NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F077447

Metagenome / Metatranscriptome Family F077447

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F077447
Family Type Metagenome / Metatranscriptome
Number of Sequences 117
Average Sequence Length 57 residues
Representative Sequence MKFKNSGNSSVQVEVISDDVEIRIGEMKWVGVAYTRDGKSKVYVRTKAEFKAKFIPVIEQAP
Number of Associated Samples 104
Number of Associated Scaffolds 117

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 37.93 %
% of genes near scaffold ends (potentially truncated) 29.06 %
% of genes from short scaffolds (< 2000 bps) 63.25 %
Associated GOLD sequencing projects 95
AlphaFold2 3D model prediction No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (94.872 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake
(18.803 % of family members)
Environment Ontology (ENVO) Unclassified
(44.444 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Water (non-saline)
(52.991 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 0.00%    β-sheet: 70.97%    Coil/Unstructured: 29.03%
Feature Viewer
Powered by Feature Viewer

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 117 Family Scaffolds
PF13481AAA_25 21.37
PF00436SSB 7.69
PF13604AAA_30 2.56
PF04851ResIII 1.71
PF04488Gly_transf_sug 0.85
PF01755Glyco_transf_25 0.85
PF02511Thy1 0.85
PF00285Citrate_synt 0.85

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 117 Family Scaffolds
COG0629Single-stranded DNA-binding proteinReplication, recombination and repair [L] 7.69
COG2965Primosomal replication protein NReplication, recombination and repair [L] 7.69
COG0372Citrate synthaseEnergy production and conversion [C] 0.85
COG1351Thymidylate synthase ThyX, FAD-dependent familyNucleotide transport and metabolism [F] 0.85
COG3306Glycosyltransferase involved in LPS biosynthesis, GR25 familyCell wall/membrane/envelope biogenesis [M] 0.85
COG3774Mannosyltransferase OCH1 or related enzymeCell wall/membrane/envelope biogenesis [M] 0.85

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms96.58 %
UnclassifiedrootN/A3.42 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000124|BS_KBA_SWE12_21mDRAFT_c10070712All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3892Open in IMG/M
3300001687|WOR8_10024564All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar35634Open in IMG/M
3300002835|B570J40625_100029387All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar38730Open in IMG/M
3300002835|B570J40625_100457912All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar31215Open in IMG/M
3300003277|JGI25908J49247_10000078All Organisms → cellular organisms → Bacteria25046Open in IMG/M
3300003277|JGI25908J49247_10032014All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar31481Open in IMG/M
3300003388|JGI25910J50241_10134602All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3653Open in IMG/M
3300003393|JGI25909J50240_1020027All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar31545Open in IMG/M
3300003394|JGI25907J50239_1089507All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3603Open in IMG/M
3300003493|JGI25923J51411_1069191All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3613Open in IMG/M
3300003860|Ga0031658_1042997All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3775Open in IMG/M
3300003860|Ga0031658_1084214All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3568Open in IMG/M
3300004481|Ga0069718_16033680All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar31482Open in IMG/M
3300004836|Ga0007759_11338649All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3666Open in IMG/M
3300005525|Ga0068877_10501438All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3671Open in IMG/M
3300005585|Ga0049084_10102829All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar31025Open in IMG/M
3300006030|Ga0075470_10044399All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar31367Open in IMG/M
3300006224|Ga0079037_102211725All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3549Open in IMG/M
3300006637|Ga0075461_10194512All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3609Open in IMG/M
3300006641|Ga0075471_10019519Not Available4036Open in IMG/M
3300006734|Ga0098073_1030725All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3756Open in IMG/M
3300006802|Ga0070749_10358762All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3809Open in IMG/M
3300006805|Ga0075464_10038445All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar32592Open in IMG/M
3300006875|Ga0075473_10032446All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar32006Open in IMG/M
3300006920|Ga0070748_1319100All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3551Open in IMG/M
3300007544|Ga0102861_1021856All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar31590Open in IMG/M
3300007544|Ga0102861_1088955All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3819Open in IMG/M
3300007636|Ga0102856_1010765All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar31271Open in IMG/M
3300007670|Ga0102862_1202034All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3516Open in IMG/M
3300007706|Ga0102899_1183725All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3525Open in IMG/M
3300007734|Ga0104986_1911All Organisms → cellular organisms → Bacteria44980Open in IMG/M
3300008110|Ga0114343_1215264All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3542Open in IMG/M
3300008266|Ga0114363_1005545All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar36429Open in IMG/M
3300008450|Ga0114880_1003280All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar38927Open in IMG/M
3300009026|Ga0102829_1145265All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3757Open in IMG/M
3300009068|Ga0114973_10204615All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar31077Open in IMG/M
3300009151|Ga0114962_10081266All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar32053Open in IMG/M
3300009152|Ga0114980_10822454All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3516Open in IMG/M
3300009152|Ga0114980_10823116All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3516Open in IMG/M
3300009160|Ga0114981_10193160All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar31117Open in IMG/M
3300009181|Ga0114969_10668422All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3562Open in IMG/M
3300009194|Ga0114983_1008543All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar33129Open in IMG/M
3300010354|Ga0129333_10007996All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar39973Open in IMG/M
3300010354|Ga0129333_10697892All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3873Open in IMG/M
3300010354|Ga0129333_10853382All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3773Open in IMG/M
3300010370|Ga0129336_10009655All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar35927Open in IMG/M
3300011011|Ga0139556_1004550All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar32037Open in IMG/M
3300011116|Ga0151516_10539All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar318383Open in IMG/M
3300017707|Ga0181363_1038383All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3885Open in IMG/M
3300017784|Ga0181348_1277331All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3570Open in IMG/M
3300019783|Ga0181361_100014All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar37424Open in IMG/M
3300019784|Ga0181359_1038282All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar31857Open in IMG/M
3300019784|Ga0181359_1197472All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3651Open in IMG/M
3300020159|Ga0211734_11038003All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar33088Open in IMG/M
3300020162|Ga0211735_10615933All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar31149Open in IMG/M
3300020498|Ga0208050_1000334All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar38009Open in IMG/M
3300020531|Ga0208487_1032612All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3604Open in IMG/M
3300020543|Ga0208089_1001667All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar35149Open in IMG/M
3300020550|Ga0208600_1038327All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3737Open in IMG/M
3300021079|Ga0194055_10119549All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar31156Open in IMG/M
3300021516|Ga0194045_1000020All Organisms → cellular organisms → Bacteria44921Open in IMG/M
3300021952|Ga0213921_1009137All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar31875Open in IMG/M
3300021956|Ga0213922_1021734All Organisms → Viruses → Predicted Viral1622Open in IMG/M
3300021961|Ga0222714_10165172All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar31312Open in IMG/M
3300021963|Ga0222712_10206121All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar31283Open in IMG/M
3300022190|Ga0181354_1000088All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar314407Open in IMG/M
3300022407|Ga0181351_1091355All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar31194Open in IMG/M
3300023174|Ga0214921_10186607All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar31324Open in IMG/M
3300024343|Ga0244777_10280904All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar31055Open in IMG/M
3300024348|Ga0244776_10051620All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar33208Open in IMG/M
3300024502|Ga0255181_1042323All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3803Open in IMG/M
3300024564|Ga0255237_1152868All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3522Open in IMG/M
3300025445|Ga0208424_1000117All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar39484Open in IMG/M
3300025635|Ga0208147_1000129All Organisms → cellular organisms → Bacteria30213Open in IMG/M
3300025635|Ga0208147_1115610All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3643Open in IMG/M
3300025732|Ga0208784_1004653All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar35068Open in IMG/M
3300025848|Ga0208005_1008871All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar33073Open in IMG/M
3300025889|Ga0208644_1013864All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar35340Open in IMG/M
3300027127|Ga0255071_1010114All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar31563Open in IMG/M
3300027365|Ga0209300_1044927All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3778Open in IMG/M
3300027538|Ga0255085_1000690All Organisms → cellular organisms → Bacteria9246Open in IMG/M
3300027649|Ga0208960_1129999All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3647Open in IMG/M
3300027688|Ga0209553_1269381All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3526Open in IMG/M
3300027708|Ga0209188_1000816All Organisms → cellular organisms → Bacteria27951Open in IMG/M
(restricted) 3300027728|Ga0247836_1012653All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar37368Open in IMG/M
3300027732|Ga0209442_1004968All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar36782Open in IMG/M
3300027732|Ga0209442_1129882All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3988Open in IMG/M
3300027733|Ga0209297_1017559All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium ADurb.BinA0143432Open in IMG/M
3300027733|Ga0209297_1059235All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar31712Open in IMG/M
3300027736|Ga0209190_1015080All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar34460Open in IMG/M
3300027754|Ga0209596_1005532Not Available9294Open in IMG/M
3300027756|Ga0209444_10001462All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar313001Open in IMG/M
3300027772|Ga0209768_10000375All Organisms → cellular organisms → Bacteria30991Open in IMG/M
3300027785|Ga0209246_10092159All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar31184Open in IMG/M
3300027798|Ga0209353_10140053All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar31082Open in IMG/M
3300027899|Ga0209668_10023968All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar33052Open in IMG/M
3300027963|Ga0209400_1101635All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar31337Open in IMG/M
(restricted) 3300028569|Ga0247843_1235776All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3671Open in IMG/M
3300031746|Ga0315293_10367619All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar31138Open in IMG/M
3300031758|Ga0315907_10343782All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar31215Open in IMG/M
3300031758|Ga0315907_10733907All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3746Open in IMG/M
3300031772|Ga0315288_11055601All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3716Open in IMG/M
3300031787|Ga0315900_10049817All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar34429Open in IMG/M
3300031857|Ga0315909_10115114All Organisms → Viruses → Predicted Viral2286Open in IMG/M
3300031951|Ga0315904_10130065All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar32589Open in IMG/M
3300031963|Ga0315901_10547219All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3891Open in IMG/M
3300032092|Ga0315905_10000447All Organisms → cellular organisms → Bacteria45274Open in IMG/M
3300032116|Ga0315903_10240755All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar31572Open in IMG/M
3300032173|Ga0315268_11728717All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3638Open in IMG/M
3300032263|Ga0316195_10176674All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar31119Open in IMG/M
3300032397|Ga0315287_11663753All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3715Open in IMG/M
3300032397|Ga0315287_12479591All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3557Open in IMG/M
3300033233|Ga0334722_10913244All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3619Open in IMG/M
3300033979|Ga0334978_0006732Not Available6208Open in IMG/M
3300034073|Ga0310130_0062667All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar31106Open in IMG/M
3300034356|Ga0335048_0596856All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3512Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake18.80%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous11.97%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake10.26%
FreshwaterEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater6.84%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine6.84%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater5.13%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment5.13%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater4.27%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater4.27%
FreshwaterEnvironmental → Aquatic → Freshwater → River → Unclassified → Freshwater3.42%
Freshwater To Marine Saline GradientEnvironmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient3.42%
Freshwater Lake SedimentEnvironmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment2.56%
Freshwater LenticEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic1.71%
Freshwater, PlanktonEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton1.71%
Anoxic Zone FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater1.71%
FreshwaterEnvironmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater1.71%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water1.71%
Deep SubsurfaceEnvironmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface1.71%
SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment0.85%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake0.85%
Freshwater WetlandsEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands0.85%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine0.85%
Marine SedimentEnvironmental → Aquatic → Marine → Oceanic → Sediment → Marine Sediment0.85%
SedimentEnvironmental → Aquatic → Marine → Coastal → Sediment → Sediment0.85%
MarineEnvironmental → Aquatic → Marine → Wetlands → Sediment → Marine0.85%
Fracking WaterEnvironmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Fracking Water0.85%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000124Marine microbial communities from chronically polluted sediments in the Baltic Sea - site KBA sample SWE 12_21mEnvironmentalOpen in IMG/M
3300001687Deep Marine Sediments WOR-3-8_10EnvironmentalOpen in IMG/M
3300002835Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605)EnvironmentalOpen in IMG/M
3300003277Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SDEnvironmentalOpen in IMG/M
3300003388Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SNEnvironmentalOpen in IMG/M
3300003393Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DDEnvironmentalOpen in IMG/M
3300003394Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SNEnvironmentalOpen in IMG/M
3300003493Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SNEnvironmentalOpen in IMG/M
3300003860Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - PLP11 PLEnvironmentalOpen in IMG/M
3300004481Combined Assembly of Gp0112041, Gp0112042, Gp0112043EnvironmentalOpen in IMG/M
3300004836Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.DN (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300005525Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel6S_1000h metaGEnvironmentalOpen in IMG/M
3300005585Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ON33MSRFEnvironmentalOpen in IMG/M
3300006030Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_<0.8_DNAEnvironmentalOpen in IMG/M
3300006224Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 4 metaGEnvironmentalOpen in IMG/M
3300006637Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_>0.8_DNAEnvironmentalOpen in IMG/M
3300006641Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_DNAEnvironmentalOpen in IMG/M
3300006734Marine viral communities from the Gulf of Mexico - 31_GoM_OMZ_CsCl metaGEnvironmentalOpen in IMG/M
3300006802Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18EnvironmentalOpen in IMG/M
3300006805Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNAEnvironmentalOpen in IMG/M
3300006875Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNAEnvironmentalOpen in IMG/M
3300006920Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12EnvironmentalOpen in IMG/M
3300007544Estuarine microbial communities from the Columbia River estuary - metaG 1449B-3EnvironmentalOpen in IMG/M
3300007636Estuarine microbial communities from the Columbia River estuary - metaG 1371A-3EnvironmentalOpen in IMG/M
3300007670Estuarine microbial communities from the Columbia River estuary - metaG 1449C-3EnvironmentalOpen in IMG/M
3300007706Estuarine microbial communities from the Columbia River estuary - metaG 1555B-3EnvironmentalOpen in IMG/M
3300007734Freshwater viral communities from Lake Soyang, Gangwon-do, South Korea - SYL_2015JanEnvironmentalOpen in IMG/M
3300008110Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-3-NAEnvironmentalOpen in IMG/M
3300008266Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NAEnvironmentalOpen in IMG/M
3300008450Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Oct 27, 2014 all contigsEnvironmentalOpen in IMG/M
3300009026Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.575EnvironmentalOpen in IMG/M
3300009068Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaGEnvironmentalOpen in IMG/M
3300009151Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaGEnvironmentalOpen in IMG/M
3300009152Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaGEnvironmentalOpen in IMG/M
3300009160Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_MF_MetaGEnvironmentalOpen in IMG/M
3300009181Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaGEnvironmentalOpen in IMG/M
3300009194Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 RTEnvironmentalOpen in IMG/M
3300010354Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNAEnvironmentalOpen in IMG/M
3300010370Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_DNAEnvironmentalOpen in IMG/M
3300011011Freshwater microbial communities from Western Basin Lake Erie, Ontario, Canada - Station 970 - Top - Depth 1mEnvironmentalOpen in IMG/M
3300011116Freshwater viral communities from Lake Soyang, Gangwon-do, South Korea - SYL_2015NovEnvironmentalOpen in IMG/M
3300017707Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MLB.S.NEnvironmentalOpen in IMG/M
3300017784Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.D.NEnvironmentalOpen in IMG/M
3300019783Freshwater viral communities from Lake Michigan, USA - Sp13.ND.MM110.S.NEnvironmentalOpen in IMG/M
3300019784Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.DEnvironmentalOpen in IMG/M
3300020159Freshwater lake microbial communities from Lake Erken, Sweden - P4710_108 megahit1EnvironmentalOpen in IMG/M
3300020162Freshwater lake microbial communities from Lake Erken, Sweden - P4710_201 megahit1EnvironmentalOpen in IMG/M
3300020498Freshwater microbial communities from Lake Mendota, WI - 13JUN2010 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300020531Freshwater microbial communities from Lake Mendota, WI - 21SEP2012 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300020543Freshwater microbial communities from Lake Mendota, WI - 29JUN2012 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300020550Freshwater microbial communities from Lake Mendota, WI - 08OCT2012 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300021079Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Sep2016-L442-9mEnvironmentalOpen in IMG/M
3300021516Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L626-11mEnvironmentalOpen in IMG/M
3300021952Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 20-17 MGEnvironmentalOpen in IMG/M
3300021956Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 29-17 MGEnvironmentalOpen in IMG/M
3300021961Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3DEnvironmentalOpen in IMG/M
3300021963Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657DEnvironmentalOpen in IMG/M
3300022190Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.NEnvironmentalOpen in IMG/M
3300022407Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.DEnvironmentalOpen in IMG/M
3300023174Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1505EnvironmentalOpen in IMG/M
3300024343Combined assembly of estuarine microbial communities from Columbia River, Washington, USA >3um size fractionEnvironmentalOpen in IMG/M
33000243480.2um to 3um size fraction coassemblyEnvironmentalOpen in IMG/M
3300024502Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Colum_RepC_8dEnvironmentalOpen in IMG/M
3300024564Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepC_8d (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300025445Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025585Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025635Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025732Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025848Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025889Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 (SPAdes)EnvironmentalOpen in IMG/M
3300027127Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Miss_RepC_8hEnvironmentalOpen in IMG/M
3300027365Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 RT (SPAdes)EnvironmentalOpen in IMG/M
3300027538Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepB_8dEnvironmentalOpen in IMG/M
3300027649Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ON33MSRF (SPAdes)EnvironmentalOpen in IMG/M
3300027688Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.DN (SPAdes)EnvironmentalOpen in IMG/M
3300027708Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_EF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027728 (restricted)Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_14mEnvironmentalOpen in IMG/M
3300027732Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.DD (SPAdes)EnvironmentalOpen in IMG/M
3300027733Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027736Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027754Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027756Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.DN (SPAdes)EnvironmentalOpen in IMG/M
3300027772Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SD (SPAdes)EnvironmentalOpen in IMG/M
3300027785Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN (SPAdes)EnvironmentalOpen in IMG/M
3300027798Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD (SPAdes)EnvironmentalOpen in IMG/M
3300027899Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - PLP11 PL (SPAdes)EnvironmentalOpen in IMG/M
3300027963Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300028569 (restricted)Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2017_8mEnvironmentalOpen in IMG/M
3300031746Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_20EnvironmentalOpen in IMG/M
3300031758Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123EnvironmentalOpen in IMG/M
3300031772Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_20EnvironmentalOpen in IMG/M
3300031787Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114EnvironmentalOpen in IMG/M
3300031857Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125EnvironmentalOpen in IMG/M
3300031951Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120EnvironmentalOpen in IMG/M
3300031963Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA116EnvironmentalOpen in IMG/M
3300032092Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA121EnvironmentalOpen in IMG/M
3300032116Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119EnvironmentalOpen in IMG/M
3300032173Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_topEnvironmentalOpen in IMG/M
3300032263Coastal sediment microbial communities from Maine, United States - Phippsburg sediment 1EnvironmentalOpen in IMG/M
3300032397Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_0EnvironmentalOpen in IMG/M
3300033233Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_bottomEnvironmentalOpen in IMG/M
3300033979Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME30Aug2017-rr0003EnvironmentalOpen in IMG/M
3300034073Fracking water microbial communities from deep shales in Oklahoma, United States - MC-6-XLEnvironmentalOpen in IMG/M
3300034356Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jun2014-rr0152EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
BS_KBA_SWE12_21mDRAFT_1007071253300000124MarineMPPKMRYKNLKNSSVQVELLSDDVEIRIGETKWAGVAYMREGKRKLYVRTKAEFNAKFALIDAKP*
WOR8_1002456453300001687Marine SedimentMKYKNSGNPSVSVEVISDDVEIRIGETKWSGVVYTREGKSKVYVRTKAEFKAKFTPVLPGDKP*
B570J40625_10002938793300002835FreshwaterVEIRIGEMKWVGIAYTRDGKPKVYVRTKAEFKAKFTPVIEQAP*
B570J40625_10045791253300002835FreshwaterMLQTMKYRNLGKSSVEVELLSDDVEIRIGETKWAGVAYMREGKSKVYVRTKAEFKAKFVLIDA
JGI25908J49247_10000078223300003277Freshwater LakeMLQTMKYRNLGNSSVEVELLSDDVEIRIGETKWAGVAYMREGKSKVYVRTKAEFKAKFVLIDAKP*
JGI25908J49247_1003201453300003277Freshwater LakeMKFKNSGNSTVQVEVISDDVEIRIGEMKWVGIAYTRDGKPKVYVRTKAEFKAKFTPVIEQAP*
JGI25910J50241_1013460233300003388Freshwater LakeKMKFKNSGNSTVQVEVISDDVEIRVGEMKWMGVAYIRDGKPKVYVRTKAEFKAKFTPVIEQAP*
JGI25909J50240_102002743300003393Freshwater LakeMKFKNSGNSTVQVEVISDDVEIRIGEMKWVGVAYIRDGKPKVYVRTKAEFKAKFTPVIEQAP*
JGI25907J50239_108950713300003394Freshwater LakeLLQVEVISDDVEIRVGEMKWMGVAYIRDGKPKVYVRTKAEFKAKFIPVIEQAP*
JGI25923J51411_106919123300003493Freshwater LakeVQVEVISDDVEIRIGEMKWVGIAYTRNGKPKVYVRTKAEFKAKFIPVIEQAP*
Ga0031658_104299723300003860Freshwater Lake SedimentMKYKNSGNPSVSVEVISDDVEIRIGETKWAGVAYMREGKSKVYVRTKAEFKAKFTPASGDKP*
Ga0031658_108421413300003860Freshwater Lake SedimentMLPKMKYKNSGNSSVEVEVLSDDVEIRIGETKWSGVVYMREGKRKLYVRTKAEFNAKFVLIDAKP*
Ga0069718_1603368033300004481SedimentMQPKMRYKNLGNSSVQVELLSDDVEIRIGETKWSGVVYMREGKRKLYVRTKAEFNAKFALIDAKP*
Ga0007759_1133864933300004836Freshwater LakeVQVEVISDDVEIRIGEMKWVGIAYTRNGKPKVYVRTKAEFKAKFTPVIEQAP*
Ga0068877_1050143813300005525Freshwater LakeKNLGNSSVQVELLSDDVEIRIGETKWAGVAYMREGKRKLYVRTKAEFNAKFALIDAKP*
Ga0049084_1010282923300005585Freshwater LenticVEIRVGEMKWMGVAYIRDGKPKVYVRTKAEFKAKFIPVIEQAP*
Ga0075470_1004439933300006030AqueousMKFRNSGNKSVEVELISDDVEIRIGETKWSGVAYVREGRSKVYVRTKAEFKAKFVPMTDATS*
Ga0079037_10221172533300006224Freshwater WetlandsTTMKFRNSGNKSVEVELISDDVEIRIGETKWQGVAYMREGKRKVYVRTKAEFKAKFVPMTDATS*
Ga0075461_1019451213300006637AqueousEVISDDVEIRIGETKWSGVVYTREGKSKVYVRTKAEFKAKFTPVLSGDKP*
Ga0075471_1001951973300006641AqueousMKYKNSGNPSVSVEVISDDVEIRIGETKWSGVVYTREGKSKVYVRTKAEFKAKFTPVLSGDKP*
Ga0098073_103072543300006734MarineMKFRNSGNKSVEVELISDDVEIRIGETKWQGVAYMREGKRKVYVRTKAEFKAKFVPMTDATS*
Ga0070749_1035876223300006802AqueousMKYKNSGNPSVSVEVISDDVEIRIGETKWAGVAYMREGKSKVYVRTKAEFKAKFTPVLSGDKP*
Ga0075464_1003844533300006805AqueousVQVEVISDDVEIRIGEMKWVGIAYTRNGKPKVYVRTKAEFEAKFTPVIEQAP*
Ga0075473_1003244633300006875AqueousMKYKNSGNPSVSVEVISDDVEIRIGETKWAGVAYMREGKPKVYVRTKAEFKAKFTPVSGDKP*
Ga0070748_131910023300006920AqueousVQVEVISDDVEIRVGEMKWMGVAYIRDGKPKVYVRTKAEFKAKFIPVIEQAP*
Ga0102861_102185613300007544EstuarineVQVEVISDDVEIRIGEMKWVGIAYTRDGKPKVYVRTKAEFKAKFTPVIEQAP*
Ga0102861_108895523300007544EstuarineVEIRVGEMKWVGVAYTRDGKSKVYVRTKAEFKAKFTPVIEQAP*
Ga0102856_101076543300007636EstuarineVQVEVISDDVEIRIGEMKWVGVAYTRDGKSKVYVRTKAEFKAKFTPVIEQAP*
Ga0102862_120203423300007670EstuarineVQVEVISDDAEIRIGEMKWVGIAYTRDGKPKVYVRTKAEFKAKFTPVIEQAP*
Ga0102899_118372523300007706EstuarineVQVEVISDDVEIRIGEMKWVGVAYTRDGKSKVYVRTKAEFKAKFIPVIEQAP*
Ga0104986_1911113300007734FreshwaterVQVEVISDDVEIRIGEMKWVGVAYTRDGKSKVYVRTKAEFKTKFIPVIEQAP*
Ga0114343_121526413300008110Freshwater, PlanktonMKYKNSGNSSVEVELLSDDVEIRIGETKWSGVVYMREGKRKLYVRTKAEFKAKFVLIDAKP*
Ga0114363_1005545113300008266Freshwater, PlanktonMLPVMGISTRRVTTMKFRNSGNKSVEVELISDDVEIRIGETKWSGVAYVREGRSKVYVRTKAEFKAKFVPMTDATS*
Ga0114880_1003280173300008450Freshwater LakeVQVEVISDDVEIRIGEMKWVGIAYTRDGKPKVYVRTKAEFEAKFTPVIEQAP*
Ga0102829_114526533300009026EstuarineVQVEVISDDVEIRIGEMKWVGIAYTRDGKPKVYVRTQAEFKAKFTPVIAQAP*
Ga0114973_1020461523300009068Freshwater LakeVQVEVISDDVEIRIGEMKWMGVAYIRDGKPKVYVRTKAEFKAKFTPVIEQAP*
Ga0114962_1008126633300009151Freshwater LakeVQVEIISDDVEIRIGEMKWVGVAYTRDGKSKVYVRTKAEFKAKFIPVIEQAP*
Ga0114980_1082245433300009152Freshwater LakeVQVEVISDDVEIRIGEMKWVGVAYTRDGKSKVYVRTKAEFKSKFIPVIEQAP*
Ga0114980_1082311613300009152Freshwater LakeVQVEIISDDVEIRIGEMKWVGVAYTRDGKSKVYVRTKAEFKAKFTPVIEQAP*
Ga0114981_1019316013300009160Freshwater LakeVISDDVEIRVGEMKWVGVAYIRDGKPKVYVRTKAEFKAKFIPVIEQAP*
Ga0114969_1066842223300009181Freshwater LakeSVQVEIISDDVEIRIGEMKWVGVAYTRDGKSKVYVRTKAEFKAKFIPVIEQAP*
Ga0114983_100854333300009194Deep SubsurfaceMKYKNSGNPSVSVEVISDDVEIRIGETKWAGVAYMREGKSKVYVRTKAEFKAKFTPVSGDKP*
Ga0129333_1000799613300010354Freshwater To Marine Saline GradientQTMKYKNSGNPSVSVEVISDDVEIRIGETKWAGVAYTREGKLKVYVRTKAEFKAKFTPVSGDKP*
Ga0129333_1069789233300010354Freshwater To Marine Saline GradientVEVELISDDVEIRIGETKWSGVAYVREGRSKVYVRTKAEFKAKFVPMTDATS*
Ga0129333_1085338223300010354Freshwater To Marine Saline GradientMLPKMKYKNSGNSSVEVELLSDDVEIRIGETKWSGVVYMREGKRKLYVRTKAEFKAKFVLIDAKP*
Ga0129336_1000965563300010370Freshwater To Marine Saline GradientMKYKNSGNPSVSVEVISDDVEIRIGETKWSGVVYTREGKSKVYVRTKAEFKAKFTPASGDKP*
Ga0139556_100455033300011011FreshwaterMKWMGVAYIRDGKPKVYVRTKAEFKAKFTPVIEQAP*
Ga0151516_1053973300011116FreshwaterMLPKMKYKNSGNSSVEVEVISDDVEIRIGETKWSGVAYVRDGKTKLYVRTKAEFKAKFVPIDAKP*
Ga0181363_103838313300017707Freshwater LakeVQVEVISDDVEIRIGEMKWVGIAYTRNGKPKVYVRTKAEFKAKFIPVI
Ga0181348_127733123300017784Freshwater LakeVQVEVISDDVEIRIGEMKWVGIAYTRNGKPKVYVRTKAEFKAKFTPVIEQAP
Ga0181361_10001463300019783Freshwater LakeMLQTMKYRNLGNSSVEVELLSDDVEIRIGETKWAGVAYMREGKSKVYVRTKAEFKAKFVLIDAKP
Ga0181359_103828213300019784Freshwater LakeSGNSTVQVEVISDDVEIRIGEMKWVGIAYTRNGKPKVYVRTKAEFKAKFIPVIEQAP
Ga0181359_119747223300019784Freshwater LakeMRYKNLGNSSVQVELLSDDVEIRIGETKWSGVVYMREGKRKLYVRTKAEFNAKFALIDAK
Ga0211734_1103800383300020159FreshwaterMLPKMKYKNSGNSSVEVEVLSDDVEIRIGETKWSGVVYMREGKRKLYVRTKAEFNAKFVLIDAKP
Ga0211735_1061593333300020162FreshwaterMKFKNSGNSSVQVEIISDDVEIRIGEMKWVGVAYTRDGKSKVYVRTKAEFKAKFIPVIEQAP
Ga0208050_100033463300020498FreshwaterMKFKNSGNSTVQVEVISDDVEIRIGEMKWVGIAYTRDGKPKVYVRTKAEFKAKFTPVIEQAP
Ga0208487_103261223300020531FreshwaterVQVEVISDDVEIRIGETKWAGVAYMREGKSKVYVRTKAEFKAKFTPVIEQAP
Ga0208089_100166753300020543FreshwaterMLQTMKYRNLGKSSVEVELLSDDVEIRIGETKWAGVAYMREGKSKVYVRTKAEFKAKFVLIDAKP
Ga0208600_103832733300020550FreshwaterMKYRNSAKSSVEVELLSDDVEIRIGETKWAGVAYMREGKSKVYVRTKAEFKAKFVLVDAK
Ga0194055_1011954923300021079Anoxic Zone FreshwaterMKFKNSGNSSVQVEVISDDVEIRVGEMKWMGVAYIRDGKPKVYVRTKAEFKAKFIPVIEQAP
Ga0194045_1000020123300021516Anoxic Zone FreshwaterVQVEVISDDVEIRIGEMKWVGVAYTRDGKSKVYVRTKAEFKAKFIPVIEQAP
Ga0213921_100913733300021952FreshwaterMKYKNSGNPSVSVEVISDDVEIRIGETKWAGVVYTREGKLKVYVRTKAEFKAKFTPVLPGDKP
Ga0213922_102173433300021956FreshwaterMRYKNLGNSSVEVELLSDDVEIRIGETKWSGVAYMREGKRKVYVRTKAEFKAKFVLIDAK
Ga0222714_1016517253300021961Estuarine WaterMKFRNSGNKSVEVELISDDVEIRIGETKWQGVAYMREGKRKVYVRTKAEFKAKFVPMTDATS
Ga0222712_1020612123300021963Estuarine WaterMRYKNSGNSSVQVEVISDDVEIRIGETKWSGVAYVRDGKTKLYVRTKAEFKAKFVPIDAK
Ga0181354_100008893300022190Freshwater LakeVQVEVISDDVEIRIGEMKWVGIAYTRNGKPKVYVRTKAEFKAKFIPVIEQAP
Ga0181351_109135513300022407Freshwater LakeMKYKNSGNPSVSVEVISDDVEIRIGETKWAGVVYTREGKSKVYVRTKAEFK
Ga0214921_1018660723300023174FreshwaterIRIGEMKWVGIAYTRNGKPKVYVRTKAEFEAKFTPVIEQAP
Ga0244777_1028090423300024343EstuarineMKFKNLENSSLQVEVISDDVEIRIGEMKWVGVAYTRDGKSKVYVRTKAEFKAKFTPVIEQAP
Ga0244776_1005162033300024348EstuarineMKFKNLENSSLQVELISDDVEIRIGEMKWVGVAYTRDGKSKVYVRTKAEFKAKFTPVIEQAP
Ga0255181_104232333300024502FreshwaterMLPGMGMSIIRGMMMKFRNSGNKSVEVELISDDVEIRIGETKWAGVAYVRDGKRKVYVRTKAEFMAKFVPMTDATS
Ga0255237_115286823300024564FreshwaterMLPKMKYKNSGNSSVEVELLSDDVEIRIGETKWSGVAYMREGKSKVYVRTKAEFKAKFVLIDAKP
Ga0208424_1000117203300025445AqueousMKYKNSGNPSVSVEVISDDVEIRIGETKWAGVAYMREGKSKVYVRTKAEFKAKFTPVLSGDKP
Ga0208546_109974823300025585AqueousMLPVMDTSINIKTTMKFRNSGNKSVEVELISDDVEIRIGETKWSGVAYVREGRSKVYVRTKAEFKAKFVPMTDATS
Ga0208147_1000129123300025635AqueousMKYKNSGNPSVSVEVISDDVEIRIGETKWAGVAYMREGKPKVYVRTKAEFKAKFTPVSGDKP
Ga0208147_111561033300025635AqueousMKYKNSGNPSVSVEVISDDVEIRIGETKWSGVVYTREGKSKVYVRTKAEFKAKFTP
Ga0208784_100465333300025732AqueousMKYKNSGNPSVSVEVISDDVEIRIGETKWAGVAYMREGKPKVYVRTKAEFKAKFTPVLSGDKP
Ga0208005_100887133300025848AqueousMKYKNSGNPSVSVEVISDDVEIRIGETKWSGVVYTREGKSKVYVRTKAEFKAKFTPVLSGDKP
Ga0208644_1013864143300025889AqueousMKYKNSGNPSVSVEVISDDVEIRIGETKWAGVVYTREGKSKVYVRTKAEFKAKFTPVLPGDKP
Ga0255071_101011433300027127FreshwaterMKYKNSGNSSVEVELLSDDVEIRIGETKWSGVAYMREGKSKVYVRTKAEFKAKFVLIDAK
Ga0209300_104492733300027365Deep SubsurfaceMKYKNSGNPSVSVEVISDDVEIRIGETKWAGVAYMREGKSKVYVRTKAEFKAKFTPVSGDKP
Ga0255085_100069013300027538FreshwaterLKMKYKNSGNSSVEVELLSDDVEIRIGETKWAGVAYMREGKSKVYVRTKAEFKAKFVLIDAKP
Ga0208960_112999933300027649Freshwater LenticMKFKNSGNSLLQVEVISDDVEIRVGEMKWMGVAYIRDGKPKVYVRTKAEFKAKFIP
Ga0209553_126938133300027688Freshwater LakeLQVEVISDDVEIRVGEMKWMGVAYIRDGKPKVYVRTKAEFKAKFTPVIEQAP
Ga0209188_1000816123300027708Freshwater LakeVQVEIISDDVEIRIGEMKWVGVAYTRDGKSKVYVRTKAEFKAKFIPVIEQAP
(restricted) Ga0247836_1012653143300027728FreshwaterMKYKNLGNSSVQVELLSDDVEIRIGETKWSGVVYMREGKRKLYVRTKAEFNAKFVLLDAK
Ga0209442_100496833300027732Freshwater LakeMKFKNSGNSLLQVEVISDDVEIRVGEMKWMGVAYIRDGKPKVYVRTKAEFKAKFIPVIEQAP
Ga0209442_112988213300027732Freshwater LakeVQVEVISDDVEIRIGEMKWVGIAYTRDGKPKVYVRAKAEFKAK
Ga0209297_101755953300027733Freshwater LakeMKFKNSGNSSVQVEVISDDVEIRIGEMKWVGVAYTRDSKSKVYVRTKAEFKAKFIPVIEQAP
Ga0209297_105923513300027733Freshwater LakeMKFKNSGNSSVQVEVISDDVEIRIGEMKWVGVAYTRDGKSKVYVRTKAEFKAKFIPVIEQAP
Ga0209190_1015080143300027736Freshwater LakeVQVEVISDDVEIRIGEMKWMGVAYIRDGKPKVYVRTKAEFKAKFTPVIEQAP
Ga0209596_100553213300027754Freshwater LakeIGEMKWVGVAYTRDGKSKVYVRTKAEFKAKFIPVIEQAP
Ga0209444_10001462113300027756Freshwater LakeMKFKNSGNSTVQVEVISDDVEIRIGEMKWVGIAYTRNGKPKVYVRTKAEFKAKFIPVIEQAP
Ga0209768_10000375153300027772Freshwater LakeLLQVEVISDDVEIRVGEMKWMGVAYIRDGKPKVYVRTKAEFKAKFIPVIEQAP
Ga0209246_1009215913300027785Freshwater LakeNSTVQVEVISDDVEIRIGEMKWVGIAYTRDGKPKVYVRAKAEFKAKFTPVIEQAP
Ga0209353_1014005313300027798Freshwater LakeGNSTVQVEVISDDVEIRIGEMKWVGIAYTRDGKPKVYVRAKAEFKAKFTPVIEQAP
Ga0209668_1002396853300027899Freshwater Lake SedimentMKYKNSGNPSVSVEVISDDVEIRIGETKWAGVAYMREGKSKVYVRTKAEFKAKFTPASGDKP
Ga0209400_110163513300027963Freshwater LakeISDDVEIRIGEMKWVGVAYTRDGKSKVYVRTKAEFKAKFIPVIEQAP
(restricted) Ga0247843_123577623300028569FreshwaterVQVELISDDVEIRIGEMKWVGVAYTRDGKSKVYVRTKAEFKAKFIPVIEQAP
Ga0315293_1036761933300031746SedimentMKWVGMAYIRDGKPKVYVRTKAEFKAKFTPVIEQAP
Ga0315907_1034378213300031758FreshwaterMRYKNLGNSSVQVELLSDDVEIRIGETKWQGVAYMREGKRKVYVRTKAEFNAKFALIDAK
Ga0315907_1073390713300031758FreshwaterMRYKNLGNSSVQVELLSDDVEIRIGETKWQGVAYMREGKRKVYVRTKAEFNAKFAPIDAK
Ga0315288_1105560113300031772SedimentGNSSLQVEVISDDVEIRIGEMKWVGMAYIRDGKPKVYVRTKAEFKAKFTPVIEQAP
Ga0315900_1004981733300031787FreshwaterVQVELLSDDVEIRIGETKWTGVAYMREGRSKVYVRTKAEFKAKFVPMLTDVTS
Ga0315909_1011511433300031857FreshwaterMKYKNLGNSSVQVELLSDDVEIRIGETKWQGVAYMREGKRKLYVRTKAEFNAKFVLLDAK
Ga0315904_1013006543300031951FreshwaterMKRYKNLGNSSVQVELLSDDVEIRIGETKWTGVAYMREGRSKVYVRTKAEFKAKFVPMLTDVTS
Ga0315901_1054721913300031963FreshwaterTMKRYKNLGNSSVQVELLSDDVEIRIGETKWTGVAYMREGRSKVYVRTKAEFKAKFVPMLTDVTS
Ga0315905_10000447593300032092FreshwaterVQVEVISDDVEIRIGEMKWVGIAYTRDGKPKVYVRTKAEFEAKFTPVIEQAP
Ga0315903_1024075553300032116FreshwaterMLPKMRYKNLGNSSVQVELLSDDVEIRIGETKWQGVAYMREGKRKVYVRTKAEFNAKFALIDAKP
Ga0315268_1172871733300032173SedimentMKFKNLENSSLQVELISDDVEIRIGEMKWVGVAYTRDGKSKVYVRTKAEFKAKFIPVIEQAP
Ga0316195_1017667443300032263SedimentMKYKNSGNPSVSVEVISDDVEIRIGETKWSGVVYTREGKSKVYVRTKAEFKAKFTPVSGDKP
Ga0315287_1166375313300032397SedimentMKFKNSGNSSLQVEVISDDVEIRIGEMKWVGMAYIRDGKPKVYVRTKAEFKAKFTPV
Ga0315287_1247959123300032397SedimentIGEMKWMGIAYIRDGKPKVYVRTKAEFKAKFTPVIEQAP
Ga0334722_1091324433300033233SedimentGEMKWVGVAYTRDGKSKVYVRTKAEFKAKFIPVIEQAP
Ga0334978_0006732_41_2263300033979FreshwaterMRYKNLGNSSVQVELLSDDVEIRIGETKWQGVAYMREGKRKLYVRTKAEFNAKFALIDAK
Ga0310130_0062667_104_2893300034073Fracking WaterMRYKNLKNSSVQVELLSDDVEIRIGETKWAGVAYMREGKRKLYVRTKAEFNVKFALIDAK
Ga0335048_0596856_299_4903300034356FreshwaterMKYKNSGNPSVSVEVISDDVEIRIGETKWAGVAYMREGKSKVYVRTKAEFKAKFTPVLPGDKP

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.