVIIAMVGGLVVGGALFAILKNAGSKSTESKVTKLDIG
Ga0335079_1180952123300032783SoilMVIIAVFGGLVVGGALLAVIRNSGSKEKESNYTKLDIG
Ga0335078_1068178823300032805SoilMVIVAVFGGLVVGGALFAILKNSGGKPAEDKYTKLDIG
Ga0335078_1154053213300032805SoilMVIITALGCLVAGGALLAIFKNSGSKSKESKYTKLDLG
Ga0335078_1248362813300032805SoilLHMVIIYLFGGLVVGGALFAILKNSGAKSTQSNYTKLDIG
Ga0335081_1035208923300032892SoilMVIIALFGGLVVGGALFAILKNTGGKSAESKYTKLDIG
Ga0335081_1041026323300032892SoilMVIIALFGALVAGGALFALFKNTGSKSVESKYTKLDIG
Ga0335074_1120808213300032895SoilMVILALFGGLVVVGVIFALLKNTGHKATESKYTKLNIG
Ga0334722_1001031973300033233SedimentMVIIAVAGGLFIGGALFAVLKNRGGADKKYTKLNIG
Ga0326728_10008750103300033402Peat SoilMVIIALLGGLVAGGALFAILKNSGNKAAESKYTKLDIG
Ga0326728_1012222543300033402Peat SoilMVIIALFGGLVVGGALFAVLKNTGNKSSEGKYTKLDIG
Ga0326728_1050838823300033402Peat SoilMVIIALFGGLVISGALFAILRNSSSKAKESKYTKLDIG
Ga0326728_1100068523300033402Peat SoilMVIIALFSGPVAGGALFAILKNSGNKSKESKYTKSNIG
Ga0326728_1101450113300033402Peat SoilMVIIALFGGLVAGGALFAILKNSGSKSTESKYTKLDIG
Ga0326727_10009416143300033405Peat SoilMVIIALFGGLVAGGALFAILKNSGSKSTESKYTKLNIG
Ga0326727_1015343923300033405Peat SoilMVIIAVFGGLVIGGALFAAIKNSGSKSADSRFTKLDIG
Ga0316624_1000545913300033486SoilHQEQQRTMVILAVAGGLFIGGALFAVLKNSGGSDKKYTKLNIG
Ga0316628_10041843213300033513SoilPWSTRGIMVLIAVAGGLFVGGALFALLKNSGGSDKKYTKLNIS
Ga0371489_0000128_20151_202673300033755Peat SoilMVIIAVFGGLVIGGALFAVLKNSGSKSADSRFTKLNIG
Ga0314861_0000186_17272_173883300033977PeatlandMVIIAVFGGLVIGGAIFAVVKNSGGRATSSKVTKLDIG
Ga0314861_0106977_1067_11833300033977PeatlandMVIIALFGGLVVGGALFAILKNSGNKATESKYTKLDIG
Ga0314861_0151774_817_9333300033977PeatlandMVIIAVFGGLVIGGALFAVLKSSSSKSSDSNYTKLDIG
Ga0326724_0054790_1550_16663300034091Peat SoilMVIIALFGGLVVGGALFAILKNSGSKASESKYTKLNIG

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.