NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F077140

Metagenome / Metatranscriptome Family F077140

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F077140
Family Type Metagenome / Metatranscriptome
Number of Sequences 117
Average Sequence Length 47 residues
Representative Sequence DAAAGIKAIYQDLLDRAWNEARARGDKLPPEAQKAIPPTVPGQQ
Number of Associated Samples 94
Number of Associated Scaffolds 117

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 65.81 %
% of genes from short scaffolds (< 2000 bps) 60.68 %
Associated GOLD sequencing projects 93
AlphaFold2 3D model prediction Yes
3D model pTM-score0.62

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (65.812 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(46.154 % of family members)
Environment Ontology (ENVO) Unclassified
(38.462 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(52.137 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 38.89%    β-sheet: 2.78%    Coil/Unstructured: 58.33%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.62
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 117 Family Scaffolds
PF03597FixS 40.17
PF14256YwiC 0.85
PF13641Glyco_tranf_2_3 0.85
PF03100CcmE 0.85
PF01566Nramp 0.85
PF03992ABM 0.85
PF00115COX1 0.85
PF16859TetR_C_11 0.85

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 117 Family Scaffolds
COG3197Cytochrome oxidase maturation protein, CcoS/FixS familyPosttranslational modification, protein turnover, chaperones [O] 40.17
COG1914Mn2+ or Fe2+ transporter, NRAMP familyInorganic ion transport and metabolism [P] 0.85
COG2332Cytochrome c biogenesis protein CcmEPosttranslational modification, protein turnover, chaperones [O] 0.85

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms65.81 %
UnclassifiedrootN/A34.19 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2124908016|OU_2_1_1_newblercontig01829All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1361Open in IMG/M
3300000955|JGI1027J12803_101011224All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria502Open in IMG/M
3300000956|JGI10216J12902_106166381All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria899Open in IMG/M
3300002908|JGI25382J43887_10279622All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria748Open in IMG/M
3300005544|Ga0070686_100584543All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria878Open in IMG/M
3300005549|Ga0070704_100648907All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria932Open in IMG/M
3300006034|Ga0066656_10312380All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1015Open in IMG/M
3300006791|Ga0066653_10140454All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1161Open in IMG/M
3300009137|Ga0066709_103014018All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria618Open in IMG/M
3300009148|Ga0105243_10621836All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1043Open in IMG/M
3300010333|Ga0134080_10585903All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria541Open in IMG/M
3300010336|Ga0134071_10348349All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria748Open in IMG/M
3300011000|Ga0138513_100061720All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria574Open in IMG/M
3300011998|Ga0120114_1103785All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria547Open in IMG/M
3300012204|Ga0137374_11222904All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria524Open in IMG/M
3300012210|Ga0137378_10642247All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria972Open in IMG/M
3300012285|Ga0137370_10745093All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium608Open in IMG/M
3300012358|Ga0137368_10521981All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria763Open in IMG/M
3300012358|Ga0137368_10846303All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria562Open in IMG/M
3300012532|Ga0137373_10273235All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1355Open in IMG/M
3300012532|Ga0137373_10833082All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria680Open in IMG/M
3300012930|Ga0137407_11231844All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria710Open in IMG/M
3300012938|Ga0162651_100037286All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria733Open in IMG/M
3300012957|Ga0164303_10034321All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2116Open in IMG/M
3300012985|Ga0164308_10533942All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria987Open in IMG/M
3300013763|Ga0120179_1048121All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria979Open in IMG/M
3300014823|Ga0120170_1067290All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria764Open in IMG/M
3300015158|Ga0167622_1038960All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria912Open in IMG/M
3300015371|Ga0132258_12329286All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1343Open in IMG/M
3300017997|Ga0184610_1007849All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2600Open in IMG/M
3300018027|Ga0184605_10314816All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria708Open in IMG/M
3300018051|Ga0184620_10039665All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1280Open in IMG/M
3300018071|Ga0184618_10319324All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria662Open in IMG/M
3300018072|Ga0184635_10155935All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria912Open in IMG/M
3300018072|Ga0184635_10220937All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria754Open in IMG/M
3300019279|Ga0184642_1716102All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria882Open in IMG/M
3300019886|Ga0193727_1013036All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3141Open in IMG/M
3300020002|Ga0193730_1064933All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1044Open in IMG/M
3300021073|Ga0210378_10021779All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2588Open in IMG/M
3300021344|Ga0193719_10212954All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria823Open in IMG/M
3300021951|Ga0222624_1035827All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria712Open in IMG/M
3300022694|Ga0222623_10059760All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1470Open in IMG/M
3300022694|Ga0222623_10171019All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria845Open in IMG/M
3300024288|Ga0179589_10391375All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria636Open in IMG/M
3300025938|Ga0207704_10196547All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1472Open in IMG/M
3300026295|Ga0209234_1167377All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria767Open in IMG/M
3300026552|Ga0209577_10298158All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1203Open in IMG/M
3300027748|Ga0209689_1132923All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1232Open in IMG/M
3300028719|Ga0307301_10002266All Organisms → cellular organisms → Bacteria5381Open in IMG/M
3300028719|Ga0307301_10214198All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria626Open in IMG/M
3300028720|Ga0307317_10199462All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria675Open in IMG/M
3300028721|Ga0307315_10163081All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria681Open in IMG/M
3300028721|Ga0307315_10265760All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria540Open in IMG/M
3300028721|Ga0307315_10301248All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria509Open in IMG/M
3300028754|Ga0307297_10027069All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1660Open in IMG/M
3300028771|Ga0307320_10472503All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria506Open in IMG/M
3300028791|Ga0307290_10121732All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria954Open in IMG/M
3300028796|Ga0307287_10038135All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1735Open in IMG/M
3300028807|Ga0307305_10069423All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1626Open in IMG/M
3300028811|Ga0307292_10091077All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1190Open in IMG/M
3300028824|Ga0307310_10533676All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria593Open in IMG/M
3300028828|Ga0307312_10126924All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1603Open in IMG/M
3300028875|Ga0307289_10086040All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1276Open in IMG/M
3300028876|Ga0307286_10112137All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria963Open in IMG/M
3300028876|Ga0307286_10227613All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria680Open in IMG/M
3300028878|Ga0307278_10001333All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria12310Open in IMG/M
3300028885|Ga0307304_10154021All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria960Open in IMG/M
3300030829|Ga0308203_1027181All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria779Open in IMG/M
3300030905|Ga0308200_1043326All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria818Open in IMG/M
3300031093|Ga0308197_10027953All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1300Open in IMG/M
3300031093|Ga0308197_10112203All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria824Open in IMG/M
3300031094|Ga0308199_1007339All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1566Open in IMG/M
3300031094|Ga0308199_1037887All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria898Open in IMG/M
3300031152|Ga0307501_10022742All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1209Open in IMG/M
3300031421|Ga0308194_10181616All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria669Open in IMG/M
3300031824|Ga0307413_10307571All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1205Open in IMG/M
3300031996|Ga0308176_10287073All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1596Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil46.15%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil9.40%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil6.84%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment5.98%
PermafrostEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost5.13%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment3.42%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil3.42%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment2.56%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil1.71%
Groundwater SandEnvironmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand1.71%
SoilEnvironmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil1.71%
Glacier Forefield SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil0.85%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.85%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.85%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil0.85%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.85%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere0.85%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.85%
Environmental → Unclassified → Unclassified → Unclassified → Unclassified → 0.85%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.85%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere0.85%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.85%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.85%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.85%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.85%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2124908016Sample 642EnvironmentalOpen in IMG/M
3300000955Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300001333Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A21-PF)- 6 month illuminaEnvironmentalOpen in IMG/M
3300002908Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cmEnvironmentalOpen in IMG/M
3300004081Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2)EnvironmentalOpen in IMG/M
3300004479Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAsEnvironmentalOpen in IMG/M
3300005454Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136EnvironmentalOpen in IMG/M
3300005544Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaGEnvironmentalOpen in IMG/M
3300005549Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaGEnvironmentalOpen in IMG/M
3300005556Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156EnvironmentalOpen in IMG/M
3300006034Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105EnvironmentalOpen in IMG/M
3300006791Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102EnvironmentalOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009148Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaGHost-AssociatedOpen in IMG/M
3300009808Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N2_40_50EnvironmentalOpen in IMG/M
3300010333Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300010336Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015EnvironmentalOpen in IMG/M
3300011000Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t6i015EnvironmentalOpen in IMG/M
3300011994Permafrost microbial communities from Nunavut, Canada - A7_65cm_12MEnvironmentalOpen in IMG/M
3300011998Permafrost microbial communities from Nunavut, Canada - A30_35cm_6MEnvironmentalOpen in IMG/M
3300012019Permafrost microbial communities from Nunavut, Canada - A7_5cm_12MEnvironmentalOpen in IMG/M
3300012204Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaGEnvironmentalOpen in IMG/M
3300012210Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012212Combined assembly of Hopland grassland soilHost-AssociatedOpen in IMG/M
3300012285Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012358Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_100_16 metaGEnvironmentalOpen in IMG/M
3300012532Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaGEnvironmentalOpen in IMG/M
3300012930Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012938Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t2i015EnvironmentalOpen in IMG/M
3300012955Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MGEnvironmentalOpen in IMG/M
3300012957Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MGEnvironmentalOpen in IMG/M
3300012985Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MGEnvironmentalOpen in IMG/M
3300012986Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MGEnvironmentalOpen in IMG/M
3300013763Permafrost microbial communities from Nunavut, Canada - A15_65cm_0MEnvironmentalOpen in IMG/M
3300014326Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaGHost-AssociatedOpen in IMG/M
3300014823Permafrost microbial communities from Nunavut, Canada - A3_80cm_0MEnvironmentalOpen in IMG/M
3300015158Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G1A, Ice margin)EnvironmentalOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300017997Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_coexEnvironmentalOpen in IMG/M
3300018000Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_coexEnvironmentalOpen in IMG/M
3300018027Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coexEnvironmentalOpen in IMG/M
3300018051Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_b1EnvironmentalOpen in IMG/M
3300018071Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1EnvironmentalOpen in IMG/M
3300018072Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b2EnvironmentalOpen in IMG/M
3300018482Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118EnvironmentalOpen in IMG/M
3300019279Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019867Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3m1EnvironmentalOpen in IMG/M
3300019875Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3s2EnvironmentalOpen in IMG/M
3300019886Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2c2EnvironmentalOpen in IMG/M
3300020002Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1a1EnvironmentalOpen in IMG/M
3300020018Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2s2EnvironmentalOpen in IMG/M
3300021073Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_b1 redoEnvironmentalOpen in IMG/M
3300021344Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2EnvironmentalOpen in IMG/M
3300021951Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300022195Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300022694Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_coexEnvironmentalOpen in IMG/M
3300023266Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S220-509R-4EnvironmentalOpen in IMG/M
3300024288Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungalEnvironmentalOpen in IMG/M
3300025938Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026295Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_20cm (SPAdes)EnvironmentalOpen in IMG/M
3300026552Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes)EnvironmentalOpen in IMG/M
3300027273Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N2_40_50 (SPAdes)EnvironmentalOpen in IMG/M
3300027748Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 (SPAdes)EnvironmentalOpen in IMG/M
3300028714Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_196EnvironmentalOpen in IMG/M
3300028716Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_198EnvironmentalOpen in IMG/M
3300028719Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_182EnvironmentalOpen in IMG/M
3300028720Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_357EnvironmentalOpen in IMG/M
3300028721Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_355EnvironmentalOpen in IMG/M
3300028754Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_157EnvironmentalOpen in IMG/M
3300028768Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_119EnvironmentalOpen in IMG/M
3300028771Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_369EnvironmentalOpen in IMG/M
3300028787Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_381EnvironmentalOpen in IMG/M
3300028791Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_144EnvironmentalOpen in IMG/M
3300028796Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_141EnvironmentalOpen in IMG/M
3300028807Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186EnvironmentalOpen in IMG/M
3300028811Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_149EnvironmentalOpen in IMG/M
3300028824Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_197EnvironmentalOpen in IMG/M
3300028828Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202EnvironmentalOpen in IMG/M
3300028875Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_143EnvironmentalOpen in IMG/M
3300028876Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_140EnvironmentalOpen in IMG/M
3300028878Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117EnvironmentalOpen in IMG/M
3300028880Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_181EnvironmentalOpen in IMG/M
3300028881Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116EnvironmentalOpen in IMG/M
3300028885Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_185EnvironmentalOpen in IMG/M
3300030829Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_357 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030905Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_204 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031093Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_198 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031094Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_203 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031114Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_182 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031152Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 15_SEnvironmentalOpen in IMG/M
3300031421Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_195 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031824Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2Host-AssociatedOpen in IMG/M
3300031996Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
OU_023956202124908016IYNDLLDRAWAEAKTRGENLPPEVQKEILPTVPGQQ
JGI1027J12803_10101122413300000955SoilSDMLNRAWSDAKARREKLPSESQKAIPPTVPGQQ*
JGI10216J12902_10616638113300000956SoilAAAGIKAIYQDLLDRAWNEARARGEKLPEVSQKLIPPTVPGQQ*
A21PFW6_114922413300001333PermafrostIKSIYQDMLDRAWAESKARGDKLPPEAQKNVPPEVPGQQ*
JGI25382J43887_1027962213300002908Grasslands SoilAGIKAIYQDLLDRAWNEARARGNKLPPEVQKAIPPTVPGQQ*
Ga0063454_10168986823300004081SoilLTLADAGTGIQRIYQQLLDRAWADAKARGAKLPPIDQKNAPPSVPEGQQ*
Ga0062595_10220419913300004479SoilTPLSLEDAAAGIKAIYQDLLSRAWAEAQARGDKLPPSGQKDIPPTVPGQQ*
Ga0066687_1059737133300005454SoilGIKAIYQDLLDRAWNEARARGDKLPPDVQKAVPPTVPGQQ*
Ga0070686_10058454313300005544Switchgrass RhizosphereDSFLINDGKTRLSLPDAAAGIRAIYEDLLNRAWADAKDRGNKLPDESQKAIPPTVPGQQ*
Ga0070704_10064890713300005549Corn, Switchgrass And Miscanthus RhizosphereRFLLNDGKTPLSLKDAAAGIKAIYEDLLNRAWNEARARGDKLPDESQKLIPPTVPGQQ*
Ga0066707_1094270433300005556SoilIHAIYSQLLDGAWSEATSRGEKLPSQSQKASPPTVPGQQ*
Ga0066656_1031238013300006034SoilNDGKTPLSLADAAAGIKAIYQDLLDRAWTEARARGDKLPPEAQKAIPPTVPGQQ*
Ga0066653_1014045443300006791SoilLSLADAAAGIKAIYQDLLGRAWTEARARGDKLPPEAQKAIPPTVPGQQ*
Ga0066709_10301401833300009137Grasslands SoilFLINDGKTRLSLQDAANGIKAIYDDLLDRAWNEARARGEKLPPDSQKLLPPTVPGQQ*
Ga0105243_1062183613300009148Miscanthus RhizosphereTIYEDLLNRAWADARDRGNKLPEESQKAIPPTVPGQQ*
Ga0105071_103407433300009808Groundwater SandLEDAAAGIRTIYEDLLDQAWADAKARGDKLPPVSQKNIPPTVPGQQ*
Ga0134080_1058590313300010333Grasslands SoilGDKFLLNDGKTPLSLDDAAAGIKAIYQDLLDRAWNEARARGNKLPPEAQKAIPPTVPGQQ
Ga0134071_1034834913300010336Grasslands SoilAGIKSIYEDMLDRAWAETKARGDKLPPEAQKNVPPVVPGQQ*
Ga0138513_10006172033300011000SoilSPIYEGMLDQAWSDAGDRGGKLPDESQKAIPPTVPGQQ*
Ga0120157_109702633300011994PermafrostGPGSDRAQDLLDRAWAESKARGAKLPPEAQKNVPPEVPGQQ*
Ga0120114_110378513300011998PermafrostLNDGKTPLSLEDAAAGIKAIYQDLLDRAWNEARARGDKLPPEAQKAIPPTVPGQQ*
Ga0120139_119639013300012019PermafrostPLSLDEAAAGIKSIYQDLLDRAWAESKARGDKLPPEAQKNVPPEVPGQQ*
Ga0137374_1122290413300012204Vadose Zone SoilGDSFLINDGKTRLSLRDARNGIKMIYDDLLDRAWNDARDRGNKLPPELQRAIPPTVPGQQ
Ga0137378_1064224743300012210Vadose Zone SoilGLSPADSFLINDGKTRLSLKDAAAGIKSIYDNMLNRGWSDAQGRGNKLPSTAQKAIPPTVPGQQ*
Ga0150985_10777381633300012212Avena Fatua RhizosphereGLGTSLSLRDAAAGIRQLYDRMLNTAWADARRRGEKLPSVAQKNIPPTVPGQQ*
Ga0137370_1074509333300012285Vadose Zone SoilLDMLNRAWADARRRGEKLPPVSQKNILPTVPGEQ*
Ga0137368_1052198133300012358Vadose Zone SoilGIKGFYQQLLNQAWADARARDDKLPPLSQKAIPPTVPGQE*
Ga0137368_1084630333300012358Vadose Zone SoilYDDLLNRAWDDARERDDELPSTAQKAIPPTVPGQQ*
Ga0137373_1009849263300012532Vadose Zone SoilGIRTIYQDLLDRAWADAKARGDKLPPESQKNIPPTLPGH*
Ga0137373_1017863513300012532Vadose Zone SoilKAIYQDLLDRAWAEARARGEKLPSEAQKAILPTVPGQQ*
Ga0137373_1027323563300012532Vadose Zone SoilAAAGIRTIYEDLLERAWSDARARGDKLPDEAQKALPPTVPGQQ*
Ga0137373_1083308213300012532Vadose Zone SoilNDGKTPLSLADAAAGIKAIYEDLLDRAWTAARARGDKLPPEAQKAIPPTVPAQQ*
Ga0137407_1123184413300012930Vadose Zone SoilQDLLDRAWNEARARGDKLPPDVQKAIPPTVPGQQ*
Ga0162651_10003728613300012938SoilVDSFKLNDGKTPLSLDDAAAGIKAIYQDLLDRAWAEARARGDKLPPEVQKGIPPTVPGQQ
Ga0164298_1140642613300012955SoilKAIYQDLLDKAWAEAQARGDKLPPAGQKDIPPTVPGQQ*
Ga0164303_1003432163300012957SoilDKFLLNDGKTPLSLKDAAAGIKAIYEDLLNRAWNEARARGDKLPDESQKLIPPTVPGQQ*
Ga0164308_1053394243300012985SoilLSLKDAAAGIKAIYEDLLNRAWNEARARGDKLPDESQKLIPPTVPGQQ*
Ga0164304_1071998733300012986SoilKKIYDQLLNTAWADAKARGDKLPPAAQKAVPPEVPGE*
Ga0164304_1144552133300012986SoilLNDGKTPLSLEDAAAGIKAIYQDLLDKAWAEAQARGDKLPPAGQKDIPPTVPGQQ*
Ga0120179_104812113300013763PermafrostIYQDLLDRAWAEAQARGDKLPPSGQKDIPPTVPGQQ*
Ga0157380_1191135213300014326Switchgrass RhizosphereIKAIYQDLLDRAWAEAQARGDKLPPSGQKDIPPTVPGQQ*
Ga0120170_106729013300014823PermafrostYQDLLDRAWAEAQARGDKLPPAGQKDIPPTVPGQQ*
Ga0167622_103896043300015158Glacier Forefield SoilTGLLDRAWADARSRGDKLPPESQKAIPPTVPGQQ*
Ga0132258_1232928613300015371Arabidopsis RhizosphereDSFKINDGKTNLSLKDAAAGIKTIYNDLLNRAWADAKDRDGKLPSEAQKAIPPTVPGQQ*
Ga0184610_100784913300017997Groundwater SedimentPLDLEDAAAGIQSIYQDLLDRAWAEAKARGAKLPPEAQKAIPPTVPGQQ
Ga0184604_1024898533300018000Groundwater SedimentAIKAIYQDLLDRAWAEAKAEGNKLPPEGQKNIPPNVPGQQ
Ga0184605_1031481633300018027Groundwater SedimentDEAAAGIKAIYQDLLDRAWTDAKARGDKLPPAVQKAVPPEVPGE
Ga0184620_1003966553300018051Groundwater SedimentGKTPLSLEDAAAGIKAIYQNLLDRAWAEAKARGDKLPPSGQKDIPPTVPGQQ
Ga0184618_1031932433300018071Groundwater SedimentGIKAIYQDLLDRAWTDAKARGDKLPPAGQKAVPPEVPGE
Ga0184635_1015593543300018072Groundwater SedimentAPADSFKLNDGKTPLSLDDAAAGIKAIYQDLLDRAWAEARARGDKLPPEVQKGLPPTVPGQQ
Ga0184635_1022093713300018072Groundwater SedimentSLEEAAAGIKAIYQDLLDRAWTDAKARGDKLPPSAQKAVPPEVPGE
Ga0066669_1081914233300018482Grasslands SoilSDAANGIRTIYQGLLNKAWSDAAARGEKLPSIAQKNIPPTVPGQQ
Ga0184642_171610213300019279Groundwater SedimentTLQDAADGIETIYEDLLNRGWAAARERGDKLPDEAQKAIPPTVPGQQ
Ga0193704_108287433300019867SoilIYQNLLDRAWAEAKARGDKLPPSGQKDIPPTVPGQQ
Ga0193701_109574733300019875SoilAGIKAIYQDLLDRAWTDAKARGDKLPPAVQKAVPPEVPGE
Ga0193727_101303613300019886SoilGIKAIYEDLLNRAWNEARARGDKLPDESQKLIPPTVPGQQ
Ga0193730_106493313300020002SoilEAAAGIKAIYQDLLDTAWTEAKARGDKLPPEGQKAVPPEVPGE
Ga0193721_114492033300020018SoilGIKAMYQDLLDRAWSEARARGDKLPPEGQKDIPPTVPGQQ
Ga0210378_1002177913300021073Groundwater SedimentAPADSFLINDGKTRLSLRDAAAGIKAIYEDLLNRAWNDAREQGNKLPPESQKEIPPTVPGQQ
Ga0193719_1021295413300021344SoilGDSFLLNDGKTPLSLPDAAAGIKAIYDDLLNKAWDEARARGNKLPPESQKAIPPTVPGQQ
Ga0222624_103582733300021951Groundwater SedimentLNEAAAGIKAIYQDLLDRAWIDAKARGDKLPPVAQKAVPPEVPGE
Ga0222625_156866213300022195Groundwater SedimentIYQDLLDRAWAEAKARGAKLPPEAQKAIPPTVPGQQ
Ga0222623_1005976013300022694Groundwater SedimentIKAIYEDLLNRAWNEARARGDKLPDESQKLIPPTVPGQQ
Ga0222623_1014401343300022694Groundwater SedimentNDKANTPLSLEEAAAGIKAIYQDLLDRAWTDAKARGDKLPPAVQKAVPPEVPGE
Ga0222623_1017101943300022694Groundwater SedimentIKAIYEDLLNRAWNDARERSGKLPPEAQKAIPPTVPGQQ
Ga0247789_101717053300023266SoilGLGTSLSLENAAAGIRALYEQMLDTAWADAKSRGDKQPPESQKQIPPEVPGQQ
Ga0179589_1039137533300024288Vadose Zone SoilAAAGIKAIYEALLNRAWNEARARGDKLPDDSQKLIPPTVPGQQ
Ga0207704_1019654713300025938Miscanthus RhizosphereGIKAIYQDLLDRGWAEAQARGDKLPPSGQKDIPPTVPGQQ
Ga0209234_116737713300026295Grasslands SoilPLSLKDAAAGIKAIYQDLLDRAWNEARARGDKLPPDVQKAVPPTVQGQQ
Ga0209577_1029815843300026552SoilIYEDMLNKAWADATARGEKLPSASQKAIPPTVPGQQ
Ga0209886_106173913300027273Groundwater SandLEDAAAGIRTIYEDLLDQAWADAKARGDKLPPVSQKNIPPTVPGQQ
Ga0209689_113292333300027748SoilSFKLNDGKTPLSLADAAAGIKATYDDLLQRAWTEARARDDKLPPAAQKDIPPTVPGQQ
Ga0307309_1017711613300028714SoilDAAAGIKAIYQDLLDRAWNEARARGDKLPPEAQKAIPPTVPGQQ
Ga0307311_1015656533300028716SoilVNDGKTRLSLTDAANGIRTIYEKLLNQAWTEARARGEQLPPLSQKDLPPTVPGQQ
Ga0307301_1000226693300028719SoilYEDLLNRAWNDARERSDKLPPEAQKAIPPTVPGQQ
Ga0307301_1021419813300028719SoilKRNTPLSLEAAAAGIKAIYQDMLDRAWSDAKARGDKLPPAVQKEIPPEVPGE
Ga0307317_1019946213300028720SoilAAAGIKTIYNDLLDRAWSDAEDRGAKLPDESQKAIPPTVPGQQ
Ga0307315_1016308113300028721SoilAASGIKTIYDDLLNRAWADARERDGKLPSVAQKAIPPTVPGQQ
Ga0307315_1026576013300028721SoilETPLSLTDAAAGIKAIYTRLLDTAWNDARARGEKLPSIQQKLIPPQVEGQQ
Ga0307315_1030124813300028721SoilFLINDGKTRLSLRDAADGIRTIYQQLLDQGWADAEARNEKLPSESQKAIPPTVPGQQ
Ga0307297_1002706963300028754SoilGDSFLVNDGKTRLSLRDAASGIKTIYDDLLNRAWADARERDGKLPSVAQKAIPPTVPGQQ
Ga0307280_1005507513300028768SoilIVVPGFSTPLDLQDAAAGIKGIYQQMLDQAWADARSRGDKLPPTSQKDIPPVVEGQQ
Ga0307320_1047250313300028771SoilAPGDSFLVNDGKTRLSLEDAAAGIKTIYTRLLDQAWSDAAARGEKLPPESQKAIPPTVPGQQ
Ga0307323_1037515513300028787SoilSLDEAAAGIKSIYQNLLDTAWSEAKARGDKLPPEAQKNVPPEVPGQQ
Ga0307290_1012173243300028791SoilAAGIKAIYQNLLDRAWAEAKARGDKLPPSGQKDIPPTVPGQQ
Ga0307290_1038720713300028791SoilSLADAAAGIKAIYQDLLDRAWTEARARGDKLPPEAQKAIPPTVPGQQ
Ga0307287_1003813513300028796SoilPGDSFLVNDGKTRLSLRDAASGIKTIYDDLLNRAWADARERDGKLPSVAQKAIPPTVPGQ
Ga0307287_1010051813300028796SoilAAGIKAIYQDLLERAWSEARARGDKLPPSGQKDIPPTVPGQQ
Ga0307305_1006942313300028807SoilAAAGIKAIYQDLLDRAWIDAKARGDKLPPVAQKAVPPEVPGE
Ga0307305_1033445513300028807SoilNDGKTPLSLDDAAAGIKAIYQDLLDRAWTEARARGDKLPPEVQKGIPPTVPGQQ
Ga0307292_1009107713300028811SoilPGLSPADSFLINDGKTRLSLRDAADGIKTIYNDLLNRAWDEARGRGNKLPSESQKAIPPTVPGQQ
Ga0307310_1051416813300028824SoilPLDLEDAAAGIQSIYQDLLDRAWAEAKARGGKLPPEAQKAIPPTVPGQQ
Ga0307310_1053367613300028824SoilGIKTIYDDLLNRAWADARERDGKLPSVAQKAIPPTVPGQQ
Ga0307312_1012692413300028828SoilNDKTNTPLSLDEAAAGIKSIYQDMLDRAWAESKARGDKLPPEAQKNVPPEVPGQQ
Ga0307312_1065746833300028828SoilAAAGIKAIYQQMLNQAWADAKSRGDKLPPASQKDIPPEVEGQQ
Ga0307289_1008604053300028875SoilSFKLNDGKTPLSLDDAAAGIKAIYQDLLDRAWAEARARGDKLAPEVQKGIPPTVPGQQ
Ga0307286_1011213743300028876SoilATVDSFKLNDGKTPLSLDDAAAGIKAIYQDLLDRAWAEARARGDKLPPEVQKGLPPTVPGQQ
Ga0307286_1022761333300028876SoilTIYNDLLDRAWSDAEDRGAKLPDESQKAIPPTVPGQQ
Ga0307278_10001333163300028878SoilDGKTPLSLDDAAAGIKAIYQDLLDRAWNEARARGDKLPPEAQKAIPPTVPGQQ
Ga0307278_1041423613300028878SoilAAGIKAIYQDLLDRAWAEAKARGDKLPPSGQKDIPPTVPGQQ
Ga0307300_1018095133300028880SoilSLTDAANGIRTIYEKLLNQAWTEARARGEQLPPLSQKDLPPTVPGQQ
Ga0307277_1028657013300028881SoilDLEDAAAGIQSIYQDLLDRAWAEAKARGGKLPPEAQKAILPTVPGQQ
Ga0307277_1043574233300028881SoilTPLSLEDAAAGIKAIYQNLLHRAWAEAQARGDKLPPSGQKDIPPTVPGQQ
Ga0307304_1015402143300028885SoilIRTIYQQLLDRGWTDAQARGEKLPPQSQKAIPPTVPGQQ
Ga0307304_1044476713300028885SoilTPLSLDDAAAGIKAIYQDLLDRAWAEAQARGDKLPPSGQKDIPPTVPGQQ
Ga0308203_102718113300030829SoilLEEAAAGIKAIYQDLLDRAWTDAKARGDKLPPAVQKAVPPEVPGE
Ga0308200_104332633300030905SoilGDKFFLNDGKTPLSLDDAAAGIKAIYQDLLDRAWAEAKARGDKLPPSGQKDIPPTVPGQQ
Ga0308197_1002795353300031093SoilFLINDGKTRLSLRDAADGIKTIYNDLLNRAWDEARGRGNKLPSEAQKAIPPTVPGQQ
Ga0308197_1011220333300031093SoilSFLINDGKTHLSLKEAAAGIKGIYQKLLDTAWSDARGRGDKLPLAEQKLIFPTVPGQQ
Ga0308199_100733913300031094SoilIYDRVLGQAWSDAAGRGDKLPSESQKANPPTVPGQQ
Ga0308199_103788733300031094SoilLVNDGSTRLSLQDAADGIRTIYDKLLNQAWDEARSRGEKLPPLSQKDIPPTVPGQQ
Ga0308187_1044279523300031114SoilGKTRLSLKDAAAGIKAIYDQLLNTAWADAKARGDKLPSTEQKLLPPEVPGQQ
Ga0308187_1048705113300031114SoilGKTPLSLEDAAAGIKAIYHDLLDRAWAEAQARRDKLPPSGQKDIPPTVPGQQ
Ga0307501_1002274213300031152SoilLSLDEAAAGIKAIYQDLLDRAWTDAKARGDKLPPAGQKAVPPEVPGE
Ga0308194_1018161633300031421SoilGDKFLLNDGKTPLSLDDAAAGIKAIYQDLLDRAWNEARARGDKLPPEAQKAIPPTVPGQQ
Ga0307413_1030757113300031824RhizosphereGLETPLTLEDAAAGIRTIYEDLLDRAWADAKARGEKLPAASQKDIPPTVPGQQ
Ga0308176_1028707313300031996SoilRLSLEDAAAGIKTIYTRLLDQAWSDAAARGQKLPPESQKAIPPTVPGQQ

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.