Metagenome / Metatranscriptome Family F077432

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences

Select file to download:
Download

Overview

Basic Information
Family ID	F077432
Family Type	Metagenome / Metatranscriptome
Number of Sequences	117
Average Sequence Length	45 residues
Representative Sequence	YTVTGGAGAFANATGSGTISTQIDLCANTATGTYTGTISKPNSN
Number of Associated Samples	89
Number of Associated Scaffolds	117

Quality Assessment
Transcriptomic Evidence	Yes
Most common taxonomic group	Bacteria
% of genes with valid RBS motifs	1.71 %
% of genes near scaffold ends (potentially truncated)	97.44 %
% of genes from short scaffolds (< 2000 bps)	92.31 %
Associated GOLD sequencing projects	76
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.34

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign

Most Common Taxonomy
Group	Bacteria (73.504 % of family members)
NCBI Taxonomy ID	2
Taxonomy	All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere (17.949 % of family members)
Environment Ontology (ENVO)	Unclassified (58.120 % of family members)
Earth Microbiome Project Ontology (EMPO)	Host-associated → Plant → Plant rhizosphere (76.923 % of family members)

Multiple Sequence Alignments

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Select alignment to view:

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification:	Fibrous	Signal Peptide:	Yes	Secondary Structure distribution:	α-helix: 0.00% β-sheet: 30.56% Coil/Unstructured: 69.44%
Feature Viewer

Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.34
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.34
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 117 Family Scaffolds
PF01156	IU_nuc_hydro	11.97
PF00072	Response_reg	10.26
PF07494	Reg_prop	3.42
PF00246	Peptidase_M14	3.42
PF05402	PqqD	1.71
PF00501	AMP-binding	1.71
PF07484	Collar	1.71
PF13418	Kelch_4	1.71
PF00884	Sulfatase	1.71
PF01737	Ycf9	0.85
PF04862	DUF642	0.85
PF04471	Mrr_cat	0.85
PF03795	YCII	0.85
PF03551	PadR	0.85
PF14706	Tnp_DNA_bind	0.85
PF00440	TetR_N	0.85
PF00903	Glyoxalase	0.85
PF01326	PPDK_N	0.85
PF13620	CarboxypepD_reg	0.85
PF01165	Ribosomal_S21	0.85
PF08327	AHSA1	0.85
PF13415	Kelch_3	0.85
PF00589	Phage_integrase	0.85
PF00082	Peptidase_S8	0.85
PF00933	Glyco_hydro_3	0.85
PF00254	FKBP_C	0.85
PF13238	AAA_18	0.85
PF13540	RCC1_2	0.85
PF07732	Cu-oxidase_3	0.85
PF12833	HTH_18	0.85

COG ID	Name	Functional Category	% Frequency in 117 Family Scaffolds
COG1957	Inosine-uridine nucleoside N-ribohydrolase	Nucleotide transport and metabolism [F]	11.97
COG3292	Periplasmic ligand-binding sensor domain	Signal transduction mechanisms [T]	3.42
COG0574	Phosphoenolpyruvate synthase/pyruvate phosphate dikinase	Carbohydrate transport and metabolism [G]	0.85
COG0828	Ribosomal protein S21	Translation, ribosomal structure and biogenesis [J]	0.85
COG1472	Periplasmic beta-glucosidase and related glycosidases	Carbohydrate transport and metabolism [G]	0.85
COG1695	DNA-binding transcriptional regulator, PadR family	Transcription [K]	0.85
COG1733	DNA-binding transcriptional regulator, HxlR family	Transcription [K]	0.85
COG1846	DNA-binding transcriptional regulator, MarR family	Transcription [K]	0.85
COG2132	Multicopper oxidase with three cupredoxin domains (includes cell division protein FtsP and spore coat protein CotA)	Cell cycle control, cell division, chromosome partitioning [D]	0.85
COG2350	YciI superfamily enzyme, includes 5-CHQ dehydrochlorinase, contains active-site pHis	Secondary metabolites biosynthesis, transport and catabolism [Q]	0.85

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	73.50 %
Unclassified	root	N/A	26.50 %

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	73.50 %
Unclassified	root	N/A	26.50 %

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	73.50 %
Unclassified	root	N/A	26.50 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	26.50 %
Acidobacteria	phylum	All Organisms → cellular organisms → Bacteria → Acidobacteria	24.79 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	7.69 %
Terrabacteria group	clade	All Organisms → cellular organisms → Bacteria → Terrabacteria group	1.71 %
Bacteria incertae sedis	no rank	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis	0.85 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	26.50 %
unclassified Acidobacteria	no rank	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria	17.09 %
Acidobacteriia	class	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia	3.42 %
Blastocatellia	class	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia	3.42 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	3.42 %
delta/epsilon subdivisions	subphylum	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions	2.56 %
Chloroflexi	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	0.85 %
Bacteria candidate phyla	clade	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla	0.85 %
Cyanobacteria/Melainabacteria group	clade	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group	0.85 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	26.50 %
Acidobacteria bacterium SCGC AG-212-P17	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium SCGC AG-212-P17	9.40 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	7.69 %
Acidobacteriales	order	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales	3.42 %
Deltaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	2.56 %
Burkholderiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	2.56 %
unclassified Blastocatellia	no rank	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia	1.71 %
Cyanobacteria	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria	0.85 %
unclassified Betaproteobacteria	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria	0.85 %
unclassified Chloroflexi	no rank	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi	0.85 %
candidate division KSB1	clade	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division KSB1	0.85 %
Chloracidobacterium	genus	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Chloracidobacterium	0.85 %
Blastocatellales	order	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales	0.85 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	26.50 %
Acidobacteria bacterium SCGC AG-212-P17	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium SCGC AG-212-P17	9.40 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	7.69 %
Acidobacteriaceae	family	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	3.42 %
Blastocatellia bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium	1.71 %
Myxococcales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales	1.71 %
Oxalobacteraceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae	1.71 %
Chloroflexi bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	0.85 %
Pyrinomonadaceae	family	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae	0.85 %
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	0.85 %
unclassified Deltaproteobacteria	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria	0.85 %
unclassified candidate division KSB1	no rank	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division KSB1 → unclassified candidate division KSB1	0.85 %
Cyanophyceae	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Cyanophyceae	0.85 %
Chloracidobacterium	genus	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Chloracidobacterium	0.85 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	26.50 %
Acidobacteria bacterium SCGC AG-212-P17	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium SCGC AG-212-P17	9.40 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	7.69 %
Massilia group	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Massilia group	1.71 %
unclassified Acidobacteriaceae	no rank	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae	1.71 %
Blastocatellia bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium	1.71 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	0.85 %
candidate division KSB1 bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division KSB1 → unclassified candidate division KSB1 → candidate division KSB1 bacterium	0.85 %
unclassified Pyrinomonadaceae	no rank	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae	0.85 %
Cystobacterineae	suborder	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae	0.85 %
Chloroflexi bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	0.85 %
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	0.85 %
Cyanophyceae	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Cyanophyceae	0.85 %
Chloracidobacterium	genus	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Chloracidobacterium	0.85 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	26.50 %
Acidobacteria bacterium SCGC AG-212-P17	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium SCGC AG-212-P17	9.40 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	7.69 %
Acidobacteriaceae bacterium KBS 89	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium KBS 89	1.71 %
Massilia	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Massilia group → Massilia	1.71 %
Blastocatellia bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium	1.71 %
Myxococcaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae	0.85 %
Pyrinomonadaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium	0.85 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	0.85 %
candidate division KSB1 bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division KSB1 → unclassified candidate division KSB1 → candidate division KSB1 bacterium	0.85 %
Chloroflexi bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	0.85 %
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	0.85 %
Cyanophyceae	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Cyanophyceae	0.85 %
Chloracidobacterium	genus	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Chloracidobacterium	0.85 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	26.50 %
Acidobacteria bacterium SCGC AG-212-P17	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium SCGC AG-212-P17	9.40 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	7.69 %
Massilia timonae	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Massilia group → Massilia → Massilia timonae	1.71 %
Acidobacteriaceae bacterium KBS 89	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium KBS 89	1.71 %
Blastocatellia bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium	1.71 %
Myxococcaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae	0.85 %
Pyrinomonadaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium	0.85 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	0.85 %
candidate division KSB1 bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division KSB1 → unclassified candidate division KSB1 → candidate division KSB1 bacterium	0.85 %
Chloroflexi bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	0.85 %
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	0.85 %
Cyanophyceae	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Cyanophyceae	0.85 %
Chloracidobacterium	genus	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Chloracidobacterium	0.85 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
3300000956\|JGI10216J12902_115225711	Not Available	518	Open in IMG/M
3300003324\|soilH2_10114092	All Organisms → cellular organisms → Bacteria	2289	Open in IMG/M
3300005093\|Ga0062594_103235973	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium KBS 89	511	Open in IMG/M
3300005290\|Ga0065712_10720628	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	538	Open in IMG/M
3300005293\|Ga0065715_10338616	All Organisms → cellular organisms → Bacteria	967	Open in IMG/M
3300005294\|Ga0065705_10596546	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium	709	Open in IMG/M
3300005330\|Ga0070690_100581785	All Organisms → cellular organisms → Bacteria → Proteobacteria	848	Open in IMG/M
3300005331\|Ga0070670_101004888	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Chloracidobacterium	759	Open in IMG/M
3300005332\|Ga0066388_104316556	All Organisms → cellular organisms → Bacteria	725	Open in IMG/M
3300005334\|Ga0068869_102099784	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium KBS 89	508	Open in IMG/M
3300005335\|Ga0070666_10691629	All Organisms → cellular organisms → Bacteria	747	Open in IMG/M
3300005338\|Ga0068868_100819694	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Massilia group → Massilia → Massilia timonae	841	Open in IMG/M
3300005338\|Ga0068868_101040387	All Organisms → cellular organisms → Bacteria	751	Open in IMG/M
3300005340\|Ga0070689_100590410	All Organisms → cellular organisms → Bacteria	961	Open in IMG/M
3300005354\|Ga0070675_102086639	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Massilia group → Massilia → Massilia timonae	522	Open in IMG/M
3300005364\|Ga0070673_100021154	All Organisms → cellular organisms → Bacteria	4709	Open in IMG/M
3300005364\|Ga0070673_100106938	All Organisms → cellular organisms → Bacteria → Acidobacteria	2314	Open in IMG/M
3300005364\|Ga0070673_101653016	All Organisms → cellular organisms → Bacteria	606	Open in IMG/M
3300005434\|Ga0070709_10607661	All Organisms → cellular organisms → Bacteria	842	Open in IMG/M
3300005435\|Ga0070714_100333670	Not Available	1421	Open in IMG/M
3300005441\|Ga0070700_100567049	All Organisms → cellular organisms → Bacteria	884	Open in IMG/M
3300005518\|Ga0070699_100306513	All Organisms → cellular organisms → Bacteria	1425	Open in IMG/M
3300005536\|Ga0070697_101713351	All Organisms → cellular organisms → Bacteria	562	Open in IMG/M
3300005539\|Ga0068853_101099115	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	767	Open in IMG/M
3300005539\|Ga0068853_101985631	All Organisms → cellular organisms → Bacteria	564	Open in IMG/M
3300005546\|Ga0070696_101732226	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	539	Open in IMG/M
3300005617\|Ga0068859_100044885	All Organisms → cellular organisms → Bacteria	4441	Open in IMG/M
3300005617\|Ga0068859_100406435	All Organisms → cellular organisms → Bacteria	1457	Open in IMG/M
3300005617\|Ga0068859_100677529	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	1122	Open in IMG/M
3300005617\|Ga0068859_101211168	All Organisms → cellular organisms → Bacteria	832	Open in IMG/M
3300005718\|Ga0068866_11305365	Not Available	527	Open in IMG/M
3300005719\|Ga0068861_100834234	All Organisms → cellular organisms → Bacteria	868	Open in IMG/M
3300005840\|Ga0068870_10206874	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1193	Open in IMG/M
3300005841\|Ga0068863_101075554	All Organisms → cellular organisms → Bacteria	808	Open in IMG/M
3300005842\|Ga0068858_100399395	All Organisms → cellular organisms → Bacteria	1321	Open in IMG/M
3300005842\|Ga0068858_102174130	Not Available	549	Open in IMG/M
3300005843\|Ga0068860_100344569	All Organisms → cellular organisms → Bacteria	1465	Open in IMG/M
3300005843\|Ga0068860_101846086	All Organisms → cellular organisms → Bacteria	626	Open in IMG/M
3300005844\|Ga0068862_100304317	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium SCGC AG-212-P17	1467	Open in IMG/M
3300005844\|Ga0068862_102081162	All Organisms → cellular organisms → Bacteria	579	Open in IMG/M
3300006237\|Ga0097621_100298745	Not Available	1422	Open in IMG/M
3300006358\|Ga0068871_101446260	Not Available	649	Open in IMG/M
3300006844\|Ga0075428_100212239	All Organisms → cellular organisms → Bacteria	2092	Open in IMG/M
3300006854\|Ga0075425_100064486	All Organisms → cellular organisms → Bacteria	4115	Open in IMG/M
3300006854\|Ga0075425_101936775	All Organisms → cellular organisms → Bacteria	660	Open in IMG/M
3300006871\|Ga0075434_100428638	All Organisms → cellular organisms → Bacteria	1344	Open in IMG/M
3300009098\|Ga0105245_10599944	All Organisms → cellular organisms → Bacteria	1127	Open in IMG/M
3300009101\|Ga0105247_10120319	All Organisms → cellular organisms → Bacteria	1700	Open in IMG/M
3300009101\|Ga0105247_10278004	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1154	Open in IMG/M
3300009101\|Ga0105247_10399337	All Organisms → cellular organisms → Bacteria	979	Open in IMG/M
3300009101\|Ga0105247_10853349	Not Available	699	Open in IMG/M
3300009148\|Ga0105243_10470379	Not Available	1184	Open in IMG/M
3300009156\|Ga0111538_12065521	Not Available	716	Open in IMG/M
3300009174\|Ga0105241_11511769	All Organisms → cellular organisms → Bacteria	646	Open in IMG/M
3300009174\|Ga0105241_12399862	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae	526	Open in IMG/M
3300009177\|Ga0105248_10351795	Not Available	1659	Open in IMG/M
3300009177\|Ga0105248_12001144	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	658	Open in IMG/M
3300009545\|Ga0105237_10243835	All Organisms → cellular organisms → Bacteria	1798	Open in IMG/M
3300009553\|Ga0105249_11075759	All Organisms → cellular organisms → Bacteria	874	Open in IMG/M
3300010360\|Ga0126372_12716447	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium	547	Open in IMG/M
3300010371\|Ga0134125_12142661	Not Available	608	Open in IMG/M
3300010397\|Ga0134124_11775336	All Organisms → cellular organisms → Bacteria	650	Open in IMG/M
3300010399\|Ga0134127_10256912	Not Available	1659	Open in IMG/M
3300010399\|Ga0134127_12818443	All Organisms → cellular organisms → Bacteria	566	Open in IMG/M
3300010400\|Ga0134122_10010804	All Organisms → cellular organisms → Bacteria	6794	Open in IMG/M
3300010400\|Ga0134122_11002000	All Organisms → cellular organisms → Bacteria	818	Open in IMG/M
3300010400\|Ga0134122_11426834	Not Available	708	Open in IMG/M
3300010400\|Ga0134122_12278515	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	587	Open in IMG/M
3300010400\|Ga0134122_13281355	All Organisms → cellular organisms → Bacteria	508	Open in IMG/M
3300010401\|Ga0134121_11757521	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales	645	Open in IMG/M
3300010403\|Ga0134123_10045990	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division KSB1 → unclassified candidate division KSB1 → candidate division KSB1 bacterium	3261	Open in IMG/M
3300010403\|Ga0134123_11997706	Not Available	638	Open in IMG/M
3300011119\|Ga0105246_11536421	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium SCGC AG-212-P17	627	Open in IMG/M
3300011333\|Ga0127502_10849931	All Organisms → cellular organisms → Bacteria	848	Open in IMG/M
3300012212\|Ga0150985_105085344	Not Available	588	Open in IMG/M
3300012896\|Ga0157303_10262006	Not Available	533	Open in IMG/M
3300012961\|Ga0164302_10875309	Not Available	687	Open in IMG/M
3300012988\|Ga0164306_11096517	Not Available	661	Open in IMG/M
3300013100\|Ga0157373_11070909	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium	604	Open in IMG/M
3300013102\|Ga0157371_10770003	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium SCGC AG-212-P17	724	Open in IMG/M
3300013297\|Ga0157378_12539003	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium SCGC AG-212-P17	564	Open in IMG/M
3300013306\|Ga0163162_13016481	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium SCGC AG-212-P17	541	Open in IMG/M
3300014326\|Ga0157380_13337007	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	513	Open in IMG/M
3300014487\|Ga0182000_10237102	Not Available	723	Open in IMG/M
3300014745\|Ga0157377_10368222	Not Available	969	Open in IMG/M
3300015371\|Ga0132258_11462993	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Cyanophyceae	1726	Open in IMG/M
3300018920\|Ga0190273_12119044	All Organisms → cellular organisms → Bacteria	525	Open in IMG/M
3300023168\|Ga0247748_1007793	All Organisms → cellular organisms → Bacteria	1379	Open in IMG/M
3300025898\|Ga0207692_10281917	Not Available	1006	Open in IMG/M
3300025900\|Ga0207710_10064461	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1669	Open in IMG/M
3300025900\|Ga0207710_10449292	Not Available	665	Open in IMG/M
3300025903\|Ga0207680_10120338	All Organisms → cellular organisms → Bacteria	1716	Open in IMG/M
3300025911\|Ga0207654_10578733	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium SCGC AG-212-P17	800	Open in IMG/M
3300025928\|Ga0207700_11740213	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium SCGC AG-212-P17	549	Open in IMG/M
3300025934\|Ga0207686_10378808	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1072	Open in IMG/M
3300025935\|Ga0207709_10686928	Not Available	818	Open in IMG/M
3300025936\|Ga0207670_10528859	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	961	Open in IMG/M
3300025936\|Ga0207670_10998664	All Organisms → cellular organisms → Bacteria	704	Open in IMG/M
3300025940\|Ga0207691_10258725	Not Available	1500	Open in IMG/M
3300025940\|Ga0207691_10787257	Not Available	800	Open in IMG/M
3300025960\|Ga0207651_10684516	Not Available	902	Open in IMG/M
3300025981\|Ga0207640_11699351	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	570	Open in IMG/M
3300026035\|Ga0207703_11401675	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium SCGC AG-212-P17	672	Open in IMG/M
3300026075\|Ga0207708_10860109	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	783	Open in IMG/M
3300026088\|Ga0207641_11396081	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium SCGC AG-212-P17	701	Open in IMG/M
3300026089\|Ga0207648_12075303	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium SCGC AG-212-P17	529	Open in IMG/M
3300026095\|Ga0207676_11050337	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	804	Open in IMG/M
3300026118\|Ga0207675_100205863	All Organisms → cellular organisms → Bacteria	1891	Open in IMG/M
3300026118\|Ga0207675_100474053	Not Available	1243	Open in IMG/M
3300026118\|Ga0207675_102752640	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium SCGC AG-212-P17	500	Open in IMG/M
3300027530\|Ga0209216_1072514	Not Available	592	Open in IMG/M
3300028380\|Ga0268265_11048495	Not Available	807	Open in IMG/M
3300028380\|Ga0268265_11197601	Not Available	757	Open in IMG/M
3300028381\|Ga0268264_10297170	All Organisms → cellular organisms → Bacteria	1519	Open in IMG/M
3300030847\|Ga0075405_11988788	Not Available	612	Open in IMG/M
3300031740\|Ga0307468_100011818	All Organisms → cellular organisms → Bacteria → Proteobacteria	3464	Open in IMG/M
3300032157\|Ga0315912_10736444	All Organisms → cellular organisms → Bacteria	785	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Host-Associated	Host-Associated	64.10%
Environmental	Environmental	35.90%

Habitat	Taxonomy	Distribution
Plants	Host-Associated → Plants	64.10%
Terrestrial	Environmental → Terrestrial	35.04%
Aquatic	Environmental → Aquatic	0.85%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	35.04%
Rhizosphere	Host-Associated → Plants → Rhizosphere	32.48%
Rhizoplane	Host-Associated → Plants → Rhizoplane	29.91%
Roots	Host-Associated → Plants → Roots	1.71%
Freshwater	Environmental → Aquatic → Freshwater	0.85%

Habitat	Taxonomy	Distribution
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	26.50%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	23.93%
Unclassified	Environmental → Terrestrial → Soil → Unclassified	22.22%
Loam	Environmental → Terrestrial → Soil → Loam	12.82%
Soil	Host-Associated → Plants → Rhizosphere → Soil	8.55%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified	3.42%
Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere	1.71%
Groundwater	Environmental → Aquatic → Freshwater → Groundwater	0.85%

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	26.50%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	23.93%
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	17.09%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	11.11%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	8.55%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified	3.42%
Agricultural Land	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land	2.56%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	1.71%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil	1.71%
Soil	Host-Associated → Plants → Roots → Rhizosphere → Soil	1.71%
Unclassified	Environmental → Aquatic → Freshwater → Groundwater → Unclassified	0.85%
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	0.85%

Habitat	Taxonomy	Distribution
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	17.95%
Terrestrial Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil	10.26%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	7.69%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	6.84%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere	5.98%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere	5.13%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	4.27%
Populus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere	4.27%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	4.27%
Switchgrass Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere	3.42%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere	3.42%
Corn Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere	2.56%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere	2.56%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere	1.71%
Miscanthus Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere	1.71%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere	1.71%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	1.71%
Soil	Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil	0.85%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	0.85%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil	0.85%
Switchgrass Rhizosphere	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere	0.85%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil	0.85%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil	0.85%
Sugarcane Root And Bulk Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil	0.85%
Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil	0.85%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	0.85%
Hardwood Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil	0.85%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil	0.85%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil	0.85%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil	0.85%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere	0.85%
Avena Fatua Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere	0.85%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	0.85%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	0.85%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300000956	Soil microbial communities from Great Prairies - Kansas, Native Prairie soil	Environmental	Open in IMG/M
3300003324	Sugarcane bulk soil Sample H2	Environmental	Open in IMG/M
3300005093	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks	Environmental	Open in IMG/M
3300005290	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1	Host-Associated	Open in IMG/M
3300005293	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1	Host-Associated	Open in IMG/M
3300005294	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil	Environmental	Open in IMG/M
3300005330	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG	Environmental	Open in IMG/M
3300005331	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG	Host-Associated	Open in IMG/M
3300005332	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)	Environmental	Open in IMG/M
3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Host-Associated	Open in IMG/M
3300005335	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG	Host-Associated	Open in IMG/M
3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Host-Associated	Open in IMG/M
3300005340	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG	Environmental	Open in IMG/M
3300005354	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG	Host-Associated	Open in IMG/M
3300005364	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG	Host-Associated	Open in IMG/M
3300005434	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG	Environmental	Open in IMG/M
3300005435	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG	Environmental	Open in IMG/M
3300005441	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG	Environmental	Open in IMG/M
3300005518	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG	Environmental	Open in IMG/M
3300005536	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG	Environmental	Open in IMG/M
3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Host-Associated	Open in IMG/M
3300005546	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG	Environmental	Open in IMG/M
3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Host-Associated	Open in IMG/M
3300005718	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2	Host-Associated	Open in IMG/M
3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Host-Associated	Open in IMG/M
3300005840	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2	Host-Associated	Open in IMG/M
3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Host-Associated	Open in IMG/M
3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Host-Associated	Open in IMG/M
3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Host-Associated	Open in IMG/M
3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Host-Associated	Open in IMG/M
3300006237	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2)	Host-Associated	Open in IMG/M
3300006358	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2	Host-Associated	Open in IMG/M
3300006844	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Host-Associated	Open in IMG/M
3300006854	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4	Host-Associated	Open in IMG/M
3300006871	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Host-Associated	Open in IMG/M
3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Host-Associated	Open in IMG/M
3300009101	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG	Host-Associated	Open in IMG/M
3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Host-Associated	Open in IMG/M
3300009156	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)	Host-Associated	Open in IMG/M
3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Host-Associated	Open in IMG/M
3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Host-Associated	Open in IMG/M
3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Host-Associated	Open in IMG/M
3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Host-Associated	Open in IMG/M
3300010360	Tropical forest soil microbial communities from Panama - MetaG Plot_6	Environmental	Open in IMG/M
3300010371	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1	Environmental	Open in IMG/M
3300010397	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4	Environmental	Open in IMG/M
3300010399	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3	Environmental	Open in IMG/M
3300010400	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2	Environmental	Open in IMG/M
3300010401	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1	Environmental	Open in IMG/M
3300010403	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3	Environmental	Open in IMG/M
3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Host-Associated	Open in IMG/M
3300011333	Cornfield soil microbial communities from Stanford, California, USA - CI-CA-CRN metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300012212	Combined assembly of Hopland grassland soil	Host-Associated	Open in IMG/M
3300012896	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S118-311C-2	Environmental	Open in IMG/M
3300012961	Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG	Environmental	Open in IMG/M
3300012988	Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG	Environmental	Open in IMG/M
3300013100	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG	Host-Associated	Open in IMG/M
3300013102	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG	Host-Associated	Open in IMG/M
3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Host-Associated	Open in IMG/M
3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Host-Associated	Open in IMG/M
3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Host-Associated	Open in IMG/M
3300014487	Bulk soil microbial communities from Mexico - Magueyal (Ma) metaG	Environmental	Open in IMG/M
3300014745	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG	Host-Associated	Open in IMG/M
3300015371	Combined assembly of cpr5 and col0 rhizosphere and soil	Host-Associated	Open in IMG/M
3300018920	Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 IS	Environmental	Open in IMG/M
3300023168	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S064-202C-5	Environmental	Open in IMG/M
3300025898	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes)	Environmental	Open in IMG/M
3300025900	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025903	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025911	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025928	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)	Environmental	Open in IMG/M
3300025934	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025936	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes)	Environmental	Open in IMG/M
3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025960	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025981	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026075	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes)	Environmental	Open in IMG/M
3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes)	Host-Associated	Open in IMG/M
3300027530	Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM2H0_O2 (SPAdes)	Environmental	Open in IMG/M
3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes)	Host-Associated	Open in IMG/M
3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes)	Host-Associated	Open in IMG/M
3300030847	Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FA10 SO (Eukaryote Community Metatranscriptome)	Environmental	Open in IMG/M
3300031740	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05	Environmental	Open in IMG/M
3300032157	Garden soil microbial communities collected in Santa Monica, California, United States - V. faba soil	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
JGI10216J12902_1152257111	3300000956	Soil	GAGAFANATGSGTITTQIDLCAGTATGTYAGTISKPNTN*
soilH2_101140921	3300003324	Sugarcane Root And Bulk Soil	STGTYIVTGGTGAFANATGSGTIATEIDECAGTARGTYTGTISRPSSG*
Ga0062594_1032359731	3300005093	Soil	SKDKCLFTSTGVYTVTGGTGAFANATGSGTIDTLTDLCAGTSTGTYSGTISRPNSN*
Ga0065712_107206282	3300005290	Miscanthus Rhizosphere	GGTGAFANATGSGIFEAQSDVCANTSSGTYTGTISRPNSN*
Ga0065715_103386162	3300005293	Miscanthus Rhizosphere	KCVVTSTGTYIVTGGAGAFANATGNGTIVTQFDLCASTATGTYTGTISKPNSN*
Ga0065705_105965462	3300005294	Switchgrass Rhizosphere	VPGGTGAFANATGGGTTFTQIDLCGDTTSGGYTGTISRPNSN*
Ga0070690_1005817852	3300005330	Switchgrass Rhizosphere	IGTYTVTGGAGAFANATGGGIFEAQADVCAGTGSGTYTGTISRPNSN*
Ga0070670_1010048883	3300005331	Switchgrass Rhizosphere	YTVTGGAGAFANATGSGTISTQIDLCANTATGTYTGTISKPNSN*
Ga0066388_1043165561	3300005332	Tropical Forest Soil	GTYIVTGGTGAFANATGSGIYEAVRDVCTSSGTHMYTGTISKPNSN*
Ga0068869_1020997841	3300005334	Miscanthus Rhizosphere	TSIGTYTVTGGTGAFANATGSGIFEAQSDVCANTSSGTYTGTISKPNLN*
Ga0070666_106916291	3300005335	Switchgrass Rhizosphere	TGGTGAFANATGSGITTTEIDQCAGTATGTYTGTISRPNSG*
Ga0068868_1008196941	3300005338	Miscanthus Rhizosphere	TSIGTYTVTGGAGAFANATGGGIFEAQADVCAGTGSGTYTGTISRPHSN*
Ga0068868_1010403871	3300005338	Miscanthus Rhizosphere	TSIGTYTVTGGAGAFANATGSGIFEAQADVCANTSSGTYTGTISRPNSN*
Ga0070689_1005904101	3300005340	Switchgrass Rhizosphere	TGGTGAFANATGSGTITTEIDQCEGTATGMYEGTISRPNSG*
Ga0070675_1020866391	3300005354	Miscanthus Rhizosphere	GTYTVTGGAGAFANATGSGTITTQIDKCAGTATGTYTGTISRPNSD*
Ga0070673_1000211544	3300005364	Switchgrass Rhizosphere	KDKCLATSTGTYTVTGGAGAFANATGSGTISTQIDLCAGTATGTYTGTISKPH*
Ga0070673_1001069384	3300005364	Switchgrass Rhizosphere	MGTYTVTSGAGAFDNATGSGPIDTEIDLGANTARGTYTGTISKPH*
Ga0070673_1016530161	3300005364	Switchgrass Rhizosphere	TGGTGAFANATGGGTFEAQSDVCAGTGSGTYTGTISRPNSN*
Ga0070709_106076612	3300005434	Corn, Switchgrass And Miscanthus Rhizosphere	TVTGGAGAFANATGSGTISTQFDLCAGTASGTYTGTISQPNSN*
Ga0070714_1003336701	3300005435	Agricultural Soil	TVTGGAGAFANATGNGTIATQFDLCAGTASGTYTGTISQPNSN*
Ga0070700_1005670492	3300005441	Corn, Switchgrass And Miscanthus Rhizosphere	YTVTGGTGAFANATGSGTISTETNLCAGTALGTFTGTISKPNSN*
Ga0070699_1003065131	3300005518	Corn, Switchgrass And Miscanthus Rhizosphere	YTVTGGTGAFANATGSGTISTQIDLCASTATGTYTGTISKPNTN*
Ga0070697_1017133511	3300005536	Corn, Switchgrass And Miscanthus Rhizosphere	GTGAFANATGSGTITTQIDQCASTATGTYTGTISQPNSN*
Ga0068853_1010991152	3300005539	Corn Rhizosphere	VSPGDKCLVTSTGIYTVTGGAGAFANATGSGTISTQFDLCAGTATGTYTGTISQPNSN*
Ga0068853_1019856312	3300005539	Corn Rhizosphere	GGTGAFANATGSGTYEAQRDVCAATGTHMYTGTFSKPNSN*
Ga0070696_1017322261	3300005546	Corn, Switchgrass And Miscanthus Rhizosphere	TITGGTGAFNNATGSGTILTVIDVCAATASGVYTGTICRPNSN*
Ga0068859_1000448851	3300005617	Switchgrass Rhizosphere	IGTYTVTGGAGAFANATGGGIFEAQADVCAGTGSGTYTGTISRPHSN*
Ga0068859_1004064352	3300005617	Switchgrass Rhizosphere	KDKCVITSTGTFTVTGGTGAFANATGGGTTFTRIDLCADTTSGAYIGTISRPNSN*
Ga0068859_1006775293	3300005617	Switchgrass Rhizosphere	TSKDKCVRTSIGTYTVTGGTGAFANATGSGIFEAQSDVCANTSSGTYTGTISRPNSN*
Ga0068859_1012111681	3300005617	Switchgrass Rhizosphere	GTYTVTGGTGAFANATGSGIFEAQRDVCVGTGSGTYTGTISKPNSN*
Ga0068866_113053651	3300005718	Miscanthus Rhizosphere	FANATGSGTIETQTDVCAGTASGIYSGTISRPHSN*
Ga0068861_1008342342	3300005719	Switchgrass Rhizosphere	TYTVTGGAGAFANATGSGTVTTQIDQCAGTATGTYMGTISRPH*
Ga0068870_102068741	3300005840	Miscanthus Rhizosphere	YTVTGGAGAFANATGSGTISTEIDLCVGTAKGTYTGTISKPNSN*
Ga0068863_1010755542	3300005841	Switchgrass Rhizosphere	GTYIVTGGTGVFANATGSGIFEAQSDVCADTSSGTYTGTISRPNSN*
Ga0068858_1003993951	3300005842	Switchgrass Rhizosphere	GGTGAFANATGSGIFEAQSDVCANTSSGTYTGTISKPNLN*
Ga0068858_1021741301	3300005842	Switchgrass Rhizosphere	YTVTGGAGAFANATGSGTIVTQFDLCTSTATGTYTGTISKPNSN*
Ga0068860_1003445694	3300005843	Switchgrass Rhizosphere	TVTGGTGAFANATGSGTISTETNLCAGTALGTFTGTISRPNSN*
Ga0068860_1018460862	3300005843	Switchgrass Rhizosphere	GAFANATGSGTIATETNLCTGSAVGTFTGTISKPNSN*
Ga0068862_1003043173	3300005844	Switchgrass Rhizosphere	YTVTGGAGAFANATGSGTIVTQFDLCTNTATGTYTGTISKPNSN*
Ga0068862_1020811622	3300005844	Switchgrass Rhizosphere	GAFANATGSGTIDTLTDLCAGTSTGTYTGTISKPNSN*
Ga0097621_1002987452	3300006237	Miscanthus Rhizosphere	TVTGGTGAFANATGGGIFEAQFDLCANTSSGTYTGTISRPNSN*
Ga0068871_1014462601	3300006358	Miscanthus Rhizosphere	TYTVTGGAGAFANATGSGTIVTQFDLCANTATGTYTGTISKPNSN*
Ga0075428_1002122393	3300006844	Populus Rhizosphere	VTGGTGAFANATGSGTITTEIDQCEGTATGIYEGTISRPNSG*
Ga0075425_1000644861	3300006854	Populus Rhizosphere	TYTVTGGTGAFANATGSGTFTAQFDLCSGTASGTFTGTISRPSSG*
Ga0075425_1019367751	3300006854	Populus Rhizosphere	TSTGTYTVTGGTGAFANATGSGIILTVTDVCAGTASGTYSGTISRPNSN*
Ga0075434_1004286383	3300006871	Populus Rhizosphere	GTGAFANATGSGTITTEIDLCAGTARGTYTGTISRPNSG*
Ga0105245_105999443	3300009098	Miscanthus Rhizosphere	VTGGAGAFADATGSGTINTQIDMCAGTATGTYTGTISKPH*
Ga0105247_101203194	3300009101	Switchgrass Rhizosphere	MGTYTVTSGAGAFDNATGSGPIDTEIDLGANTARGTYTGT
Ga0105247_102780043	3300009101	Switchgrass Rhizosphere	TSTGTYTVTGGAGAFANATGSGTISTEIDLCAGTAKGTYTGTISKPNSN*
Ga0105247_103993371	3300009101	Switchgrass Rhizosphere	AFANATGGGTTFTRIDLCADTTSGAYIGTISRPNSN*
Ga0105247_108533492	3300009101	Switchgrass Rhizosphere	GTYTVTGGAGAFDNATGSGTIDTEIDLCANTARGTYTGTISKPH*
Ga0105243_104703792	3300009148	Miscanthus Rhizosphere	AFANATGSGTISTQIDLCAGTALGIYTGTISRPNSN*
Ga0111538_120655212	3300009156	Populus Rhizosphere	TGGTGAFANATGGGIFEAQADVCAGTGSGTYTGTISKPNSN*
Ga0105241_115117691	3300009174	Corn Rhizosphere	TSTGTYTVTGGAGAFANATGSGTIVTQFDLCARTATGTYTGTISKPNSN*
Ga0105241_123998621	3300009174	Corn Rhizosphere	GAGAFANATGSGTINTQIDQCAGTASGTYTGTISKPH*
Ga0105248_103517951	3300009177	Switchgrass Rhizosphere	KCVVMSTGTYTVTGGAGAFANATGSGTIVTQFDLCANTATGTYTGTISKPNSN*
Ga0105248_120011442	3300009177	Switchgrass Rhizosphere	VVLSTGTYTVTGGAGAFANATGNGTIVTQFDLCTSTATGTYTGTISKPNSN*
Ga0105237_102438351	3300009545	Corn Rhizosphere	TGGAGAFADATGSGTINTQIDMCAGTATGTYTGTISKPH*
Ga0105249_110757591	3300009553	Switchgrass Rhizosphere	TGTYTVTGGAGAFANATGSGSIVTQFDLCARTATGTYTGTISKPNSN*
Ga0126372_127164472	3300010360	Tropical Forest Soil	TGGTGAFANATGSGIFEAQRDVCAGNGSGTYTGTISQPNSN*
Ga0134125_121426611	3300010371	Terrestrial Soil	DKCEGTSIGTYTVTGGTGAFANATGSGTFEAEFDLCANTSSGTYTGTISRPNSN*
Ga0134124_117753362	3300010397	Terrestrial Soil	YTVTGGTGAFANATGSGTITTEIDRCEGTATGTYEGPISRPNSG*
Ga0134127_102569121	3300010399	Terrestrial Soil	TGAFANATGSGTISTETNLCAGTALGTFTGTISRPNSN*
Ga0134127_128184431	3300010399	Terrestrial Soil	KDKCLFTSTGVYTVTGGTGAFANATGSGAIDTLTDLCAGTSTGTYTGTISRPNSK*
Ga0134122_100108041	3300010400	Terrestrial Soil	TVTGGTGAFANATGSGTITTEIDQCEGTATGTYEGTISRPNSG*
Ga0134122_110020001	3300010400	Terrestrial Soil	YIVTGGSGAFANATGSGTIDTQIDLCANTAKGTYTGTISKPNSN*
Ga0134122_114268342	3300010400	Terrestrial Soil	GNCLINSTGSYTITGGTGAFNNATGSRTILTTIDLCAATASGVYTGTISRPNSN*
Ga0134122_122785152	3300010400	Terrestrial Soil	TGTYTVTGGTGAFANATGSGTTFTERDECAGTGGGTYTGTISRPSSG*
Ga0134122_132813551	3300010400	Terrestrial Soil	AFANATGSGTIVTQFDLCAGTATGTYTGTISKPNLN*
Ga0134121_117575212	3300010401	Terrestrial Soil	GGTGAFANATGSGTITTEIDQCAGTATGTYEGTISRPNSG*
Ga0134123_100459904	3300010403	Terrestrial Soil	GTGAFANATGSGTISTETNLCAGTALGTFTGTISRPNSN*
Ga0134123_119977062	3300010403	Terrestrial Soil	GGTGAFANATGSGTIVTLIDLCAATATGTYTGTISRPNSN*
Ga0105246_115364211	3300011119	Miscanthus Rhizosphere	FANATGSGIFEAQSDVCADTSSGTYTGTISRPNSN*
Ga0127502_108499312	3300011333	Soil	ANATGSGTITTQIDQCAGTATGTYTGTISQPNSG*
Ga0150985_1050853441	3300012212	Avena Fatua Rhizosphere	TGAFANATGSGTFTAQADLCAGTGFGTYTGTISRPSSG*
Ga0157303_102620061	3300012896	Soil	STGTYTVTGGAGAFENATGSGTIVTQIDLCAGTASGTYAGTISKPNTN*
Ga0164302_108753091	3300012961	Soil	CVVTSTGIYTITGGAGAFANATGSGTISTQFDLCAGTATGTYTGTISQPNSN*
Ga0164306_110965172	3300012988	Soil	GTGAFANATGSGTTFTERDECADTGFGTYTGTISRPNSG*
Ga0157373_110709091	3300013100	Corn Rhizosphere	VVTSTGTYTVTGGAGAFANATGSGTISTEIDLCAGTAKGTYTGTISKPNSN*
Ga0157371_107700032	3300013102	Corn Rhizosphere	MSTGTYTVTGGAGAFANATGSGTIVTQFDLCTNTATGTYTGTISKPNSN*
Ga0157378_125390032	3300013297	Miscanthus Rhizosphere	VTGGAGAFANATGSGTINTQIDQCAGTATGTYTGTISKPNSN*
Ga0163162_130164812	3300013306	Switchgrass Rhizosphere	VVMSTGTYTVTGGAGAFANATGSGTIVTQFDLCTNTATGTYTGTISKPNSN*
Ga0157380_133370071	3300014326	Switchgrass Rhizosphere	TGGAGAFANATGSGTISTEIDLCAGTAKGTYTGTISKPNSN*
Ga0182000_102371021	3300014487	Soil	LGGAGAFANATGSGTINTQIDLCANTATGTYTGTISKPKSN*
Ga0157377_103682222	3300014745	Miscanthus Rhizosphere	VTSTGTYTVTGGAGAFDNATGSGTIDTEIDLCANTARGTYTGTISKPH*
Ga0132258_114629934	3300015371	Arabidopsis Rhizosphere	FLNATGSGTITTEIDQCAGTAKGTYTGTISKPKTN*
Ga0190273_121190442	3300018920	Soil	GGTGAFANATGSGTITTVTDQCAGTASGTYEGTISRPNSG
Ga0247748_10077933	3300023168	Soil	TYTVTGGTGAFLDATGSGIISTEIDQCAGTATGTYTGTISQPNSN
Ga0207692_102819171	3300025898	Corn, Switchgrass And Miscanthus Rhizosphere	GIYTITGGAGAFANATGSGTITTEFNLCTGTADGTYTGTISQPNSN
Ga0207710_100644614	3300025900	Switchgrass Rhizosphere	TSTGTYTVTGGAGAFANATGSGTISTEIDLCAGTAKGTYTGTISKPNSN
Ga0207710_104492921	3300025900	Switchgrass Rhizosphere	MGTYTVTSGAGAFDNATGSGPIDTEIDLGANTARGTNT
Ga0207680_101203381	3300025903	Switchgrass Rhizosphere	TGGTGAFANATGSGITTTEIDQCAGTATGTYTGTISRPNSG
Ga0207654_105787331	3300025911	Corn Rhizosphere	TGAFANATGSGIFEAQSDVCAGTGSGTYTGTISRPNSN
Ga0207700_117402132	3300025928	Corn, Switchgrass And Miscanthus Rhizosphere	FNGKSPGDKCVVTSTGTYTVTGGAGAFANATGSGTISTQFDLCAGTASGTYTGTISQPNS
Ga0207686_103788083	3300025934	Miscanthus Rhizosphere	GAGAFANATGSGTISTEIDLCAGTAKGTYTGTISKPNSN
Ga0207709_106869282	3300025935	Miscanthus Rhizosphere	TVTGGTGAFANATGSGTIDTLTDLCAGTSTGTYTGTISKPNSN
Ga0207670_105288592	3300025936	Switchgrass Rhizosphere	TGGTGAFANATGSGTITTEIDQCEGTATGMYEGTISRPNSG
Ga0207670_109986642	3300025936	Switchgrass Rhizosphere	CVLTSTGTYTVTGGTGAFANATGSGTISTEIDQCAGTATGTYEGTISRPSSG
Ga0207691_102587252	3300025940	Miscanthus Rhizosphere	KCLVTSTGTYTVTGGAGAFANATGSGSIVTQFDLCARTATGTYTGTISKPH
Ga0207691_107872571	3300025940	Miscanthus Rhizosphere	LFTSTGVYTVTGGTGAFANATGSGTIDTLTDLCAGTSTGTYSGTISRPNLN
Ga0207651_106845161	3300025960	Switchgrass Rhizosphere	CVRTSIGTYTVTGGTGAFANATGSGIFEAQSDVCANTSSGTYTGTISKPNLN
Ga0207640_116993512	3300025981	Corn Rhizosphere	STGIYTVTGGGGAFANATGSGTITTETNFCTGTASGTYSGTISKPNSN
Ga0207703_114016752	3300026035	Switchgrass Rhizosphere	CVVMSTGTYTVTGGAGAFANATGSGTIVTQFDLCTNTATGTYTGTISKPNSN
Ga0207708_108601091	3300026075	Corn, Switchgrass And Miscanthus Rhizosphere	GGAGAFANATGSGTINTQIDLCAGTATGTYTGTISKPH
Ga0207641_113960812	3300026088	Switchgrass Rhizosphere	TGTYTVTGGAGAFANATGSGTIVTQFDLCTNTATGTYTGTISKPNSN
Ga0207648_120753032	3300026089	Miscanthus Rhizosphere	TYTVTGGTGAFANATGSGIFEAQFDLCAGTGGGTYTGTISRPNSN
Ga0207676_110503373	3300026095	Switchgrass Rhizosphere	TVTGGTGAFANATGSGIFEAQSDVCANTSSGTYTGTISKPNSN
Ga0207675_1002058631	3300026118	Switchgrass Rhizosphere	GHFEGGQGNSCVVTSTGTYTVTGGAGAFANATGSGTVTTQIDQCAGTATGTYMGTISRPH
Ga0207675_1004740533	3300026118	Switchgrass Rhizosphere	FANATGSGTIDTLTDLCAGTSTGTYTGTISKPNSN
Ga0207675_1027526402	3300026118	Switchgrass Rhizosphere	FANATGSGTIVTQFDLCTNTATGTYTGTISKPNSN
Ga0209216_10725142	3300027530	Forest Soil	GTYTVVGGTGKFANATGSGIIITQFDICTLTASGIYTGTISRPNSTD
Ga0268265_110484952	3300028380	Switchgrass Rhizosphere	GAFANATGGGIFEAQADVCAGTGSGTYTGTISRPNSN
Ga0268265_111976011	3300028380	Switchgrass Rhizosphere	GTGAFVNATGSGTISTEIDQCAGTATGTYTGTISQPNAG
Ga0268264_102971701	3300028381	Switchgrass Rhizosphere	TVTGGTGAFANATGSGTISTETNLCAGTALGTFTGTISRPNSN
Ga0075405_119887881	3300030847	Soil	GIYIITGGAGAFANATGSGTIATQFDLCAGTASGTYTGTISQPNSN
Ga0307468_1000118186	3300031740	Hardwood Forest Soil	TGAFANATGSGTTFTERDECVGTGFGTYTGTISRPNSG
Ga0315912_107364441	3300032157	Soil	TGAFANATGSGTFTAQHNPCTGTGGSATYEGTISRPNSG

Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome / Metatranscriptome Family F077432

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences