NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F077203

Metagenome / Metatranscriptome Family F077203

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F077203
Family Type Metagenome / Metatranscriptome
Number of Sequences 117
Average Sequence Length 43 residues
Representative Sequence MTSANDPVLAVAVRAARRAASVIADASRDLRRLPTFSKEHGDI
Number of Associated Samples 107
Number of Associated Scaffolds 117

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 75.86 %
% of genes near scaffold ends (potentially truncated) 99.15 %
% of genes from short scaffolds (< 2000 bps) 94.87 %
Associated GOLD sequencing projects 106
AlphaFold2 3D model prediction Yes
3D model pTM-score0.54

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (90.598 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil
(8.547 % of family members)
Environment Ontology (ENVO) Unclassified
(42.735 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(31.624 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 49.30%    β-sheet: 0.00%    Coil/Unstructured: 50.70%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.54
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 117 Family Scaffolds
PF00753Lactamase_B 48.72
PF07731Cu-oxidase_2 25.64
PF07992Pyr_redox_2 7.69
PF00593TonB_dep_Rec 2.56
PF07732Cu-oxidase_3 2.56
PF01799Fer2_2 1.71
PF00111Fer2 0.85
PF00563EAL 0.85

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 117 Family Scaffolds
COG2132Multicopper oxidase with three cupredoxin domains (includes cell division protein FtsP and spore coat protein CotA)Cell cycle control, cell division, chromosome partitioning [D] 28.21
COG2200EAL domain, c-di-GMP-specific phosphodiesterase class I (or its enzymatically inactive variant)Signal transduction mechanisms [T] 0.85
COG3434c-di-GMP phosphodiesterase YuxH/PdeH, contains EAL and HDOD domainsSignal transduction mechanisms [T] 0.85
COG4943Redox-sensing c-di-GMP phosphodiesterase, contains CSS-motif and EAL domainsSignal transduction mechanisms [T] 0.85
COG5001Cyclic di-GMP metabolism protein, combines GGDEF and EAL domains with a 6TM membrane domainSignal transduction mechanisms [T] 0.85


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms90.60 %
UnclassifiedrootN/A9.40 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000550|F24TB_11847566All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria797Open in IMG/M
3300004479|Ga0062595_100673090All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria824Open in IMG/M
3300005330|Ga0070690_100586241All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria845Open in IMG/M
3300005333|Ga0070677_10622802All Organisms → cellular organisms → Bacteria → Proteobacteria600Open in IMG/M
3300005353|Ga0070669_100340744All Organisms → cellular organisms → Bacteria → Proteobacteria1215Open in IMG/M
3300005353|Ga0070669_100410554All Organisms → cellular organisms → Bacteria → Proteobacteria1110Open in IMG/M
3300005354|Ga0070675_100064049All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales3039Open in IMG/M
3300005356|Ga0070674_102040456All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium522Open in IMG/M
3300005459|Ga0068867_100487980All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1057Open in IMG/M
3300005543|Ga0070672_100014798All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria5535Open in IMG/M
3300005543|Ga0070672_100853086All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria803Open in IMG/M
3300005560|Ga0066670_10067941All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium1906Open in IMG/M
3300005617|Ga0068859_102148641All Organisms → cellular organisms → Bacteria616Open in IMG/M
3300005618|Ga0068864_102393947All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria534Open in IMG/M
3300005718|Ga0068866_11127132All Organisms → cellular organisms → Bacteria → Proteobacteria563Open in IMG/M
3300005719|Ga0068861_101339176All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria697Open in IMG/M
3300005719|Ga0068861_101480896All Organisms → cellular organisms → Bacteria → Proteobacteria665Open in IMG/M
3300005842|Ga0068858_102353262All Organisms → cellular organisms → Bacteria526Open in IMG/M
3300005843|Ga0068860_102797528All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria506Open in IMG/M
3300006056|Ga0075163_11549175All Organisms → cellular organisms → Bacteria → Proteobacteria641Open in IMG/M
3300006642|Ga0075521_10549730All Organisms → cellular organisms → Bacteria → Proteobacteria567Open in IMG/M
3300006797|Ga0066659_10588591All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium902Open in IMG/M
3300006797|Ga0066659_10654141All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium856Open in IMG/M
3300006844|Ga0075428_101467686All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria715Open in IMG/M
3300006918|Ga0079216_10519111All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria793Open in IMG/M
3300006953|Ga0074063_12808309All Organisms → cellular organisms → Bacteria → Proteobacteria632Open in IMG/M
3300009011|Ga0105251_10355875All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium tuberculosis complex → Mycobacterium tuberculosis669Open in IMG/M
3300009091|Ga0102851_10349455All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium1468Open in IMG/M
3300009137|Ga0066709_100515622All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium1686Open in IMG/M
3300009177|Ga0105248_10124000All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales2914Open in IMG/M
3300009177|Ga0105248_11761264All Organisms → cellular organisms → Bacteria → Proteobacteria702Open in IMG/M
3300009179|Ga0115028_11087013All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria650Open in IMG/M
3300009540|Ga0073899_10557341All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium836Open in IMG/M
3300009678|Ga0105252_10442958All Organisms → cellular organisms → Bacteria → Proteobacteria597Open in IMG/M
3300009687|Ga0116144_10339163All Organisms → cellular organisms → Bacteria → Proteobacteria763Open in IMG/M
3300009870|Ga0131092_11491601Not Available513Open in IMG/M
3300010303|Ga0134082_10164968All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium899Open in IMG/M
3300010304|Ga0134088_10544773All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium574Open in IMG/M
3300010337|Ga0134062_10451474All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium638Open in IMG/M
3300010343|Ga0074044_11172422All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium501Open in IMG/M
3300010401|Ga0134121_10483637Not Available1137Open in IMG/M
3300010403|Ga0134123_11251258All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria775Open in IMG/M
3300011432|Ga0137428_1170440All Organisms → cellular organisms → Bacteria → Proteobacteria646Open in IMG/M
3300012045|Ga0136623_10478691All Organisms → cellular organisms → Bacteria → Proteobacteria525Open in IMG/M
3300012187|Ga0136622_10153826Not Available972Open in IMG/M
3300012207|Ga0137381_11434890All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium582Open in IMG/M
3300012285|Ga0137370_10891819All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium550Open in IMG/M
3300012680|Ga0136612_10295424All Organisms → cellular organisms → Bacteria → Proteobacteria823Open in IMG/M
3300012898|Ga0157293_10232299All Organisms → cellular organisms → Bacteria → Proteobacteria574Open in IMG/M
3300012922|Ga0137394_11563782All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium517Open in IMG/M
3300012958|Ga0164299_10488369All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria816Open in IMG/M
3300012971|Ga0126369_12983925All Organisms → cellular organisms → Bacteria → Proteobacteria554Open in IMG/M
3300013306|Ga0163162_11771465All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium706Open in IMG/M
3300014312|Ga0075345_1156346All Organisms → cellular organisms → Bacteria → Proteobacteria552Open in IMG/M
3300014323|Ga0075356_1066054All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium814Open in IMG/M
3300014745|Ga0157377_11429507Not Available547Open in IMG/M
3300014969|Ga0157376_11492378All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium709Open in IMG/M
3300015374|Ga0132255_103199265All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium698Open in IMG/M
3300016294|Ga0182041_10326610All Organisms → cellular organisms → Bacteria1281Open in IMG/M
3300017973|Ga0187780_10795739All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium684Open in IMG/M
3300018084|Ga0184629_10632065All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium544Open in IMG/M
3300018469|Ga0190270_13326019All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium ADurb.Bin100510Open in IMG/M
3300018481|Ga0190271_10241798All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1831Open in IMG/M
3300018482|Ga0066669_10186653All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria1571Open in IMG/M
3300019878|Ga0193715_1069320All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium742Open in IMG/M
3300025909|Ga0207705_10639319All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria827Open in IMG/M
3300025939|Ga0207665_11675782All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium503Open in IMG/M
3300025986|Ga0207658_10891750All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium809Open in IMG/M
3300026023|Ga0207677_11646586All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria594Open in IMG/M
3300026035|Ga0207703_11312119All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria696Open in IMG/M
3300026059|Ga0208540_1027971All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria638Open in IMG/M
3300026088|Ga0207641_10271923All Organisms → cellular organisms → Bacteria → Proteobacteria1590Open in IMG/M
3300026088|Ga0207641_10714369All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria988Open in IMG/M
3300026334|Ga0209377_1103728Not Available1174Open in IMG/M
3300026547|Ga0209156_10434745All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium544Open in IMG/M
3300027823|Ga0209490_10528651All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria639Open in IMG/M
3300027877|Ga0209293_10088075All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1378Open in IMG/M
3300027877|Ga0209293_10689226All Organisms → cellular organisms → Bacteria → Proteobacteria541Open in IMG/M
3300027902|Ga0209048_10152361All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium1723Open in IMG/M
3300028587|Ga0247828_10710756All Organisms → cellular organisms → Bacteria → Proteobacteria627Open in IMG/M
3300028792|Ga0307504_10136382All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium820Open in IMG/M
3300029984|Ga0311332_11434736All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium559Open in IMG/M
3300029990|Ga0311336_10543195All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium988Open in IMG/M
3300030000|Ga0311337_10171755All Organisms → cellular organisms → Bacteria → Proteobacteria1768Open in IMG/M
3300030002|Ga0311350_10035402All Organisms → cellular organisms → Bacteria → Proteobacteria4354Open in IMG/M
3300030114|Ga0311333_10282153All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium1316Open in IMG/M
3300030294|Ga0311349_10441442All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium1231Open in IMG/M
3300030491|Ga0302211_10234788All Organisms → cellular organisms → Bacteria → Proteobacteria543Open in IMG/M
3300031547|Ga0310887_10212032Not Available1060Open in IMG/M
3300031682|Ga0318560_10496133All Organisms → cellular organisms → Bacteria → Proteobacteria661Open in IMG/M
3300031726|Ga0302321_100164445All Organisms → cellular organisms → Bacteria → Proteobacteria2292Open in IMG/M
3300031792|Ga0318529_10370789All Organisms → cellular organisms → Bacteria → Proteobacteria666Open in IMG/M
3300031846|Ga0318512_10620990All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium552Open in IMG/M
3300031873|Ga0315297_11008527All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium688Open in IMG/M
3300031912|Ga0306921_10938924Not Available980Open in IMG/M
3300031918|Ga0311367_10751092Not Available989Open in IMG/M
3300031938|Ga0308175_102961299All Organisms → cellular organisms → Bacteria → Proteobacteria529Open in IMG/M
3300031939|Ga0308174_11740147All Organisms → cellular organisms → Bacteria → Proteobacteria536Open in IMG/M
3300032005|Ga0307411_10334602Not Available1228Open in IMG/M
3300032009|Ga0318563_10675392All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium555Open in IMG/M
3300032055|Ga0318575_10355644Not Available742Open in IMG/M
3300032180|Ga0307471_100508122All Organisms → cellular organisms → Bacteria1354Open in IMG/M
3300032180|Ga0307471_101218242All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium917Open in IMG/M
3300032276|Ga0316188_10320939All Organisms → cellular organisms → Bacteria → Proteobacteria802Open in IMG/M
3300032516|Ga0315273_11952480All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium699Open in IMG/M
3300033408|Ga0316605_12401129All Organisms → cellular organisms → Bacteria → Proteobacteria513Open in IMG/M
3300033414|Ga0316619_10691549All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium859Open in IMG/M
3300033418|Ga0316625_101054749All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium729Open in IMG/M
3300033418|Ga0316625_101475153All Organisms → cellular organisms → Bacteria → Proteobacteria642Open in IMG/M
3300033419|Ga0316601_101030141All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria822Open in IMG/M
3300033482|Ga0316627_102055366All Organisms → cellular organisms → Bacteria → Proteobacteria594Open in IMG/M
3300033487|Ga0316630_11052599All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria714Open in IMG/M
3300033513|Ga0316628_102609136All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria666Open in IMG/M
3300033521|Ga0316616_102079139All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria754Open in IMG/M
3300033521|Ga0316616_103571826All Organisms → cellular organisms → Bacteria → Proteobacteria585Open in IMG/M
3300034354|Ga0364943_0454529All Organisms → cellular organisms → Bacteria → Proteobacteria500Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil8.55%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen7.69%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere7.69%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil5.13%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil5.13%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil4.27%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere4.27%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil3.42%
WetlandEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland2.56%
Polar Desert SandEnvironmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand2.56%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil2.56%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil2.56%
Natural And Restored WetlandsEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands2.56%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere2.56%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere2.56%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere2.56%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment1.71%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil1.71%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.71%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil1.71%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil1.71%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil1.71%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.71%
Freshwater Lake SedimentEnvironmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment0.85%
Freshwater WetlandsEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands0.85%
FreshwaterEnvironmental → Aquatic → Freshwater → Ice → Glacial Lake → Freshwater0.85%
Worm BurrowEnvironmental → Aquatic → Marine → Coastal → Sediment → Worm Burrow0.85%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.85%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.85%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil0.85%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.85%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.85%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil0.85%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland0.85%
Bog Forest SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil0.85%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.85%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere0.85%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.85%
SedimentEnvironmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment0.85%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.85%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.85%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere0.85%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.85%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.85%
Activated SludgeEngineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge0.85%
Activated SludgeEngineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge0.85%
Anaerobic Digestor SludgeEngineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge0.85%
Wastewater EffluentEngineered → Wastewater → Nutrient Removal → Unclassified → Unclassified → Wastewater Effluent0.85%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000550Amended soil microbial communities from Kansas Great Prairies, USA - BrdU amended with acetate total DNA F2.4 TB clc assemlyEnvironmentalOpen in IMG/M
3300004479Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAsEnvironmentalOpen in IMG/M
3300005330Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaGEnvironmentalOpen in IMG/M
3300005333Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaGHost-AssociatedOpen in IMG/M
3300005353Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaGHost-AssociatedOpen in IMG/M
3300005354Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaGHost-AssociatedOpen in IMG/M
3300005356Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaGHost-AssociatedOpen in IMG/M
3300005459Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2Host-AssociatedOpen in IMG/M
3300005543Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaGHost-AssociatedOpen in IMG/M
3300005560Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119EnvironmentalOpen in IMG/M
3300005617Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2Host-AssociatedOpen in IMG/M
3300005618Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2Host-AssociatedOpen in IMG/M
3300005718Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2Host-AssociatedOpen in IMG/M
3300005719Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2Host-AssociatedOpen in IMG/M
3300005842Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2Host-AssociatedOpen in IMG/M
3300005843Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2Host-AssociatedOpen in IMG/M
3300006056Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 10/23/14 1A DNAEngineeredOpen in IMG/M
3300006642Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-DEnvironmentalOpen in IMG/M
3300006797Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108EnvironmentalOpen in IMG/M
3300006844Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2Host-AssociatedOpen in IMG/M
3300006918Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100EnvironmentalOpen in IMG/M
3300006953Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMB (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009011Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaGHost-AssociatedOpen in IMG/M
3300009091Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009177Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaGHost-AssociatedOpen in IMG/M
3300009179Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Plant_0915_D1EnvironmentalOpen in IMG/M
3300009540Active sludge microbial communities from Klosterneuburg, Austria, studying microevolution and ecology of nitrifiers - Klosterneuburg WWTP active sludge metagenome KNB5-PhEngineeredOpen in IMG/M
3300009678Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT100EnvironmentalOpen in IMG/M
3300009687Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC035_MetaGEngineeredOpen in IMG/M
3300009870Activated sludge microbial diversity in wastewater treatment plant from Taiwan - Linkou plantEngineeredOpen in IMG/M
3300010303Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015EnvironmentalOpen in IMG/M
3300010304Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015EnvironmentalOpen in IMG/M
3300010337Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015EnvironmentalOpen in IMG/M
3300010343Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1EnvironmentalOpen in IMG/M
3300010401Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1EnvironmentalOpen in IMG/M
3300010403Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3EnvironmentalOpen in IMG/M
3300011432Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT718_2EnvironmentalOpen in IMG/M
3300012045Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ449 (21.06)EnvironmentalOpen in IMG/M
3300012187Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ448 (21.06)EnvironmentalOpen in IMG/M
3300012207Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaGEnvironmentalOpen in IMG/M
3300012285Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012680Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ224A (23.06)EnvironmentalOpen in IMG/M
3300012898Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S194-509B-1EnvironmentalOpen in IMG/M
3300012922Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaGEnvironmentalOpen in IMG/M
3300012958Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MGEnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300013306Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaGHost-AssociatedOpen in IMG/M
3300014312Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_CattailNLA_D1EnvironmentalOpen in IMG/M
3300014323Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - WestPond_CattailB_D1EnvironmentalOpen in IMG/M
3300014745Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaGHost-AssociatedOpen in IMG/M
3300014969Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaGHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300016294Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178EnvironmentalOpen in IMG/M
3300017973Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MGEnvironmentalOpen in IMG/M
3300018084Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_b1EnvironmentalOpen in IMG/M
3300018469Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 TEnvironmentalOpen in IMG/M
3300018481Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 TEnvironmentalOpen in IMG/M
3300018482Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118EnvironmentalOpen in IMG/M
3300019878Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2m2EnvironmentalOpen in IMG/M
3300025909Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025939Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025986Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026023Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026035Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026059Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_TuleA_D1 (SPAdes)EnvironmentalOpen in IMG/M
3300026088Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026334Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 (SPAdes)EnvironmentalOpen in IMG/M
3300026547Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes)EnvironmentalOpen in IMG/M
3300027748Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 (SPAdes)EnvironmentalOpen in IMG/M
3300027823Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - MAT-06 (SPAdes)EnvironmentalOpen in IMG/M
3300027877Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_0915_D1 (SPAdes)EnvironmentalOpen in IMG/M
3300027902Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - CRP12 CR (SPAdes)EnvironmentalOpen in IMG/M
3300028587Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day3EnvironmentalOpen in IMG/M
3300028792Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 19_SEnvironmentalOpen in IMG/M
3300029984I_Fen_E1 coassemblyEnvironmentalOpen in IMG/M
3300029990I_Fen_N2 coassemblyEnvironmentalOpen in IMG/M
3300030000I_Fen_N3 coassemblyEnvironmentalOpen in IMG/M
3300030002II_Fen_N1 coassemblyEnvironmentalOpen in IMG/M
3300030114I_Fen_E2 coassemblyEnvironmentalOpen in IMG/M
3300030294II_Fen_E3 coassemblyEnvironmentalOpen in IMG/M
3300030491Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Fen_E3_3EnvironmentalOpen in IMG/M
3300031547Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D4EnvironmentalOpen in IMG/M
3300031682Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22EnvironmentalOpen in IMG/M
3300031726Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_1EnvironmentalOpen in IMG/M
3300031792Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23EnvironmentalOpen in IMG/M
3300031846Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19EnvironmentalOpen in IMG/M
3300031873Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G15_0EnvironmentalOpen in IMG/M
3300031912Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2)EnvironmentalOpen in IMG/M
3300031918III_Fen_N3 coassemblyEnvironmentalOpen in IMG/M
3300031938Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1EnvironmentalOpen in IMG/M
3300031939Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R2EnvironmentalOpen in IMG/M
3300032005Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1Host-AssociatedOpen in IMG/M
3300032009Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19EnvironmentalOpen in IMG/M
3300032055Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032276Coastal sediment microbial communities from Maine, United States - Phippsburg worm burrow 1EnvironmentalOpen in IMG/M
3300032516Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_0EnvironmentalOpen in IMG/M
3300033408Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day20_noCTEnvironmentalOpen in IMG/M
3300033414Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D4_BEnvironmentalOpen in IMG/M
3300033418Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_T1_C1_D1_AEnvironmentalOpen in IMG/M
3300033419Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day5_noCTEnvironmentalOpen in IMG/M
3300033482Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D1_CEnvironmentalOpen in IMG/M
3300033487Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_May_M1_C1_D6_AEnvironmentalOpen in IMG/M
3300033513Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D5_CEnvironmentalOpen in IMG/M
3300033521Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D1_BEnvironmentalOpen in IMG/M
3300034354Sediment microbial communities from East River floodplain, Colorado, United States - 23_s17EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
F24TB_1184756623300000550SoilMSAAASDDSMLIIAARAARTAGSIVLDAARDLKRLPAFSKEHAEI
Ga0062595_10067309023300004479SoilMNQASDPVLAVAVRAARTAASIVVDAARDLKRLPTFSKEQAGIVS
Ga0070690_10058624123300005330Switchgrass RhizosphereMSAAAPTASDHVLAVAVRAARRAASVIIDASRDLRRLPTFSKE
Ga0070677_1062280223300005333Miscanthus RhizosphereMTIDPVLAVAIRAAHRASSVILDAARDLRRRPAHAKDHGNIAA
Ga0070669_10034074413300005353Switchgrass RhizosphereMSDVPMIGDPVLAVAVRAARRAASVVVDAARDLKRLPTFSK
Ga0070669_10041055413300005353Switchgrass RhizosphereMSAGDDSVLSVAIQAARSAAAVITDAARDLVRLPTFSKDHGDIVSTADVEAEDAIVATLR
Ga0070675_10006404913300005354Miscanthus RhizosphereMSAGDDSVLSVAIQAARSAAAVITDAARDLVRLPTFSKDHGDIV
Ga0070674_10204045613300005356Miscanthus RhizosphereMSAGDDSVLSVAIQAARSAAAVITDAARDLVRLPTFSKDHGDIVS
Ga0068867_10048798023300005459Miscanthus RhizosphereMSGSMDAMLAVAVRAARTAGSIVVDASRDLRRLPAFSKEHARVA
Ga0070672_10001479853300005543Miscanthus RhizosphereMSAAAPTASDHVLAVAVRAARRAASVIIDASRDLRRL
Ga0070672_10085308613300005543Miscanthus RhizosphereMPDVPMIGDPVLAVAVRAARRAASVVVDAARDLKRLPTFS
Ga0066670_1006794123300005560SoilMSDPALAVAVRAARNAAAVISDAAHDLKRLPTFSKERGEIVSAA
Ga0068859_10214864113300005617Switchgrass RhizosphereMSPSGAGGVDSMLAIAARAARTAGSIVLDAARDLKRLPAFSKEH
Ga0068864_10239394733300005618Switchgrass RhizosphereMNTGDDSVLAVAIQAARSAAAVLTDAARDLVRLPTFSKDHGDIVSTADVEAEDAIVA
Ga0068866_1112713213300005718Miscanthus RhizosphereMSAGDDSVLSVAIQAARSAAAVITDAARDLVRLPTFSKDHGDIVSTAD
Ga0068861_10133917623300005719Switchgrass RhizosphereMTSANDPVLAVAVRAARRAASVIADASRDLRRLPTFSKEHGDI
Ga0068861_10148089613300005719Switchgrass RhizosphereMSLGNDPVLAVATRAARTAASILVDATRDLRRLPAFS
Ga0068858_10235326213300005842Switchgrass RhizosphereMSPSGAGGVDSMLAIAARAARTAGSIVLDAARDLKRLPAFSKEHAEIV
Ga0068860_10279752813300005843Switchgrass RhizosphereVNTSSDPVLAVAVRAARRAASVIVDASRDLRRLPTFSKEHGDIVSAAD
Ga0075163_1154917523300006056Wastewater EffluentMTNDPVLAVAVRAARSAASILTDAARDLKRLPTFSKEHGDIVSGAD
Ga0075521_1054973023300006642Arctic Peat SoilMSMTDDPVLAVAVRAARTAASVVADAARDLKRLPSFSK
Ga0066659_1058859123300006797SoilMNDPALAVAVRAARNAAAVISDAAHDLKRLPTFSKERGEIVSAAA
Ga0066659_1065414113300006797SoilMFMIATMNATSDPILAVAVRAARRAASVIIDASRD
Ga0075428_10146768623300006844Populus RhizosphereMADAPMVTDPVLAVAVRAARRAAAVIIDAARDLKRLPTFSKEHGDIVS
Ga0079216_1051911113300006918Agricultural SoilVNAPGDAVLAVAVRAARRAAAVIGDASRDLKRLPTYSKEAGEIVVMADKEAE
Ga0074063_1280830913300006953SoilMPAASDPVLAVAMRAARSAASVVADAARDLKRLPTFSKEHGDIV
Ga0105251_1035587513300009011Switchgrass RhizosphereMQNDPVLAVAVHAARRAAAVLVDAGRDLKRRPMHAKDH
Ga0102851_1034945523300009091Freshwater WetlandsMAHDPVLAVAVRAARRAAAVITDAARDLKRLPSHAKQHGDLIANAGVEA
Ga0066709_10051562213300009137Grasslands SoilMSDPSLAVAVRAARNAAAVIDDAAHDLKRLPAFSKEHGEIASTADAEA
Ga0105248_1012400013300009177Switchgrass RhizosphereMSAGDDSVLSVAIQAARSAAAVITDAARDLVRLPTFSKDH
Ga0105248_1176126423300009177Switchgrass RhizosphereMTTTSSDPVLAVAVRAARRAASVIIDASRDLRRLPTFSKEHG
Ga0115028_1108701323300009179WetlandMQNDTVLAVAVRAARRAASVMEDAARDLKRLPSHSKEHGDIVTSADM
Ga0073899_1055734123300009540Activated SludgeMSDVPMVGDPVLAVAVRAARRAASVIVDAGRDLKRLPTFSKEHGEIAAAA
Ga0105252_1044295813300009678SoilVTTTNDAVLAVAVRAARRAAAVVNDASRDLKRLPTFFKEHGDI
Ga0116144_1033916313300009687Anaerobic Digestor SludgeMADLPMIGDPVLAVAVRAARRASSVLVDAARDLKRLPTFSKEHDEIAAAA
Ga0131092_1149160113300009870Activated SludgeMINDPVLAVAVRAARRAGSVVIDAARDLKRLPAHAKEHA
Ga0134082_1016496813300010303Grasslands SoilMSDPALAVAVRAARNAAAVISDAAHDLKRLPTFSKERGEIVSAAAAEAKN
Ga0134088_1054477323300010304Grasslands SoilMSDPSLAVAVRAARNAAAVISDAAHDLKRLPAFSKEHGEIASTADA
Ga0134062_1045147423300010337Grasslands SoilMNDPALAVAVRAARNAAAVISAAAHDLKRLPTFSKE
Ga0074044_1117242213300010343Bog Forest SoilMSDPCLAVAVRAARNAAAIIEDAARDLARLPSSSQAHA
Ga0134121_1048363723300010401Terrestrial SoilMSDVPMIGDPVLAVAVRAARRAASVVVDAARDLKRLPTFSKE
Ga0134123_1125125823300010403Terrestrial SoilMTMHHDPILAVAIRAARRAGSVIVDAARDLKRLPSHAKGHDEIAKVAD
Ga0137428_117044023300011432SoilLNTSSDPVLAVAVRAARRAASVIIDASRDLRRLPTFSKE
Ga0136623_1047869123300012045Polar Desert SandVTLAADPVLAVAVRAAQRAASIVSDSARDLKRLPIYSREHRD
Ga0136622_1015382623300012187Polar Desert SandVSLAADPVLAVAVRAAQRAASIVSDSARDLKRLPIYSRE
Ga0137381_1143489023300012207Vadose Zone SoilMNTTADPVLAVAVRAARRAGSVIIDASRDLRRLPTFSK
Ga0137370_1089181913300012285Vadose Zone SoilMSDPSLAVAVRAARNAAAVISDAAHDLKRLPTFSKEH
Ga0136612_1029542423300012680Polar Desert SandMNAPNDPVLAVAVRAARRAAAVIGDASRDLKRLPTFSKEHGEIV
Ga0157293_1023229923300012898SoilMSDVPMIGDPVLAVAVRAARRAASVVVDAARDLKRLPTFSKEHLEI
Ga0137394_1156378223300012922Vadose Zone SoilMNATTDSVLAVAVRAARRAASVIIDASRDLRRLPTFSKEHADIVST
Ga0164299_1048836913300012958SoilMTNDQVLAVAIRAAHRASSVIIDAARDLRRRPAHAKDHGDIAAEA
Ga0126369_1298392523300012971Tropical Forest SoilMTNDPVLAVAIRAAHRAASVILDAARDLRRRPAHAK
Ga0163162_1177146513300013306Switchgrass RhizosphereMSAGDDSVLSVAIQAARSAAAVITDAARDLVRLPTFSKDHGDIVSTADV
Ga0075345_115634613300014312Natural And Restored WetlandsLTRPVDPVLAVAVRAARRAAAVVADASRDLKRLPTFSKEQGAIVSAADR
Ga0075356_106605423300014323Natural And Restored WetlandsMAALDDPVLSVAVRAARSAASVIVDAARDLARLPTFSKDHGDIVSTADVEAEDA
Ga0157377_1142950713300014745Miscanthus RhizosphereMQNDTVLAVAVHAARRAAAVLFDAARDLKRRPMHAK
Ga0157376_1149237813300014969Miscanthus RhizosphereMSVTNDPVLAVAVRAARTAASIVIDAALDLKRLPTFSKDHGDIVSGADME
Ga0132255_10319926513300015374Arabidopsis RhizosphereMSAADDPILSVAIQAARSAAAVITDAARDLVRLPTFSKDHGDI
Ga0182041_1032661023300016294SoilMVGDPVLAVAVRAVRRAAAVVIDAARDLKRLPTFS
Ga0187780_1079573923300017973Tropical PeatlandLNDPALAVAERAARNAAAVIGDAARDLKRLATFSK
Ga0184629_1063206513300018084Groundwater SedimentMINDPVLAVAVRAARRAASVIIDAARDLKRLPSHAKEHGDIVTA
Ga0190270_1332601923300018469SoilMNTSSDPVLAVAVRAARRAASVIIDASRDLRRLPTFS
Ga0190271_1024179813300018481SoilMTQIADPVLAVAVRAARRAASVIGDASRDLKRLPTFSKEHGDIFSA
Ga0066669_1018665313300018482Grasslands SoilMNTTSDPVLAVAVRAARRAASVIIDASRDLRRLPTF
Ga0193715_106932013300019878SoilMNATTDSVLAVAVRAARRAASVIIDASRDLRRLPTFSKEHADI
Ga0207705_1063931923300025909Corn RhizosphereMSTMAGDPTLAVAVRAARRAASVVADASRDLRRLPTFSEEHG
Ga0207665_1167578233300025939Corn, Switchgrass And Miscanthus RhizosphereMTMAADPVLAVAVRAARRAASVMVDASRDLRRLPTFSKEHGDI
Ga0207658_1089175013300025986Switchgrass RhizosphereMSAGDDSVLSVAIQAARSAAAVITDAARDLVRLPTFSK
Ga0207677_1164658623300026023Miscanthus RhizosphereMIAPGSDVVLEVAIRGARRAASVIIDAARDLTHLPAH
Ga0207703_1131211923300026035Switchgrass RhizosphereMTNDPVLSVAIRAAHRASSVIIDAARDLRRRPAHAKD
Ga0208540_102797123300026059Natural And Restored WetlandsLTRPVDPVLAVAVRAARRAAAVVADASRDLKRLPTFSKEQGAIVSAADREA
Ga0207641_1027192333300026088Switchgrass RhizosphereMQNDPVLAVAVHAARRAAAVLVDAARDLKRRPMHAKDHGDIVFNAD
Ga0207641_1071436923300026088Switchgrass RhizosphereMSGSMDAMLAVAVRAARTAGSIVVDASRDLRRLPAFSKEHAQV
Ga0209377_110372823300026334SoilMINDPVLAVAVRAARRAGSVIVDAARDLKRLPSHASDH
Ga0209156_1043474513300026547SoilMSDPALAVAVRAARNAAAVISDAAHDLKRLPTFSKERGDIVSAA
Ga0209689_140109213300027748SoilMSDPSLAVAVRAARNAAAVISDAAHDLKRLPAFSKEHGEIASTADAEAGNAIV
Ga0209490_1052865123300027823FreshwaterMTTSHDPVLSVAVRAAQAAASVIADAALDLKRLPTF
Ga0209293_1008807533300027877WetlandLTRPADPVLAVAVRAARRAAAVIADAARDLKRLPTF
Ga0209293_1068922623300027877WetlandVSAPISDPVLAVAVRAARRAGAVIVDAARDLKRLPAHAKEHGDIATN
Ga0209048_1015236123300027902Freshwater Lake SedimentMNQDPILAVAVRAARRAGSVIIDAARDLKRLPSHAKGHGEIAKAAD
Ga0247828_1071075613300028587SoilMNTSSYPVLAVAVRAARRAASVIIDASRDLRRLPTFSKEHGDIVSSADT
Ga0307504_1013638223300028792SoilMSDPSLAVAVRAARNAAAVISDAAHDLKRLPAFSK
Ga0311332_1143473623300029984FenMSIADDPVLAVAVRAARSAASVISDAARDLVRLPTF
Ga0311336_1054319513300029990FenMSIADDPVLAVAVRAARSAASVISDAARDLIRLPTFS
Ga0311337_1017175513300030000FenMNAADDPVLAVAVRAARSAASVISDAARDLVRLPTFSKDHGDIVSTA
Ga0311350_1003540213300030002FenMSIGDDPVLAVAVRAARSAASVISDAARDLVRLPTFSKDHGDIVSTA
Ga0311333_1028215313300030114FenVSAADDAVLAVAVRAARSAASVITDAAHDLVRLPTFSKDHGDIVSTADVE
Ga0311349_1044144213300030294FenMNAADDPVLAVAVRAARSAASVIADAARDLVRLPTFSKDHGDIVSTADVEAE
Ga0302211_1023478813300030491FenVSMIDDPVLAVAMRAARTAASVVADAARDLKRLPTFSKDHGHIVTAAD
Ga0310887_1021203223300031547SoilMADAPMVTDPVLAVAVRAARRAAAVIIDAARDLKRLPTFSKEH
Ga0318560_1049613323300031682SoilMTNDPVLAVAIRAAHRASSVILDAARDLRRRPSHAKDHGDVATEA
Ga0302321_10016444513300031726FenVSAADDTVLAVAVRAARSAAAVITDAARDLVRLPTFSKDHGDIVSTADIEAE
Ga0318529_1037078923300031792SoilMTNDPVLAVAIRAAHRASSVILDAARDLRRRPSHAKDHG
Ga0318512_1062099023300031846SoilMTMVGDPVLAVAVRAARRAASVTVDASRDLRRLPTFSKEHGD
Ga0315297_1100852713300031873SedimentMNQDPVLAVAVRAARRAGSVIIDAARDLKRLPSHAKGHGDIARA
Ga0306921_1093892433300031912SoilMNDAALAVAVRAARNAGGVIADAARDLPRLATFSKEHG
Ga0311367_1075109223300031918FenMNADNDPVLAVAVRAARTAASILDDAARDLKRLPSFSKAHGAVVSAADIE
Ga0308175_10296129913300031938SoilMSTMAGDPTLAVAVRAARRAASVVADASRDLRRLPTFSKE
Ga0308174_1174014723300031939SoilMSTMAGDPTLAVAVRAARRAASVVADASRDLRRLPTY
Ga0307411_1033460213300032005RhizosphereLTAPGDAVLAVAVRAARRAAAVIGDASRDLRRLPTYSKEHG
Ga0318563_1067539213300032009SoilMSDPTLAVAVRAARNAAAVIADATQDLKRLPAFSKEHGE
Ga0318575_1035564423300032055SoilMVGDPVLAVAVRAVRRAAAVVIDAARDLKRLPTFSKEHADIVT
Ga0307471_10050812233300032180Hardwood Forest SoilMQATAMTNDPVLAVAVRAAHRASSVILDAARDLRRRPAH
Ga0307471_10121824223300032180Hardwood Forest SoilMINDPVLAVAVRAARRAGSVIVDAARDLKRLPAHAKEH
Ga0316188_1032093923300032276Worm BurrowMSAANDPVLAVAVRAARTAASIIVDAARDLKRLPTFSKE
Ga0315273_1195248023300032516SedimentMSNTDDPVLAVAVRAARSAASVIADAARDLGRLPTFSKDHGDIVSTADVEAE
Ga0316605_1240112913300033408SoilVSGAGDTVLAVAVRAAQRAASVIIDAARDLKRLPTYAKEHGD
Ga0316619_1069154913300033414SoilLTRPADPVLAVAVRAARRAAAVIADAARDLKRLPTFSKEQGDIVSAAD
Ga0316625_10105474913300033418SoilLTRPADPVLAVAVRAARRAAAVIADAARDLKRLPTFSKEQGDIVSAA
Ga0316625_10147515313300033418SoilMSPANDPVLAVAVRAARTAASIIIDAARDLKRLPTFSKEHGD
Ga0316601_10103014113300033419SoilLTLPADPVIAVAVRAARRAAAVIADASRDLKRLPTFSKEHGDIVSGADKEA
Ga0316627_10205536613300033482SoilMQNDTVLAVAVRAARRAASVMEDAARDLKRLPSHSKEHGDI
Ga0316630_1105259913300033487SoilLTRPVDPVLAVAVRAARRAAAVIADAARDLKRLPTFSKEQGDIVSAADQEA
Ga0316628_10260913623300033513SoilLTRPADPVLAVAVRAARRAAAVIADAARDLKRLPTFSKDQGDIVSAADQEAE
Ga0316616_10207913913300033521SoilLTLPADPVIAVAVRAARRAAAVIADASRDLKRLPTFSKEHGDIVSGADKE
Ga0316616_10357182623300033521SoilLTRPADPVLAVAVRAARRAAAVIADAARDLKRLPTFSKGQGDIVS
Ga0364943_0454529_2_1543300034354SedimentMSAADDSVLSVAVRAARSAAAVITDAARDLVRLPTFSKDHGDIVSTADVEA


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.