 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| Family ID | F077355 |
| Family Type | Metagenome |
| Number of Sequences | 117 |
| Average Sequence Length | 43 residues |
| Representative Sequence | MILAKRLKAIKVGREWLIDPKDLDAVKDRKVGRPRKARKSTKR |
| Number of Associated Samples | 82 |
| Number of Associated Scaffolds | 117 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 45.30 % |
| % of genes near scaffold ends (potentially truncated) | 61.54 % |
| % of genes from short scaffolds (< 2000 bps) | 91.45 % |
| Associated GOLD sequencing projects | 75 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.25 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (66.667 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere (12.821 % of family members) |
| Environment Ontology (ENVO) | Unclassified (40.171 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (65.812 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 11.27% β-sheet: 11.27% Coil/Unstructured: 77.46% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.25 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 117 Family Scaffolds |
|---|---|---|
| PF01381 | HTH_3 | 2.56 |
| PF12844 | HTH_19 | 2.56 |
| PF02178 | AT_hook | 2.56 |
| PF01555 | N6_N4_Mtase | 1.71 |
| PF02954 | HTH_8 | 1.71 |
| PF12762 | DDE_Tnp_IS1595 | 1.71 |
| PF11146 | DUF2905 | 0.85 |
| PF04471 | Mrr_cat | 0.85 |
| PF00149 | Metallophos | 0.85 |
| PF03795 | YCII | 0.85 |
| PF13489 | Methyltransf_23 | 0.85 |
| PF00175 | NAD_binding_1 | 0.85 |
| PF09721 | Exosortase_EpsH | 0.85 |
| PF13570 | PQQ_3 | 0.85 |
| PF04434 | SWIM | 0.85 |
| PF12686 | DUF3800 | 0.85 |
| PF01909 | NTP_transf_2 | 0.85 |
| PF12848 | ABC_tran_Xtn | 0.85 |
| PF13414 | TPR_11 | 0.85 |
| PF02321 | OEP | 0.85 |
| PF03120 | DNA_ligase_OB | 0.85 |
| PF13683 | rve_3 | 0.85 |
| PF04545 | Sigma70_r4 | 0.85 |
| PF03793 | PASTA | 0.85 |
| PF13443 | HTH_26 | 0.85 |
| COG ID | Name | Functional Category | % Frequency in 117 Family Scaffolds |
|---|---|---|---|
| COG0863 | DNA modification methylase | Replication, recombination and repair [L] | 1.71 |
| COG1041 | tRNA G10 N-methylase Trm11 | Translation, ribosomal structure and biogenesis [J] | 1.71 |
| COG1538 | Outer membrane protein TolC | Cell wall/membrane/envelope biogenesis [M] | 1.71 |
| COG2189 | Adenine specific DNA methylase Mod | Replication, recombination and repair [L] | 1.71 |
| COG0272 | NAD-dependent DNA ligase | Replication, recombination and repair [L] | 0.85 |
| COG2350 | YciI superfamily enzyme, includes 5-CHQ dehydrochlorinase, contains active-site pHis | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.85 |
| COG4279 | Uncharacterized protein, contains SWIM-type Zn finger domain | Function unknown [S] | 0.85 |
| COG4715 | Uncharacterized protein, contains SWIM-type Zn finger domain | Function unknown [S] | 0.85 |
| COG5431 | Predicted nucleic acid-binding protein, contains SWIM-type Zn-finger domain | General function prediction only [R] | 0.85 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 66.67 % |
| All Organisms | root | All Organisms | 33.33 % |
| Visualization |
|---|
| Powered by ApexCharts |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 12.82% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 9.40% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 8.55% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 5.98% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 5.98% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 5.13% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.27% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 4.27% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 4.27% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 4.27% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 3.42% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 3.42% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 2.56% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.56% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 2.56% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.56% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.71% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.71% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.71% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.71% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.71% |
| Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Contaminated → Groundwater | 0.85% |
| Sugarcane Root And Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil | 0.85% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.85% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.85% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.85% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.85% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.85% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.85% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.85% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.85% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.85% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2007427000 | Uranium contaminated groundwater from Oak Ridge Integrated Field Research Center, Tennessee | Environmental | Open in IMG/M |
| 2162886012 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 | Host-Associated | Open in IMG/M |
| 3300003324 | Sugarcane bulk soil Sample H2 | Environmental | Open in IMG/M |
| 3300003998 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleC_D2 | Environmental | Open in IMG/M |
| 3300003999 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleA_D2 | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
| 3300005184 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 | Environmental | Open in IMG/M |
| 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 | Host-Associated | Open in IMG/M |
| 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 | Host-Associated | Open in IMG/M |
| 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 | Host-Associated | Open in IMG/M |
| 3300005294 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil | Environmental | Open in IMG/M |
| 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Environmental | Open in IMG/M |
| 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Environmental | Open in IMG/M |
| 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Environmental | Open in IMG/M |
| 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Environmental | Open in IMG/M |
| 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
| 3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
| 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
| 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Environmental | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006876 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200 | Environmental | Open in IMG/M |
| 3300006894 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Control | Environmental | Open in IMG/M |
| 3300006918 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100 | Environmental | Open in IMG/M |
| 3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
| 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300010039 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot56 | Environmental | Open in IMG/M |
| 3300010042 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105B | Environmental | Open in IMG/M |
| 3300010044 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60 | Environmental | Open in IMG/M |
| 3300010045 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014272 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberrySE_CattailB_D1 | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
| 3300018466 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 T | Environmental | Open in IMG/M |
| 3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026312 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 (SPAdes) | Environmental | Open in IMG/M |
| 3300027266 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM2H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027886 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost (SPAdes) | Environmental | Open in IMG/M |
| 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Host-Associated | Open in IMG/M |
| 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Host-Associated | Open in IMG/M |
| 3300032074 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R1 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| 2007447214 | 2007427000 | Groundwater | MIKAKRLKAMKVGHEWLIDPNDLDAVEERKVGRPRKSRNGTKGRKPSA |
| MBSR1b_0932.00006540 | 2162886012 | Miscanthus Rhizosphere | AKRLKAFKFGREWLIDPKDLDAVKDRKVGRPRKVRKTSKS |
| MBSR1b_0616.00000070 | 2162886012 | Miscanthus Rhizosphere | MISGGRLKATKVGNMWVINPKDLEAVKDRKVGRPRKARTRAKR |
| MBSR1b_0701.00001270 | 2162886012 | Miscanthus Rhizosphere | ATKFGNVWMIDPKDLEPLKDRKVGRPRKARKNGKYKK |
| soilH2_103541081 | 3300003324 | Sugarcane Root And Bulk Soil | MIEAKRLKATKVGNVWLIDPKDLDAVKDRKVGRPRKSRKSVKK* |
| Ga0055472_100427141 | 3300003998 | Natural And Restored Wetlands | RLKAIKVGREWLIDPKDLDAVKDRKVGRPRKARKTTKGRV* |
| Ga0055469_100340871 | 3300003999 | Natural And Restored Wetlands | VTPARVRAMIDSGRLKATKVGYMWVIDPKDLDAVKDRKVGRPRKSRKSAKQ* |
| Ga0055469_101233032 | 3300003999 | Natural And Restored Wetlands | DAGRLKAIRVGREWLIDPKDLEAVKDRKVGRPRKTRKGAKR* |
| Ga0062593_1025938051 | 3300004114 | Soil | RVRAMIARKRLKAIRVGIMWLIDPKDLEAVKDRKVGRPRKARKSTKR* |
| Ga0062592_1005483412 | 3300004480 | Soil | MISGGRLKATKVGNMWVINPKDLEAVKDRKVGRPRKARTRAKR* |
| Ga0066671_110311961 | 3300005184 | Soil | IEAKRLKATKFGNVWMIDPKDLDTVKDRKVGRPRKSCKGEKR* |
| Ga0065704_106973923 | 3300005289 | Switchgrass Rhizosphere | ALIDSGRLKATKVGGAWLINPKDLDAVKNRKPGRPRKGEKKSAT* |
| Ga0065712_100686516 | 3300005290 | Miscanthus Rhizosphere | MIAAKRLKAIKVGREWLIDPKDLEAVKDRKVGRPRKVRKATKR* |
| Ga0065715_100765701 | 3300005293 | Miscanthus Rhizosphere | MIDSGRLKATKVGNMWVINPKDLDAVKDRKVGRPRKVRKFPKQ* |
| Ga0065715_101064262 | 3300005293 | Miscanthus Rhizosphere | MIGSGRLKAIKVGKVWLIDPKDLDAVKERKVGRPRKSRKSSKLSHSKNGA* |
| Ga0065705_102677672 | 3300005294 | Switchgrass Rhizosphere | MIESGRLKATKVGIVWMIDPKDLEAVKDRKTGRPRKTRKSTKR* |
| Ga0065707_109626581 | 3300005295 | Switchgrass Rhizosphere | MIDSGRLKATKVGSFWVIDPRNLEAVKDRKVGRPRKVRKTTKR* |
| Ga0066388_1008189372 | 3300005332 | Tropical Forest Soil | MIEAKRLKAIKVGREWLIDPKDLDAVKDRKVGRPRKARTTSKRK* |
| Ga0070689_1019141873 | 3300005340 | Switchgrass Rhizosphere | IDAKRLKATKFGNVWMIDPKDLEAVKTRKPGRPRKARKK* |
| Ga0070689_1020643631 | 3300005340 | Switchgrass Rhizosphere | RVLKMIAAKRLKATTLGNVWLIDPKDLDAVKDRKVGRPRKARKGRY* |
| Ga0070687_1010981922 | 3300005343 | Switchgrass Rhizosphere | MINSGRLKATKVGIVWMIDPKDLDALKDRKVGRPRKARKASKR* |
| Ga0070673_1003746182 | 3300005364 | Switchgrass Rhizosphere | MIKAKRLKAMKVGHEWLIDPKDLEAVKERKVGRPRKSRKAAKR* |
| Ga0070688_1009926672 | 3300005365 | Switchgrass Rhizosphere | LKMIAAKRLKATTLGNVWLIDPKDLDAVKDRKVGRPRKARKGRY* |
| Ga0070700_1018729172 | 3300005441 | Corn, Switchgrass And Miscanthus Rhizosphere | GRLKAMKVGKVWLIDPKDLDGVKDRKVGRPRKARKSSKR* |
| Ga0070694_1005110382 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | LPPNVLKAIKVGREWLIDPKDLEAVKDRKVGHPHKTRKTKS* |
| Ga0070706_1000252805 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MIRAKRLKAIKVGHEWLIDPKDLDAVKERKVGRPRKSRKGSKRNP* |
| Ga0070697_1001986791 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | VLIRAKRLKAIKVGREWLIDPKDLDAVKERKVGRLRKSRKRTKVN* |
| Ga0070697_1018767192 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | MIVAKRLKATKVGNVWLIDPKDLEAVKDRKVGRPRKTRKATKKR* |
| Ga0070704_1013565682 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | LIDSGRLKAMKVGREWLIDPKDLDAVKDRKVGRPRKARKGTKR* |
| Ga0066670_106992712 | 3300005560 | Soil | RVHKMIAAKRLKATKFGNAWLIDPKDLEAVKDRKVGRPRKSRKSTKR* |
| Ga0068857_1007887581 | 3300005577 | Corn Rhizosphere | MIDSGRLKASKVGREWLIDPKDLDAVKDRKVGRPRKSRKSTKK* |
| Ga0068857_1015982292 | 3300005577 | Corn Rhizosphere | RLKAMKVGHEWLIDPKDLEAVKERKVGRPRKLRKGTKSKN* |
| Ga0068857_1021661742 | 3300005577 | Corn Rhizosphere | MIVSKRLKAIKVGREWLIDPKDLDAVKDRKVGRPRKTRKTSKR* |
| Ga0068857_1023696601 | 3300005577 | Corn Rhizosphere | VGHEWLIDPKDLEAVKERKVGRPRKSRKSLKVKTKR* |
| Ga0070702_1002230772 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | MIGSGRLKAIKVGKVWLIDPKDLDAVKERKVGRPRKSRKSSKLSHSKNVA* |
| Ga0070702_1002496972 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | MIDSGRLKATKVGNMWVINPKDLDSVKDRKVGRPRKARKTSKR* |
| Ga0070702_1015942291 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | SNRVRALIEAKRLKAFKYGREWLIYVKDLDAVKDRKVGRPRKSRKSAKR* |
| Ga0068859_1002516062 | 3300005617 | Switchgrass Rhizosphere | MIEAKRLKATKVGNVWLIDPKDLDAVKDRKVGRPRKSRKSAKK* |
| Ga0068859_1003052481 | 3300005617 | Switchgrass Rhizosphere | DRVRKMIEAKRLKATKLGNVWVIDPKDLDAVKDRKVGRPRKLRKTTKR* |
| Ga0068859_1009614211 | 3300005617 | Switchgrass Rhizosphere | VSRVHKMIAAKRLKATKLGNVWLINPKALDAVKDRKVGRPRKSRKATRR* |
| Ga0068859_1010955703 | 3300005617 | Switchgrass Rhizosphere | KAFKYGREWLIDPKDLNAVKNRKVGRPRKAAKAR* |
| Ga0068859_1015493861 | 3300005617 | Switchgrass Rhizosphere | ALIMSKRLKAVKVGGAWLIDPKDLDAVKVRKVGRPRKARKASKR* |
| Ga0068859_1026178352 | 3300005617 | Switchgrass Rhizosphere | RAKRLKAFKFGREWLIDPKDLDAVKDRKVGRPRKVRKGTKR* |
| Ga0068861_1017460432 | 3300005719 | Switchgrass Rhizosphere | MIARGRLKAMRIGIMWLIDPKDLDAVKNRKVGRPRKARKSPGKR* |
| Ga0068863_1002020323 | 3300005841 | Switchgrass Rhizosphere | MIRAKRLKAFKFGREWLIDPKDLDAVKDRKVGRPRKVRKGTKR* |
| Ga0068860_1000532421 | 3300005843 | Switchgrass Rhizosphere | LKAIKVGREWLIDPKDLDAVKDRKVGRPRKSRKSTKK* |
| Ga0068871_1008125571 | 3300006358 | Miscanthus Rhizosphere | SRVRKMIDSGRLKATKVGNMWVINPKDLDSVKDRKVGRPRKARKTSKR* |
| Ga0075434_1008057201 | 3300006871 | Populus Rhizosphere | RGRLKAMRIGIMWLINPKDLDAVKDRKVGRPRKARKSSGKR* |
| Ga0075434_1010089363 | 3300006871 | Populus Rhizosphere | IEAKRLKATKLGNVWVINPKDLDAVTKRKPGRPRKSAKK* |
| Ga0079217_113408561 | 3300006876 | Agricultural Soil | MISSGRLKATKVGNMWVIDPKDLEAVKNRKVGRPRKARKTSKR* |
| Ga0079215_115153641 | 3300006894 | Agricultural Soil | ALIMSKRLKAVKVGGAWLIDPKDLDAVKVRKVGRPRKAHKASKR* |
| Ga0079216_111395402 | 3300006918 | Agricultural Soil | MKIIGTTEAAKRLKATKLGNVWLIDPKDLDALKDRKVGRPRKARKSTKR* |
| Ga0079218_111605732 | 3300007004 | Agricultural Soil | MIASGRLKATKVGNMWVIDPKDLDAVNDRKVGRPRKSRKATKR* |
| Ga0105247_112982221 | 3300009101 | Switchgrass Rhizosphere | SSGRLKATKVGNMWVIDPKDLEAVKNRKVGRPRKARKASKR* |
| Ga0114129_126847751 | 3300009147 | Populus Rhizosphere | NRVRVLIRAKRLKAIKVGHEWLIDPKDLDAVKERKVGRPRKSRKGTKRNP* |
| Ga0105243_108839383 | 3300009148 | Miscanthus Rhizosphere | VRTLIESGRLKAQKIGREYAIDPKDLEAVKDRKVGRPRKARKS |
| Ga0111538_103359471 | 3300009156 | Populus Rhizosphere | RAKRLKATKLGNVWLIDPKNFEAAKDQTVGRPRKSRKVQKR* |
| Ga0075423_106880182 | 3300009162 | Populus Rhizosphere | MIARGRLKAMRIGIMWLINPKDLDAVKDRKVGRPRKARKSSGKR* |
| Ga0105248_102922961 | 3300009177 | Switchgrass Rhizosphere | MIANGRLKAMRVGIMWLIDPKNLEAVKDRKVGRPRKARKSPKR* |
| Ga0105248_127079612 | 3300009177 | Switchgrass Rhizosphere | KRLKAIKVGREWLIDPRDLDAVKDRKVGRPRKSRKSAKR* |
| Ga0105248_128849382 | 3300009177 | Switchgrass Rhizosphere | TRVRAMINSGRLKATKVGIVWMINPKDLDALRDRKVGRPRKARKASKR* |
| Ga0126309_105348332 | 3300010039 | Serpentine Soil | MINSGRLKATKVGIVWMIDPKDLEAVKERKVGRPRKSRKS |
| Ga0126309_110910702 | 3300010039 | Serpentine Soil | IRAKRLKAFKFGREWLIDPKDLDAVKDRKVGRPRKVRKTSKS* |
| Ga0126314_102819211 | 3300010042 | Serpentine Soil | MKAMKVGHEWLIDPKDLEAVKERKVGRPRKSRKRTKSKS* |
| Ga0126314_104890272 | 3300010042 | Serpentine Soil | MIARGRLKAMRIGIMWLIDPKDLDAVKDRKVGRPRKARETTKR* |
| Ga0126314_114900352 | 3300010042 | Serpentine Soil | MILAKRLKAIKVGREWLIDPKDLDAVKDRKVGRPRKARKSNKR* |
| Ga0126310_112413681 | 3300010044 | Serpentine Soil | AKRLKATMIGNAWLIDPKDLDAVKNRKPGRPRQSRKAFKQGFA* |
| Ga0126311_101260171 | 3300010045 | Serpentine Soil | VGREWLINPKDLEAVKDRKVGRPRKARKISNRNKI* |
| Ga0105239_122957761 | 3300010375 | Corn Rhizosphere | DSGRLKATKVGNAWLIDPKDLEAVRVRKPGRPRKARKGKK* |
| Ga0134124_1000193110 | 3300010397 | Terrestrial Soil | MINSGRLKATKVGIVWMIDPKDLDAVKERKVGRPRKARKTVKR* |
| Ga0134124_102987413 | 3300010397 | Terrestrial Soil | VRTLIESGRLKAQKIGREYAIDPKDLEAVKDRKVGRPRKVRKSAKR* |
| Ga0134124_132178812 | 3300010397 | Terrestrial Soil | RLKAIKVGREWLIDPKDLDALKDRKVGRPRKARKASKR* |
| Ga0134127_102641313 | 3300010399 | Terrestrial Soil | DQGEIEGFARAMISGGRLKATKVGNMWVINPKDLEAVKDRKVGRPRKARTRAKR* |
| Ga0134127_105984862 | 3300010399 | Terrestrial Soil | MINSGRLKATKVGNMWLIDPKDLDAVKNRKVGRPRKSRKSSKQKLQAL* |
| Ga0134127_119848302 | 3300010399 | Terrestrial Soil | VTPNRVRALIEAKRLKAFKYGREWLIYVKDLDAVKDRKVGRPRKSRKSANR* |
| Ga0134122_131742001 | 3300010400 | Terrestrial Soil | MILAKRLKAIKVGREWLIDPKDLDAVKDRKVGRPRKARKSTKR* |
| Ga0134123_107819162 | 3300010403 | Terrestrial Soil | KMIAAKRLKAVKVGREWLIDPKDLDAVKDRKVGRPRKARKSAKRQLKKPLTDKN* |
| Ga0134123_108015631 | 3300010403 | Terrestrial Soil | MINSGRLKATKVGIVWMIDPKDLEAVKERKVGRPRKSRKSSKL* |
| Ga0134123_109680892 | 3300010403 | Terrestrial Soil | MIGSGRLKAIKVGKVWLIDPKDLDAVKERKVGRPRKSRKSSKVSHSKNVA* |
| Ga0105246_118311062 | 3300011119 | Miscanthus Rhizosphere | MIASGRLKGIKVGKVWLIDPKDLDAVKDRKVGRPRKARKASKR* |
| Ga0164303_114293492 | 3300012957 | Soil | MITAKRLKAFKFGREWLIDPKDLEAVKERKVGRPRKS |
| Ga0157373_115293621 | 3300013100 | Corn Rhizosphere | NRVRKMILSKRLKAIKVGREWLIDPKDLEAVKDRKVGRPRKTRKVSIKK* |
| Ga0157378_122972871 | 3300013297 | Miscanthus Rhizosphere | AFKYGREWLIYVKDLDAVKDRKVGRPRKSRKNTKR* |
| Ga0157375_101701392 | 3300013308 | Miscanthus Rhizosphere | IAANRLKAIKVGREWLIDPKDLDAVKDRKVGRPRKSRKSTKR* |
| Ga0075327_10614611 | 3300014272 | Natural And Restored Wetlands | MIVAKRLRAIKVGREWLIDPKDLDAVKDRKVGRPRKARKASKR* |
| Ga0132258_100948327 | 3300015371 | Arabidopsis Rhizosphere | RVRVLMRAKRLKAIKVGHEWLIEPKDHEDVKERKVGRPRKSGKGTKSRK* |
| Ga0190265_125491231 | 3300018422 | Soil | NKRLKAMKVGREWLIDPKDLDAVRKRTPGRPRNSRKSTKR |
| Ga0190268_107334401 | 3300018466 | Soil | AVKVGGAWLIDPKDLDAVKVRKVGRPRKARKASKR |
| Ga0190274_119913691 | 3300018476 | Soil | VRAMIDSGRLKATKVGSTWVINPKDLEAVKNRKVGRPRKVRTSAKR |
| Ga0190274_138523641 | 3300018476 | Soil | MIRAKRLKAFKFGREWLIDPKDLDAVKDRKVGRPRKVRKTSKS |
| Ga0207684_1000461011 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MIRAKRLKAIKVGHEWLIDPKDLDAVKERKVGRPRKSRKGSKRNP |
| Ga0207654_104817062 | 3300025911 | Corn Rhizosphere | LIEAKRLKAFKYGREWLIDPKDLEAVKVRKVGRPRKARNGSKKPK |
| Ga0207671_110235941 | 3300025914 | Corn Rhizosphere | MKVGREWLIDPKDLDAVKNRKVGRPRKARKTSKTK |
| Ga0207660_112357211 | 3300025917 | Corn Rhizosphere | MIDSGRLKASKVGREWLIDPKDLDAVKDRKVGRPRKSRKSTKK |
| Ga0207646_101799191 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | IKVGHEWLIDPKDLDAVKERKVGRPRKSRKGSKRNP |
| Ga0207694_111533363 | 3300025924 | Corn Rhizosphere | EAKRLKAIKVGREWLIDPKDLDAVKDRKVGRPRKSRQK |
| Ga0207687_104215732 | 3300025927 | Miscanthus Rhizosphere | MIESKRLKATKFGNVWMIDPKDLEAVKDRKVGRPRKARKAK |
| Ga0207711_107416372 | 3300025941 | Switchgrass Rhizosphere | MINSGRLKATKVGIVWMIDPKDLEAVKERKVGRPRKSRKNSKLSHSKNAP |
| Ga0207711_114472231 | 3300025941 | Switchgrass Rhizosphere | RVRKMIDSGRLKATKVGNMWVINPKDLDSVKDRKVGRPRKARKTSKR |
| Ga0207651_114671351 | 3300025960 | Switchgrass Rhizosphere | MIKAKRLKAMKVGHEWLIDPKDLEAVKERKVGRPRKSRKAAKR |
| Ga0207712_103952481 | 3300025961 | Switchgrass Rhizosphere | MIVAKRLRAIKVGREWLIDPKDLDAVKDRKVGRPRKARTTSKR |
| Ga0207640_103995193 | 3300025981 | Corn Rhizosphere | VRTLIESGRLKAQKIGREYAIDPKDLEAVKYRKVGRPRKARKKEKTRV |
| Ga0207703_110559293 | 3300026035 | Switchgrass Rhizosphere | AVKIGGAWLIDPKDLAAVKVRKVGRPKSRKSTKKKRTT |
| Ga0207703_120245041 | 3300026035 | Switchgrass Rhizosphere | VRTLIESGRLKAQKIGREYAIDPKDLEAVKDRKVGRPRKARKSAKR |
| Ga0207648_106412311 | 3300026089 | Miscanthus Rhizosphere | DSGRLKAVKLGREWMIDPKDLEALKNRKVGRPRKTSKRLGG |
| Ga0207648_106872731 | 3300026089 | Miscanthus Rhizosphere | MIKAKRLKAMKVGHEWLIDPKDLDALKDRKVGRPRKARKSVKR |
| Ga0209153_11242661 | 3300026312 | Soil | IEAKRLKATKFGNVWMIDPKDLDTVKDRKVGRPRKSCKGEKR |
| Ga0209215_10307112 | 3300027266 | Forest Soil | VRKMIEAKRLKATKFGNVWMIDPKDLEPLKDRKVGRPRKARKSTKR |
| Ga0209486_103827291 | 3300027886 | Agricultural Soil | RALIQAKRLKAFKFGREWLIDPKDLDAVKDRKVGRPRKARKASKR |
| Ga0268265_115944652 | 3300028380 | Switchgrass Rhizosphere | MIARGRLRAMRIGIMWLIDPKDLDAVKDRKVGRPR |
| Ga0268264_100945717 | 3300028381 | Switchgrass Rhizosphere | MIDSGRLKAIKVGREWLIDPKDLDAVKDRKVGRPRKSRKSTKK |
| Ga0268264_104996351 | 3300028381 | Switchgrass Rhizosphere | MIGRGRLKAMKVGKVWLIDPKDLDSVKDRKVGRPRKARK |
| Ga0268264_110073393 | 3300028381 | Switchgrass Rhizosphere | MINSGRLKATKVGIVWMIDPKDLDAVKERKVGRPRKARKT |
| Ga0307408_1018371202 | 3300031548 | Rhizosphere | MIRAKRLKAFKFGREWLIDPKDLDAVKDRKVGRPRK |
| Ga0307408_1021576071 | 3300031548 | Rhizosphere | KMIVSKRLKAIKVGREWLIDPKDLDAVKDRKVGRPRKARKTSKR |
| Ga0307405_103793822 | 3300031731 | Rhizosphere | MIDAGRLKAMRVGREWLIDPKDLEAVKDRKVGRPRKSRKTGKP |
| Ga0308173_115760091 | 3300032074 | Soil | RVRVLIRSKRLKATKVGHDWLIDPKDLDAVKERKVGRPRKARKGTKK |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |