NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F077846

Metagenome / Metatranscriptome Family F077846

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F077846
Family Type Metagenome / Metatranscriptome
Number of Sequences 117
Average Sequence Length 50 residues
Representative Sequence RGEAAMTRTRWLWLPGEDGGVAVADPADLPFDIDEEPPGAAPGLRVVSG
Number of Associated Samples 108
Number of Associated Scaffolds 117

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 1.71 %
% of genes near scaffold ends (potentially truncated) 97.44 %
% of genes from short scaffolds (< 2000 bps) 93.16 %
Associated GOLD sequencing projects 103
AlphaFold2 3D model prediction Yes
3D model pTM-score0.34

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (58.974 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(27.350 % of family members)
Environment Ontology (ENVO) Unclassified
(29.060 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(36.752 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 3.90%    β-sheet: 15.58%    Coil/Unstructured: 80.52%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.34
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 117 Family Scaffolds
PF07733DNA_pol3_alpha 4.27
PF14579HHH_6 0.85
PF02811PHP 0.85

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 117 Family Scaffolds
COG0587DNA polymerase III, alpha subunitReplication, recombination and repair [L] 4.27
COG2176DNA polymerase III, alpha subunit (gram-positive type)Replication, recombination and repair [L] 4.27

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms58.97 %
UnclassifiedrootN/A41.03 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2040502001|FACENC_GAMC6GA01B2MITAll Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria564Open in IMG/M
2170459005|F1BAP7Q01ASII0All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria571Open in IMG/M
3300003219|JGI26341J46601_10058745All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1185Open in IMG/M
3300004643|Ga0062591_102805672All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia516Open in IMG/M
3300005093|Ga0062594_103147031All Organisms → cellular organisms → Bacteria517Open in IMG/M
3300005164|Ga0066815_10070466Not Available613Open in IMG/M
3300005172|Ga0066683_10689932All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria607Open in IMG/M
3300005184|Ga0066671_10433817All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia843Open in IMG/M
3300005336|Ga0070680_101430841All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia599Open in IMG/M
3300005337|Ga0070682_100915803All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales721Open in IMG/M
3300005451|Ga0066681_10922332All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia523Open in IMG/M
3300005468|Ga0070707_100816378All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia896Open in IMG/M
3300005468|Ga0070707_101154554All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria741Open in IMG/M
3300005526|Ga0073909_10068622Not Available1333Open in IMG/M
3300005539|Ga0068853_100138276All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2185Open in IMG/M
3300005545|Ga0070695_101830380All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia509Open in IMG/M
3300005564|Ga0070664_101992634All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia551Open in IMG/M
3300005598|Ga0066706_10556506All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia912Open in IMG/M
3300005617|Ga0068859_100958220Not Available939Open in IMG/M
3300005618|Ga0068864_100690325All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia996Open in IMG/M
3300005842|Ga0068858_101689590Not Available625Open in IMG/M
3300005843|Ga0068860_100747412Not Available989Open in IMG/M
3300006163|Ga0070715_10556304All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia666Open in IMG/M
3300006237|Ga0097621_100039166All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia3806Open in IMG/M
3300006358|Ga0068871_100171605All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1859Open in IMG/M
3300006755|Ga0079222_10340604Not Available1006Open in IMG/M
3300006800|Ga0066660_11217508All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia591Open in IMG/M
3300006881|Ga0068865_102212297All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia501Open in IMG/M
3300006903|Ga0075426_10660873Not Available782Open in IMG/M
3300009038|Ga0099829_10496272Not Available1013Open in IMG/M
3300009824|Ga0116219_10427306All Organisms → cellular organisms → Bacteria737Open in IMG/M
3300009839|Ga0116223_10584395All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria645Open in IMG/M
3300010326|Ga0134065_10150787All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria811Open in IMG/M
3300010362|Ga0126377_11323323Not Available793Open in IMG/M
3300010379|Ga0136449_102001498All Organisms → cellular organisms → Bacteria855Open in IMG/M
3300010398|Ga0126383_12351465All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria618Open in IMG/M
3300010401|Ga0134121_12101984All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria599Open in IMG/M
3300012357|Ga0137384_10370182Not Available1186Open in IMG/M
3300012951|Ga0164300_10006673All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3387Open in IMG/M
3300013100|Ga0157373_10946610All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria641Open in IMG/M
3300013296|Ga0157374_11607776All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia674Open in IMG/M
3300013308|Ga0157375_10691202Not Available1174Open in IMG/M
3300014325|Ga0163163_10216769All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1963Open in IMG/M
3300015356|Ga0134073_10282560Not Available585Open in IMG/M
3300015359|Ga0134085_10482608Not Available565Open in IMG/M
3300015373|Ga0132257_102295061Not Available699Open in IMG/M
3300016319|Ga0182033_10836226Not Available813Open in IMG/M
3300016341|Ga0182035_11532749All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria600Open in IMG/M
3300016387|Ga0182040_10521663Not Available952Open in IMG/M
3300016404|Ga0182037_11700565All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae → unclassified Acidimicrobiaceae → Acidimicrobiaceae bacterium562Open in IMG/M
3300017973|Ga0187780_11418079All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria512Open in IMG/M
3300018034|Ga0187863_10814886Not Available529Open in IMG/M
3300018468|Ga0066662_11201006Not Available768Open in IMG/M
3300020069|Ga0197907_10309847Not Available754Open in IMG/M
3300021178|Ga0210408_10812489Not Available732Open in IMG/M
3300021401|Ga0210393_11387540Not Available561Open in IMG/M
3300021404|Ga0210389_10931260Not Available675Open in IMG/M
3300021478|Ga0210402_11973503All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales509Open in IMG/M
3300021559|Ga0210409_10052913All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura3812Open in IMG/M
3300024245|Ga0247677_1005376Not Available1724Open in IMG/M
3300024283|Ga0247670_1113894All Organisms → cellular organisms → Bacteria503Open in IMG/M
3300024288|Ga0179589_10439248All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria601Open in IMG/M
3300024331|Ga0247668_1046807Not Available881Open in IMG/M
3300025885|Ga0207653_10340685All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria585Open in IMG/M
3300025898|Ga0207692_10918272All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria576Open in IMG/M
3300025910|Ga0207684_10008495All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales9136Open in IMG/M
3300025916|Ga0207663_11356245All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria573Open in IMG/M
3300025920|Ga0207649_10047978All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura2632Open in IMG/M
3300025928|Ga0207700_10676766Not Available920Open in IMG/M
3300025932|Ga0207690_11371287All Organisms → cellular organisms → Bacteria591Open in IMG/M
3300026035|Ga0207703_11932749All Organisms → cellular organisms → Bacteria566Open in IMG/M
3300027401|Ga0208637_1031608Not Available606Open in IMG/M
3300027882|Ga0209590_10232192Not Available1173Open in IMG/M
3300027911|Ga0209698_10491025Not Available951Open in IMG/M
3300027915|Ga0209069_10371351All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia777Open in IMG/M
3300028790|Ga0307283_10055288Not Available956Open in IMG/M
3300031544|Ga0318534_10457498Not Available731Open in IMG/M
3300031564|Ga0318573_10480674All Organisms → cellular organisms → Bacteria669Open in IMG/M
3300031708|Ga0310686_104312323Not Available1379Open in IMG/M
3300031740|Ga0307468_100466625Not Available989Open in IMG/M
3300031751|Ga0318494_10348416All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia857Open in IMG/M
3300031765|Ga0318554_10359558Not Available827Open in IMG/M
3300031765|Ga0318554_10710920All Organisms → cellular organisms → Bacteria563Open in IMG/M
3300031770|Ga0318521_10144258Not Available1348Open in IMG/M
3300031778|Ga0318498_10336618Not Available675Open in IMG/M
3300031782|Ga0318552_10498953All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria621Open in IMG/M
3300031819|Ga0318568_10018258All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura3757Open in IMG/M
3300031819|Ga0318568_10597926All Organisms → cellular organisms → Bacteria687Open in IMG/M
3300031819|Ga0318568_10695081All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia632Open in IMG/M
3300031832|Ga0318499_10265169All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria666Open in IMG/M
3300031846|Ga0318512_10465481Not Available639Open in IMG/M
3300031860|Ga0318495_10122852Not Available1170Open in IMG/M
3300031890|Ga0306925_10955844Not Available877Open in IMG/M
3300031896|Ga0318551_10023097All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → Actinomadura atramentaria2924Open in IMG/M
3300031896|Ga0318551_10633493All Organisms → cellular organisms → Bacteria618Open in IMG/M
3300031912|Ga0306921_12447408Not Available543Open in IMG/M
3300031947|Ga0310909_11459707All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria546Open in IMG/M
3300032001|Ga0306922_12192958All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria533Open in IMG/M
3300032012|Ga0310902_11070523All Organisms → cellular organisms → Bacteria563Open in IMG/M
3300032055|Ga0318575_10141404Not Available1192Open in IMG/M
3300032066|Ga0318514_10784157All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria507Open in IMG/M
3300032067|Ga0318524_10275083All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria869Open in IMG/M
3300032068|Ga0318553_10118714Not Available1358Open in IMG/M
3300032068|Ga0318553_10742607All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria513Open in IMG/M
3300032205|Ga0307472_100430578Not Available1114Open in IMG/M
3300032828|Ga0335080_10368044Not Available1548Open in IMG/M
3300032829|Ga0335070_10890629Not Available825Open in IMG/M
3300032893|Ga0335069_10845993Not Available1027Open in IMG/M
3300032954|Ga0335083_10248976Not Available1590Open in IMG/M
3300032954|Ga0335083_11480591All Organisms → cellular organisms → Bacteria516Open in IMG/M
3300032954|Ga0335083_11540158All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria503Open in IMG/M
3300032955|Ga0335076_11176185All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria650Open in IMG/M
3300033134|Ga0335073_10887474Not Available941Open in IMG/M
3300033134|Ga0335073_11249897All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria740Open in IMG/M
3300033289|Ga0310914_10396666Not Available1249Open in IMG/M
3300033290|Ga0318519_10626230All Organisms → cellular organisms → Bacteria655Open in IMG/M
3300034820|Ga0373959_0170659All Organisms → cellular organisms → Bacteria560Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil27.35%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil7.69%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere7.69%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil5.98%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil4.27%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere4.27%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil3.42%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil2.56%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil2.56%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil2.56%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil2.56%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere2.56%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds1.71%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil1.71%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil1.71%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil1.71%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere1.71%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere1.71%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.71%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland0.85%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil0.85%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.85%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil0.85%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.85%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.85%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.85%
Grass SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil0.85%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil0.85%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland0.85%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.85%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.85%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.85%
Switchgrass RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere0.85%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere0.85%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.85%
Rhizosphere SoilHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil0.85%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2040502001Soil microbial communities from sample at FACE Site 2 North Carolina CO2+EnvironmentalOpen in IMG/M
2170459005Grass soil microbial communities from Rothamsted Park, UK - July 2009 direct MP BIO1O1 lysis 0-21cmEnvironmentalOpen in IMG/M
3300003219Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3EnvironmentalOpen in IMG/M
3300004643Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3EnvironmentalOpen in IMG/M
3300005093Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All BlocksEnvironmentalOpen in IMG/M
3300005164Soil and rhizosphere microbial communities from Laval, Canada - mgLACEnvironmentalOpen in IMG/M
3300005172Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132EnvironmentalOpen in IMG/M
3300005184Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120EnvironmentalOpen in IMG/M
3300005336Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaGEnvironmentalOpen in IMG/M
3300005337Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaGEnvironmentalOpen in IMG/M
3300005451Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130EnvironmentalOpen in IMG/M
3300005468Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaGEnvironmentalOpen in IMG/M
3300005526Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1EnvironmentalOpen in IMG/M
3300005539Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2Host-AssociatedOpen in IMG/M
3300005545Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaGEnvironmentalOpen in IMG/M
3300005564Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaGHost-AssociatedOpen in IMG/M
3300005598Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155EnvironmentalOpen in IMG/M
3300005617Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2Host-AssociatedOpen in IMG/M
3300005618Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2Host-AssociatedOpen in IMG/M
3300005842Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2Host-AssociatedOpen in IMG/M
3300005843Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2Host-AssociatedOpen in IMG/M
3300006163Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaGEnvironmentalOpen in IMG/M
3300006237Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2)Host-AssociatedOpen in IMG/M
3300006358Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2Host-AssociatedOpen in IMG/M
3300006755Agricultural soil microbial communities from Georgia to study Nitrogen management - GA PlitterEnvironmentalOpen in IMG/M
3300006800Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109EnvironmentalOpen in IMG/M
3300006881Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2Host-AssociatedOpen in IMG/M
3300006903Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5Host-AssociatedOpen in IMG/M
3300009038Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaGEnvironmentalOpen in IMG/M
3300009824Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaGEnvironmentalOpen in IMG/M
3300009839Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaGEnvironmentalOpen in IMG/M
3300010326Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010379Sb_50d combined assemblyEnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300010401Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1EnvironmentalOpen in IMG/M
3300012357Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaGEnvironmentalOpen in IMG/M
3300012951Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MGEnvironmentalOpen in IMG/M
3300013100Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaGHost-AssociatedOpen in IMG/M
3300013296Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaGHost-AssociatedOpen in IMG/M
3300013308Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaGHost-AssociatedOpen in IMG/M
3300014325Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaGHost-AssociatedOpen in IMG/M
3300015356Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300015359Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09182015EnvironmentalOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300016319Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00HEnvironmentalOpen in IMG/M
3300016341Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170EnvironmentalOpen in IMG/M
3300016387Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176EnvironmentalOpen in IMG/M
3300016404Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082EnvironmentalOpen in IMG/M
3300017973Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MGEnvironmentalOpen in IMG/M
3300018034Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10EnvironmentalOpen in IMG/M
3300018468Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111EnvironmentalOpen in IMG/M
3300020069Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300021178Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-MEnvironmentalOpen in IMG/M
3300021401Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-OEnvironmentalOpen in IMG/M
3300021404Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-OEnvironmentalOpen in IMG/M
3300021478Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-MEnvironmentalOpen in IMG/M
3300021559Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-MEnvironmentalOpen in IMG/M
3300024245Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK18EnvironmentalOpen in IMG/M
3300024283Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK11EnvironmentalOpen in IMG/M
3300024288Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungalEnvironmentalOpen in IMG/M
3300024331Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK09EnvironmentalOpen in IMG/M
3300025885Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025898Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025910Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025916Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025920Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025928Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025932Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026035Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300027401Soil and rhizosphere microbial communities from Laval, Canada - mgLAC (SPAdes)EnvironmentalOpen in IMG/M
3300027882Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027911Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes)EnvironmentalOpen in IMG/M
3300027915Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes)EnvironmentalOpen in IMG/M
3300028790Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_122EnvironmentalOpen in IMG/M
3300031544Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26EnvironmentalOpen in IMG/M
3300031564Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21EnvironmentalOpen in IMG/M
3300031708FICUS49499 Metagenome Czech Republic combined assemblyEnvironmentalOpen in IMG/M
3300031740Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05EnvironmentalOpen in IMG/M
3300031751Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24EnvironmentalOpen in IMG/M
3300031765Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22EnvironmentalOpen in IMG/M
3300031770Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17EnvironmentalOpen in IMG/M
3300031778Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f24EnvironmentalOpen in IMG/M
3300031782Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20EnvironmentalOpen in IMG/M
3300031819Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21EnvironmentalOpen in IMG/M
3300031832Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f25EnvironmentalOpen in IMG/M
3300031846Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19EnvironmentalOpen in IMG/M
3300031860Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f25EnvironmentalOpen in IMG/M
3300031890Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2)EnvironmentalOpen in IMG/M
3300031896Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19EnvironmentalOpen in IMG/M
3300031912Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2)EnvironmentalOpen in IMG/M
3300031947Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000HEnvironmentalOpen in IMG/M
3300032001Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2)EnvironmentalOpen in IMG/M
3300032012Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D3EnvironmentalOpen in IMG/M
3300032055Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23EnvironmentalOpen in IMG/M
3300032066Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18EnvironmentalOpen in IMG/M
3300032067Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22EnvironmentalOpen in IMG/M
3300032068Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300032828Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4EnvironmentalOpen in IMG/M
3300032829Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3EnvironmentalOpen in IMG/M
3300032893Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1EnvironmentalOpen in IMG/M
3300032954Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2EnvironmentalOpen in IMG/M
3300032955Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5EnvironmentalOpen in IMG/M
3300033134Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2EnvironmentalOpen in IMG/M
3300033289Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108EnvironmentalOpen in IMG/M
3300033290Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15EnvironmentalOpen in IMG/M
3300034820Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2Host-AssociatedOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
FACENCE_43167602040502001SoilPGEDGGVAVADPADLPFDIDEEPPGAAPGLRVVSG
E41_015332702170459005Grass SoilPGEDGGVAVADPADLPFDIDEEPPGAVPGLRVVSG
JGI26341J46601_1005874523300003219Bog Forest SoilDGHGRLRACCAEVVADGRGEAAMTRTRWLWLPTEDGRVAVADPLDLPFDIPADLPFAGTAPALRAVSG*
Ga0062591_10280567223300004643SoilCAEITADGRGEAAMTRTRWLWLPGEDGGVAVADPADLPFDIDGEPPGTAPGLRVVSG*
Ga0062594_10314703113300005093SoilWLWLPGEDGGVAMADPADLPFDIDEEPPGAAPGLRVVSG*
Ga0066815_1007046623300005164SoilRTRWLWLPGEDGGVAVADPADLPFDIDEEPPGAAPGLRVVTG*
Ga0066683_1068993213300005172SoilEAAMTRTRWLWLPGEDGGVAVADPADLPFDVLQDPAVPALRVVSG*
Ga0066671_1043381713300005184SoilTRTRWLWLPGEDGGIAVADPADLPFDIDEEPPGAAPALRVVGG*
Ga0070680_10143084113300005336Corn RhizosphereGRGEAAMTRTRWLWLPGEDGGVAMADPADLPFDIDEEPPGAAPGLRVVSG*
Ga0070682_10091580323300005337Corn RhizosphereACCAEITADGRGEAAMTRTHWLWLPGEDGGVAMADPADLPFDIDEEPPGAASGLRVVSG*
Ga0066681_1092233213300005451SoilITADGRGEAAMTRTRWLWLPGEDGGIAVADPADLPFDIDEEPPGAAPALRVVGG*
Ga0070707_10081637823300005468Corn, Switchgrass And Miscanthus RhizosphereTRTRWLWLPGEDGGVAVADPRNLPFDLLQTPAAPALRAVSG*
Ga0070707_10115455423300005468Corn, Switchgrass And Miscanthus RhizosphereTHWLWLPGEDGGVAVADPADLPFDVLQDPPGAASALHMVSG*
Ga0073909_1006862213300005526Surface SoilWLWLPGEDGGVAVADPADLPFDALQDPAAPALRLVSG*
Ga0068853_10013827613300005539Corn RhizosphereADGRGEAAMTRTRWLWLPGEDGGVAMADPADLPFDIDEEPPGAAPGLRVVSG*
Ga0070695_10183038023300005545Corn, Switchgrass And Miscanthus RhizosphereADGRGEAAMTRTHWLWLPGEDGGVAMADPADLPFDIDEEPPGAASGLRVVSG*
Ga0070664_10199263423300005564Corn RhizosphereCCAEVTADGRGEAAMARTRWLWLPGEDGGVALADPLDLPRGLDEPAGPNGVAVALRAVGG
Ga0066706_1055650623300005598SoilEAAMTRTRWLWLPGEDGGIAVADPADLPFDIDEEPPGAAPALRVVSG*
Ga0068859_10095822023300005617Switchgrass RhizosphereAMTRTRWLWLPSEDGGVAVADPADLPFDIDEEPPGAAPGLRVVSG*
Ga0068864_10069032523300005618Switchgrass RhizosphereRLRACCAEITADGRGEAAMTRTHWLWLPGEDGGVAMADPADLPFDIDEEPPGAAPGLRVVSG*
Ga0068858_10168959013300005842Switchgrass RhizosphereLWLPGEDGGVALADPLDLPRGLDEPAGPNGVAVALRAVGG*
Ga0068860_10074741213300005843Switchgrass RhizosphereRGEAAMTRTRWLWLPGEDGGVAMADPADLPFDIDEEPPGAAPGLRVVSG*
Ga0070715_1055630423300006163Corn, Switchgrass And Miscanthus RhizosphereGRGEAAMARTRWLWLPGEDGGVALADPLDLPRGLDESAGPNGVAVALRAVGG*
Ga0097621_10003916633300006237Miscanthus RhizosphereCAEITADGRGEAAMTRTRWLWLPGEDGGVAVADPADLPFDIDEEPPGAAPGLRVVSG*
Ga0068871_10017160513300006358Miscanthus RhizosphereADGRGEAAMTRTHWLWLPGEDGGVAMADPADLPFDIDEEPPGAAPGLRVVSG*
Ga0079222_1034060413300006755Agricultural SoilEAAMTRTHWLWLPGEDGGVAMADPADLPFDIDEEPPGAASGLRVVSG*
Ga0066660_1121750823300006800SoilSCAEVAADGRGEAAMTRTRWLWLPGEDGGVAVADPGDLPFDILQDPPALHVVSR*
Ga0068865_10221229713300006881Miscanthus RhizosphereADGRGEAAMTRTRWLWLPGEDGGVAMADPADLPFDIDEEPPGAAPGLRVVGG*
Ga0075426_1066087313300006903Populus RhizosphereEAAMTRTRWLWLPGEDGGVAVADPADLPFDIDGEPPGAAPGLRVVSG*
Ga0099829_1049627223300009038Vadose Zone SoilADGRGEAAMTRTRWLWLPAEDGSVAVADPADVPFDLPAGGQPGPGRALRAVGG*
Ga0116219_1042730613300009824Peatlands SoilDGRGEAAMTRTRWLWLPAEDGRVAVADPLDLPADLPFAGTAPALRAVSG*
Ga0116223_1058439523300009839Peatlands SoilADGRGEAAMTRTRWLWLPAEDGRVAVADPLDLPFDIPADLPFAGTAPALRAVSG*
Ga0134065_1015078713300010326Grasslands SoilRACCAQVVADGRGEAAMTRTHWLWLPCEDGGVAVADPADLPFDIDEEPPGAAPGLRAVSG
Ga0126377_1132332313300010362Tropical Forest SoilRWLWLPGEDGGVAVADPADLPFDIDGEPPGAAPGLRAVSG*
Ga0136449_10200149813300010379Peatlands SoilHGRLRACCAEVVADGRGEAAMTRTRWLWLPAEDGGVAVADPLDLPADLAFGIPADLPFAGIAPALRAVSG*
Ga0126383_1235146513300010398Tropical Forest SoilADGRGEAAMARTRWLWLPGEDGGVAVADPGDLPFDVLQDPPGAAPALHAVSG*
Ga0134121_1210198413300010401Terrestrial SoilRGEAAMTRTRWLWLPGEDGGVAVAGPADLPFDIDEEPPGAAPGLRVVGG*
Ga0137384_1037018213300012357Vadose Zone SoilEITADGRGEAAMTRTRWLWLPGEDGGVAVADPADLPFDIDEEPPGAAPGLRVVSG*
Ga0164300_1000667333300012951SoilMTRTRWLWLPGEDGGVAMADPADLPFDIDEEPPGAAPGLRVVSG*
Ga0157373_1094661013300013100Corn RhizosphereHGRLRACCAEITADGRGEAAMTRTHWLWLPGEDGGVAMADPADLPFDIDEEPPGAAPGLRVVSG*
Ga0157374_1160777613300013296Miscanthus RhizosphereWLPGEDGGVATADPADLPFDIDEEPPGAAPGLRVVGG*
Ga0157375_1069120213300013308Miscanthus RhizosphereRGEAAMTRTRWLWLPGEDGGVAVADPADLPFDIDEEPPGAAPGLRVVSG*
Ga0163163_1021676923300014325Switchgrass RhizosphereRLQACCAEITADGRGEAAMTRTRWLWLPGEDGGVAVADPADLPFDIDEEPPGAAPGLRAVSG*
Ga0134073_1028256023300015356Grasslands SoilCCAQVVADGRGEAAMTRTHWLWLPGEDGGVAVADPADLPFDIDEEPPGAAPALRVVGG*
Ga0134085_1048260813300015359Grasslands SoilDGRGEAAMTRTRWLWLPGEDGGVAVADPADLPFDVLQDPAVPALRVVGG*
Ga0132257_10229506113300015373Arabidopsis RhizosphereWLWLPGEDDGVAMADPADLPFDIDEEPPGAAPGLRVVSG*
Ga0182033_1083622623300016319SoilGEAARARTRWLWLPGEDGGVALADPGDLPFDVQEPPGAAPGLRVVGG
Ga0182035_1153274923300016341SoilRLRACCAEVVADGRGEAAVTRSRWLWLPAEDGGVAVADPGDLPSDVLLDLPGAAPALRTVSG
Ga0182040_1052166313300016387SoilLPSEDGGVAVADPGDLPFDLPQDPTGAAPALHAVNG
Ga0182037_1170056513300016404SoilAEVVADGRGEAAVTRSRWLWLPAEDGGVAVADPADIPFDVPAGNRPGAVSALRAVNG
Ga0187780_1141807923300017973Tropical PeatlandGDGHGRLRACCAEVVADGRGEAAVTRTRWLWLPAEDGGVAVADPMDFPADLSFGRPAGGLPGAAPALRAVGG
Ga0187863_1081488613300018034PeatlandRGEAAMTRTRWLWLPGEDGGVALADPRDFPADLPSGVPSDRPPALRAAGE
Ga0066662_1120100613300018468Grasslands SoilACCAQVVADGRGEAAMTRSRWLWLPGEDGGVAVADPADLPFDVLQDPAVPALRVVSG
Ga0197907_1030984713300020069Corn, Switchgrass And Miscanthus RhizosphereHARLRACCAEITADGRGEAAMTRTRWLWLPGEDGGVAMADPADLPFDIDEEPPGAAPGLRVVSG
Ga0210408_1081248913300021178SoilGEAAMTRSRWLWLPGEDGGVAVADPADLPFDALQDPPGAVPALRVVSG
Ga0210393_1138754013300021401SoilGRLRACCAEVVADGRGEAAMTRTRWLWLPAEDGGIAVADPLDLPADLPFDIPAVGSADLPSASLPFARTAPALRAVNAG
Ga0210389_1093126013300021404SoilAMTRTRWLWLPGEDGGVAMADPADLPFDIDEEPPGAAPGLRVVTG
Ga0210402_1197350313300021478SoilTRSRWLWLPGEDGGVAVADPADLPFDALQDPAASALRVVSG
Ga0210409_1005291313300021559SoilWLWLPGEDGGVAVADPADLPFDALQDPPGAVPALRVVSG
Ga0247677_100537613300024245SoilADGRGEAAMARTRWLWLPGEDGGVALADPLDLPRGLDEPAGPNGVAVALRAVGG
Ga0247670_111389413300024283SoilPGEDGGVAMADPADLPFDIDEEPPGAAPGLRVVSG
Ga0179589_1043924813300024288Vadose Zone SoilVVADGRGEAAMTRTRWLWLPGEDGGVAVADPADLPFDVLQDPPGAAPALHMVSG
Ga0247668_104680723300024331SoilLWLPGEDGGVAMADPADLPFDIDEEPPGAAPGLRVVSG
Ga0207653_1034068523300025885Corn, Switchgrass And Miscanthus RhizosphereGRGEAAMTRTRWLWLPGEDGGVATADPADLPFDIDEEPPGAAPGLRVVSG
Ga0207692_1091827213300025898Corn, Switchgrass And Miscanthus RhizosphereTHWLWLPGEDGGVAMADPADLPFDIDEEPPGAAPGLRVVSG
Ga0207684_1000849583300025910Corn, Switchgrass And Miscanthus RhizosphereGRGEAAMTRTCWLWLPGEDGGVAVADPADLPFDVLQDPPGAAPALHMVSG
Ga0207663_1135624513300025916Corn, Switchgrass And Miscanthus RhizosphereGRGEAAMTRTHWLWLPGEDGGVAVADPADLPFDVLQDPPEAAPALRLVSG
Ga0207649_1004797833300025920Corn RhizosphereGRGEAAMTRTHWLWLPGEDGGVAMADPADLPFDIDEEPPGAAPGLRVVSG
Ga0207700_1067676613300025928Corn, Switchgrass And Miscanthus RhizosphereWLPGEDGGVAGADPADLPFDALQDPAAPALRVVSG
Ga0207690_1137128713300025932Corn RhizosphereVADGRGEAAMTRTRWLWLPGEDGGVAMVDPADLPFDIDEEPPGAAPGLRVVSG
Ga0207703_1193274913300026035Switchgrass RhizosphereDGRGEAAMTRTHWLWLPGEDGGVAMADPADLPFDIDEEPPGAAPGLRVVSG
Ga0208637_103160823300027401SoilRTRWLWLPGEDGGVAVADPADLPFDIDEEPPGAAPGLRVVTG
Ga0209590_1023219213300027882Vadose Zone SoilEVAADGRGEAAMTRTRWLWLPAEDGSVAVADPADVPFDLPAGGQPGPGRALRAVGG
Ga0209698_1049102513300027911WatershedsLRACCAEVVADGRGEAVMTRTRWFWLPAENGGVAVADPRDLPADFPFDVPAANLPFTRATPALRAVSAG
Ga0209069_1037135123300027915WatershedsMTRTRWLWLPGEDGGVAVADPRDLPFDIPADFPAADQPGTAPALRVVSAG
Ga0307283_1005528813300028790SoilMTRTRWLWLPGEDGGVAMADPADLPFGIDEEPPGAAPGLRVVGG
Ga0318534_1045749813300031544SoilLWLPGEDGGVAVADPGDLPFDVLRDPPGAAPALHMVNG
Ga0318573_1048067423300031564SoilEVAADGRGEAAMARTRWLWLPGEDGGVAVADPGDLPFDVLRDPPGAVPALHMVNG
Ga0310686_10431232323300031708SoilCCAEVVADGRGEAAMTRTRWLWLPAEGGGIAAADPLDLPADLPFDIPADLPSASLPFARAAPALRAVDAR
Ga0307468_10046662523300031740Hardwood Forest SoilGVIRARCAEVVADCRGAAAMSRTRWLWLPGEDGGVAMADPADLPFDIDEEPPGAAPGLRVVGG
Ga0318494_1034841613300031751SoilGEAAMARTRWLWLPSEDGGVAVADPGDLPFDLPQDPPGAAPALHAVNG
Ga0318554_1035955823300031765SoilACCAEVAADGRGEAAMVRTRWLWLPGEDGGVAVADPGDLPFDVLRDPPGAVPALHMVNG
Ga0318554_1071092023300031765SoilRLRACCAEVAADGRGEAALARTRWLWLPGEDGGVALADPGDLPFDVREPPGAAPGLRVVG
Ga0318521_1014425823300031770SoilGHGRLRACCAEVAADGRGEAAMTRTRWLWLPGEDGGVAVAGPRDLPFDIQDPPGTAPALRVVGG
Ga0318498_1033661813300031778SoilGHGRLRACYAEVAADGRGEAVVARTCWLWLPAEDGGVALADPVDLPFDIPAGDQPGTVPALRAAGG
Ga0318552_1049895323300031782SoilALARTRWLWLPGEDGGVALADPGDLPFDVREPPGAAPGLRVVGG
Ga0318568_1001825813300031819SoilAEVAADGRGEAAMTRTRWLWLPGEDGGVAVAGPRDLPFDIQDPPGTAPALRVVGG
Ga0318568_1059792613300031819SoilACCAEVAADGRGEAAMARTRWLWLPGEDGGVAVADPGDLPFDVREPPGAAPGLRVVGG
Ga0318568_1069508123300031819SoilAEVAADGRGEAAVTRTRWLWLPAEDGGVTVADPMDLPFDLPAGDLPEAAPALRVVVG
Ga0318499_1026516923300031832SoilARTRWLWLPSEDGGVAAADPGDLPSGIRQDPAAPALHAVSG
Ga0318512_1046548123300031846SoilPVHRWLWLPGEDGGVALADPGDLPFDVQEPPGAAPGLRVVGG
Ga0318495_1012285213300031860SoilLRACCAEVAADGRGEAALARTRWLWLPGEDGGVALADPGDLPFDVREPPGAAPGLRVVGG
Ga0306925_1095584423300031890SoilLRACCAEVAADGRGEAAMTRTRWLWLPGEDGGVAVAGPRDLPFDIQDPPGTAPALRVVGG
Ga0318551_1002309733300031896SoilAADGRGEAAMTRTRWLWLPGEDGGVAVAGPRDLPFDIQDPPGTAPALRVVGG
Ga0318551_1063349313300031896SoilLPGEDGGVALADPGDLPFDVREPPGAAPGLRVVGG
Ga0306921_1244740813300031912SoilAADGRGEAARARTRWLWLPSEDGGVAAADPGDLPSGIRQDPAAPALHAVSG
Ga0310909_1145970713300031947SoilEAAMARTRWLWLPGEDGGVAVADPGDLPFDVLRDPPGAVPALHMVNG
Ga0306922_1219295813300032001SoilWLWLPGEDGGVAAADPGDLPSGIRQDPAAPALHAVSG
Ga0310902_1107052313300032012SoilGRGEAAMTRSRWLWLPGEDGGVAMADPADLPFDIDEEPPGAAPGLRVVSG
Ga0318575_1014140413300032055SoilACCAEVAADGRGEAAMARTRWLWLPGEDGGVAVADPGDLPFDVLRDPPGAAPALHMVNG
Ga0318514_1078415713300032066SoilVADGRGEAAMTRSRWLWLPAEDGGLAVADPADIPFGIPAGAGPGSMSALRAVNE
Ga0318524_1027508313300032067SoilCAEVAADGRGEAALARTRWLWLPGEDGGVALADPGDLPFDVQEPPGAAPGLRVVGG
Ga0318553_1011871413300032068SoilVAADGRGEAARARTRWLWLPGEDGGVAAADPGDLPSGIRQDPAAPALHAVSG
Ga0318553_1074260723300032068SoilLWLPSEDGGVAVADPGDLPFDLPQDPPGAAPALHAVNG
Ga0307472_10043057813300032205Hardwood Forest SoilMTRTRWLWLPGEDGGVAMADPADLPFDIDEEPPGAAPGLRVVSG
Ga0335080_1036804413300032828SoilCCAEVVADGRGEAAVPRSRWLWLPAEDGSLAVADPADIPFDVPAGNRPGAVSALRAVNG
Ga0335070_1089062913300032829SoilAAMARTRWLWLPGEDGGVAVADPGDLPFDVLQDPPGAAPALRAANG
Ga0335069_1084599313300032893SoilGRGEAARAQTRWLWLPGEDGGVALADPGDLPFDVLQDPAAPALRTVSG
Ga0335083_1024897623300032954SoilCAEVAADGRGEAAMTRTRWLWLPGEDGGVAVADPGDLPFDILHDPPALRMVSG
Ga0335083_1148059123300032954SoilLWLPGEDGGVAMADPADLPFDIGGEPPGAAPGLRVVSG
Ga0335083_1154015813300032954SoilCCAKVAADGRGEASLARTRWLWLPGEDGGVALADPGDLPFDVREPPGAAPGLRVVGG
Ga0335076_1117618513300032955SoilRGEAAMARTRWLWLPGEDGGVAVPDPGDLPFDLPQDPPGAAPALHAVNG
Ga0335073_1088747413300033134SoilPGEDGGVAVADPADLPFDIDEEPPGAAPGLRAVSG
Ga0335073_1124989713300033134SoilVAADGRGAAAGARTRWLWLPGEDGGVAVADPGDLPFDLHQDPGTAPALHAVSG
Ga0310914_1039666613300033289SoilYAEVAADGRGEAVVARTCWLWLPAEDGGVALADPVDLPFDIPAGDQPGTVPALRAAGG
Ga0318519_1062623013300033290SoilGRGEAAMARTRWLWLPGEDGGVAVADPGDLPFDVLRDPPGAVPALHMVNG
Ga0373959_0170659_410_5443300034820Rhizosphere SoilMTRTHWLWLPGEDGGVAMADPADLPFDIDEEPPGAAPGLRVVSG

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.