NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F077993

Metagenome / Metatranscriptome Family F077993

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F077993
Family Type Metagenome / Metatranscriptome
Number of Sequences 117
Average Sequence Length 40 residues
Representative Sequence TFLMENRNASADDVENNIEGLCLEFERLKPYLLQMWKSRE
Number of Associated Samples 103
Number of Associated Scaffolds 117

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 1.71 %
% of genes near scaffold ends (potentially truncated) 97.44 %
% of genes from short scaffolds (< 2000 bps) 88.03 %
Associated GOLD sequencing projects 98
AlphaFold2 3D model prediction Yes
3D model pTM-score0.58

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (100.000 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland
(11.111 % of family members)
Environment Ontology (ENVO) Unclassified
(25.641 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(45.299 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 48.53%    β-sheet: 0.00%    Coil/Unstructured: 51.47%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.58
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 117 Family Scaffolds
PF05552TM_helix 62.39
PF02446Glyco_hydro_77 7.69
PF00939Na_sulph_symp 0.85
PF00912Transgly 0.85
PF07690MFS_1 0.85
PF13519VWA_2 0.85
PF01609DDE_Tnp_1 0.85
PF13229Beta_helix 0.85
PF00365PFK 0.85
PF04203Sortase 0.85
PF03547Mem_trans 0.85
PF02518HATPase_c 0.85
PF01590GAF 0.85

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 117 Family Scaffolds
COG0668Small-conductance mechanosensitive channelCell wall/membrane/envelope biogenesis [M] 62.39
COG3264Small-conductance mechanosensitive channel MscKCell wall/membrane/envelope biogenesis [M] 62.39
COG16404-alpha-glucanotransferaseCarbohydrate transport and metabolism [G] 7.69
COG02056-phosphofructokinaseCarbohydrate transport and metabolism [G] 0.85
COG0471Di- and tricarboxylate antiporterCarbohydrate transport and metabolism [G] 0.85
COG0679Predicted permease, AEC (auxin efflux carrier) familyGeneral function prediction only [R] 0.85
COG0744Penicillin-binding protein 1B/1F, peptidoglycan transglycosylase/transpeptidaseCell wall/membrane/envelope biogenesis [M] 0.85
COG1055Na+/H+ antiporter NhaD or related arsenite permeaseInorganic ion transport and metabolism [P] 0.85
COG3039Transposase and inactivated derivatives, IS5 familyMobilome: prophages, transposons [X] 0.85
COG3293TransposaseMobilome: prophages, transposons [X] 0.85
COG3385IS4 transposase InsGMobilome: prophages, transposons [X] 0.85
COG3764Sortase (surface protein transpeptidase)Cell wall/membrane/envelope biogenesis [M] 0.85
COG4953Membrane carboxypeptidase/penicillin-binding protein PbpCCell wall/membrane/envelope biogenesis [M] 0.85
COG5009Membrane carboxypeptidase/penicillin-binding proteinCell wall/membrane/envelope biogenesis [M] 0.85
COG5421TransposaseMobilome: prophages, transposons [X] 0.85
COG5433Predicted transposase YbfD/YdcC associated with H repeatsMobilome: prophages, transposons [X] 0.85
COG5659SRSO17 transposaseMobilome: prophages, transposons [X] 0.85

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms100.00 %
UnclassifiedrootN/A0.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300001356|JGI12269J14319_10361882All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria509Open in IMG/M
3300001661|JGI12053J15887_10630273All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria510Open in IMG/M
3300005353|Ga0070669_100719316All Organisms → cellular organisms → Bacteria844Open in IMG/M
3300005534|Ga0070735_10111420All Organisms → cellular organisms → Bacteria1716Open in IMG/M
3300005542|Ga0070732_10921042All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria534Open in IMG/M
3300005564|Ga0070664_100188163All Organisms → cellular organisms → Bacteria → Acidobacteria1838Open in IMG/M
3300005564|Ga0070664_100615217All Organisms → cellular organisms → Bacteria1008Open in IMG/M
3300005618|Ga0068864_101982232All Organisms → cellular organisms → Bacteria588Open in IMG/M
3300005921|Ga0070766_10195335All Organisms → cellular organisms → Bacteria1263Open in IMG/M
3300006059|Ga0075017_100325586All Organisms → cellular organisms → Bacteria1140Open in IMG/M
3300006173|Ga0070716_101683540All Organisms → cellular organisms → Bacteria523Open in IMG/M
3300006176|Ga0070765_100054345All Organisms → cellular organisms → Bacteria3284Open in IMG/M
3300006176|Ga0070765_102277776All Organisms → cellular organisms → Bacteria505Open in IMG/M
3300006354|Ga0075021_10007912All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae5686Open in IMG/M
3300006893|Ga0073928_10893402All Organisms → cellular organisms → Bacteria609Open in IMG/M
3300007265|Ga0099794_10808816All Organisms → cellular organisms → Bacteria501Open in IMG/M
3300007982|Ga0102924_1347239All Organisms → cellular organisms → Bacteria574Open in IMG/M
3300009038|Ga0099829_11475618All Organisms → cellular organisms → Bacteria562Open in IMG/M
3300009524|Ga0116225_1025998All Organisms → cellular organisms → Bacteria2952Open in IMG/M
3300009524|Ga0116225_1226300All Organisms → cellular organisms → Bacteria842Open in IMG/M
3300009545|Ga0105237_10011232All Organisms → cellular organisms → Bacteria9484Open in IMG/M
3300009547|Ga0116136_1040833All Organisms → cellular organisms → Bacteria → Acidobacteria1352Open in IMG/M
3300009617|Ga0116123_1163180All Organisms → cellular organisms → Bacteria572Open in IMG/M
3300009639|Ga0116122_1018794All Organisms → cellular organisms → Bacteria2502Open in IMG/M
3300009672|Ga0116215_1501925All Organisms → cellular organisms → Bacteria524Open in IMG/M
3300011120|Ga0150983_13064057All Organisms → cellular organisms → Bacteria1390Open in IMG/M
3300011269|Ga0137392_10973744All Organisms → cellular organisms → Bacteria697Open in IMG/M
3300012199|Ga0137383_10838969All Organisms → cellular organisms → Bacteria671Open in IMG/M
3300012202|Ga0137363_10748243All Organisms → cellular organisms → Bacteria828Open in IMG/M
3300012210|Ga0137378_10270313All Organisms → cellular organisms → Bacteria1582Open in IMG/M
3300012918|Ga0137396_10426162All Organisms → cellular organisms → Bacteria984Open in IMG/M
3300012989|Ga0164305_10673977All Organisms → cellular organisms → Bacteria841Open in IMG/M
3300014160|Ga0181517_10148027All Organisms → cellular organisms → Bacteria1321Open in IMG/M
3300014200|Ga0181526_10023325All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae4041Open in IMG/M
3300014493|Ga0182016_10357377All Organisms → cellular organisms → Bacteria876Open in IMG/M
3300015052|Ga0137411_1123992All Organisms → cellular organisms → Bacteria1433Open in IMG/M
3300017823|Ga0187818_10074612All Organisms → cellular organisms → Bacteria1460Open in IMG/M
3300017924|Ga0187820_1245763All Organisms → cellular organisms → Bacteria573Open in IMG/M
3300017930|Ga0187825_10197759All Organisms → cellular organisms → Bacteria723Open in IMG/M
3300017935|Ga0187848_10313894All Organisms → cellular organisms → Bacteria652Open in IMG/M
3300017938|Ga0187854_10174772All Organisms → cellular organisms → Bacteria962Open in IMG/M
3300017988|Ga0181520_10104669All Organisms → cellular organisms → Bacteria2413Open in IMG/M
3300018008|Ga0187888_1272233All Organisms → cellular organisms → Bacteria655Open in IMG/M
3300018016|Ga0187880_1063922All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1913Open in IMG/M
3300018020|Ga0187861_10422684All Organisms → cellular organisms → Bacteria556Open in IMG/M
3300018021|Ga0187882_1357354All Organisms → cellular organisms → Bacteria556Open in IMG/M
3300018026|Ga0187857_10526871All Organisms → cellular organisms → Bacteria529Open in IMG/M
3300018034|Ga0187863_10112160All Organisms → cellular organisms → Bacteria → Acidobacteria1525Open in IMG/M
3300018034|Ga0187863_10183659All Organisms → cellular organisms → Bacteria1165Open in IMG/M
3300018034|Ga0187863_10225971All Organisms → cellular organisms → Bacteria1041Open in IMG/M
3300018037|Ga0187883_10239097All Organisms → cellular organisms → Bacteria929Open in IMG/M
3300018042|Ga0187871_10275853All Organisms → cellular organisms → Bacteria932Open in IMG/M
3300018057|Ga0187858_10712415All Organisms → cellular organisms → Bacteria598Open in IMG/M
3300019786|Ga0182025_1018926All Organisms → cellular organisms → Bacteria973Open in IMG/M
3300019786|Ga0182025_1050259All Organisms → cellular organisms → Bacteria1212Open in IMG/M
3300020579|Ga0210407_10036787All Organisms → cellular organisms → Bacteria3641Open in IMG/M
3300020579|Ga0210407_10341890All Organisms → cellular organisms → Bacteria1170Open in IMG/M
3300020582|Ga0210395_10663237All Organisms → cellular organisms → Bacteria781Open in IMG/M
3300020583|Ga0210401_10741819All Organisms → cellular organisms → Bacteria842Open in IMG/M
3300021088|Ga0210404_10688620All Organisms → cellular organisms → Bacteria583Open in IMG/M
3300021088|Ga0210404_10914093All Organisms → cellular organisms → Bacteria502Open in IMG/M
3300021168|Ga0210406_10716243All Organisms → cellular organisms → Bacteria769Open in IMG/M
3300021406|Ga0210386_10984905All Organisms → cellular organisms → Bacteria720Open in IMG/M
3300021475|Ga0210392_10103850All Organisms → cellular organisms → Bacteria1875Open in IMG/M
3300021479|Ga0210410_10127560All Organisms → cellular organisms → Bacteria2258Open in IMG/M
3300022726|Ga0242654_10338587All Organisms → cellular organisms → Bacteria563Open in IMG/M
3300023090|Ga0224558_1246265All Organisms → cellular organisms → Bacteria514Open in IMG/M
3300025482|Ga0208715_1031376All Organisms → cellular organisms → Bacteria1000Open in IMG/M
3300025581|Ga0208355_1056124All Organisms → cellular organisms → Bacteria944Open in IMG/M
3300025924|Ga0207694_11246805All Organisms → cellular organisms → Bacteria629Open in IMG/M
3300026515|Ga0257158_1099391All Organisms → cellular organisms → Bacteria574Open in IMG/M
3300026551|Ga0209648_10707050All Organisms → cellular organisms → Bacteria550Open in IMG/M
3300026552|Ga0209577_10348564All Organisms → cellular organisms → Bacteria1091Open in IMG/M
3300026880|Ga0209623_1017990All Organisms → cellular organisms → Bacteria503Open in IMG/M
3300027164|Ga0208994_1057713All Organisms → cellular organisms → Bacteria582Open in IMG/M
3300027432|Ga0209421_1049803All Organisms → cellular organisms → Bacteria834Open in IMG/M
3300027570|Ga0208043_1138426All Organisms → cellular organisms → Bacteria640Open in IMG/M
3300027660|Ga0209736_1148882All Organisms → cellular organisms → Bacteria622Open in IMG/M
3300027667|Ga0209009_1054936All Organisms → cellular organisms → Bacteria997Open in IMG/M
3300027667|Ga0209009_1090968All Organisms → cellular organisms → Bacteria774Open in IMG/M
3300027698|Ga0209446_1076302All Organisms → cellular organisms → Bacteria855Open in IMG/M
3300027737|Ga0209038_10237202All Organisms → cellular organisms → Bacteria548Open in IMG/M
3300027846|Ga0209180_10655347All Organisms → cellular organisms → Bacteria575Open in IMG/M
3300027855|Ga0209693_10234683All Organisms → cellular organisms → Bacteria900Open in IMG/M
3300027855|Ga0209693_10332812All Organisms → cellular organisms → Bacteria738Open in IMG/M
3300027855|Ga0209693_10388750All Organisms → cellular organisms → Bacteria674Open in IMG/M
3300027889|Ga0209380_10282969All Organisms → cellular organisms → Bacteria → Proteobacteria974Open in IMG/M
3300027889|Ga0209380_10492912All Organisms → cellular organisms → Bacteria715Open in IMG/M
3300027894|Ga0209068_10006675All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus5434Open in IMG/M
3300027986|Ga0209168_10014880All Organisms → cellular organisms → Bacteria → Acidobacteria4505Open in IMG/M
3300028759|Ga0302224_10396786All Organisms → cellular organisms → Bacteria560Open in IMG/M
3300028788|Ga0302189_10412719All Organisms → cellular organisms → Bacteria529Open in IMG/M
3300028798|Ga0302222_10258036All Organisms → cellular organisms → Bacteria680Open in IMG/M
3300028863|Ga0302218_10326186All Organisms → cellular organisms → Bacteria500Open in IMG/M
3300029943|Ga0311340_10856831All Organisms → cellular organisms → Bacteria760Open in IMG/M
3300029953|Ga0311343_10143629All Organisms → cellular organisms → Bacteria → Acidobacteria2612Open in IMG/M
3300029999|Ga0311339_10989650All Organisms → cellular organisms → Bacteria789Open in IMG/M
3300030007|Ga0311338_10339145All Organisms → cellular organisms → Bacteria → Acidobacteria1641Open in IMG/M
3300030013|Ga0302178_10531589All Organisms → cellular organisms → Bacteria509Open in IMG/M
3300030051|Ga0302195_10498574All Organisms → cellular organisms → Bacteria519Open in IMG/M
3300030054|Ga0302182_10245582All Organisms → cellular organisms → Bacteria760Open in IMG/M
3300030659|Ga0316363_10191909All Organisms → cellular organisms → Bacteria855Open in IMG/M
3300031057|Ga0170834_105073593All Organisms → cellular organisms → Bacteria → Acidobacteria5171Open in IMG/M
3300031231|Ga0170824_111788610All Organisms → cellular organisms → Bacteria674Open in IMG/M
3300031236|Ga0302324_100081218All Organisms → cellular organisms → Bacteria → Acidobacteria5594Open in IMG/M
3300031715|Ga0307476_10967774All Organisms → cellular organisms → Bacteria627Open in IMG/M
3300031823|Ga0307478_10710646All Organisms → cellular organisms → Bacteria842Open in IMG/M
3300031823|Ga0307478_11648989All Organisms → cellular organisms → Bacteria529Open in IMG/M
3300031837|Ga0302315_10765882All Organisms → cellular organisms → Bacteria502Open in IMG/M
3300031962|Ga0307479_10312542All Organisms → cellular organisms → Bacteria1553Open in IMG/M
3300031962|Ga0307479_12010045All Organisms → cellular organisms → Bacteria527Open in IMG/M
3300032160|Ga0311301_11046582All Organisms → cellular organisms → Bacteria1071Open in IMG/M
3300032174|Ga0307470_11286466All Organisms → cellular organisms → Bacteria598Open in IMG/M
3300032205|Ga0307472_101200916All Organisms → cellular organisms → Bacteria724Open in IMG/M
3300032955|Ga0335076_10916680All Organisms → cellular organisms → Bacteria758Open in IMG/M
3300034125|Ga0370484_0096475All Organisms → cellular organisms → Bacteria769Open in IMG/M
3300034163|Ga0370515_0415827All Organisms → cellular organisms → Bacteria567Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland11.11%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil10.26%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa8.55%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil7.69%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil6.84%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil6.84%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil5.98%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil5.98%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog2.56%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland2.56%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment2.56%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds2.56%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil2.56%
BogEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Bog2.56%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil1.71%
Iron-Sulfur Acid SpringEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring1.71%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil1.71%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil1.71%
Untreated Peat SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil1.71%
PermafrostEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost1.71%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.71%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere1.71%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.85%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil0.85%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.85%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil0.85%
BogEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Bog0.85%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere0.85%
SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Soil0.85%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.85%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.85%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300001356Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007EnvironmentalOpen in IMG/M
3300001661Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly)EnvironmentalOpen in IMG/M
3300005353Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaGHost-AssociatedOpen in IMG/M
3300005534Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1EnvironmentalOpen in IMG/M
3300005542Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1EnvironmentalOpen in IMG/M
3300005564Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaGHost-AssociatedOpen in IMG/M
3300005618Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2Host-AssociatedOpen in IMG/M
3300005921Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6EnvironmentalOpen in IMG/M
3300006059Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012EnvironmentalOpen in IMG/M
3300006173Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaGEnvironmentalOpen in IMG/M
3300006176Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5EnvironmentalOpen in IMG/M
3300006354Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012EnvironmentalOpen in IMG/M
3300006893Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaGEnvironmentalOpen in IMG/M
3300007265Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1EnvironmentalOpen in IMG/M
3300007982Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPM 11 metaGEnvironmentalOpen in IMG/M
3300009038Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaGEnvironmentalOpen in IMG/M
3300009524Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaGEnvironmentalOpen in IMG/M
3300009545Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaGHost-AssociatedOpen in IMG/M
3300009547Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_40EnvironmentalOpen in IMG/M
3300009617Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_100EnvironmentalOpen in IMG/M
3300009639Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_40EnvironmentalOpen in IMG/M
3300009672Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_2_FS metaGEnvironmentalOpen in IMG/M
3300011120Combined assembly of Microbial Forest Soil metaTEnvironmentalOpen in IMG/M
3300011269Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaGEnvironmentalOpen in IMG/M
3300012199Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012202Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaGEnvironmentalOpen in IMG/M
3300012210Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012918Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaGEnvironmentalOpen in IMG/M
3300012989Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MGEnvironmentalOpen in IMG/M
3300014160Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_30_metaGEnvironmentalOpen in IMG/M
3300014200Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaGEnvironmentalOpen in IMG/M
3300014493Permafrost microbial communities from Stordalen Mire, Sweden - 712S2M metaGEnvironmentalOpen in IMG/M
3300015052Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300017823Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3EnvironmentalOpen in IMG/M
3300017924Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_5EnvironmentalOpen in IMG/M
3300017930Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_5EnvironmentalOpen in IMG/M
3300017935Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_40EnvironmentalOpen in IMG/M
3300017938Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_150EnvironmentalOpen in IMG/M
3300017988Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_30_metaGEnvironmentalOpen in IMG/M
3300018008Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_40EnvironmentalOpen in IMG/M
3300018016Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_40EnvironmentalOpen in IMG/M
3300018020Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_100EnvironmentalOpen in IMG/M
3300018021Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_150EnvironmentalOpen in IMG/M
3300018026Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_100EnvironmentalOpen in IMG/M
3300018034Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10EnvironmentalOpen in IMG/M
3300018037Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_10EnvironmentalOpen in IMG/M
3300018042Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_10EnvironmentalOpen in IMG/M
3300018057Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_150EnvironmentalOpen in IMG/M
3300019786Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (PacBio error correction)EnvironmentalOpen in IMG/M
3300020579Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-MEnvironmentalOpen in IMG/M
3300020582Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-OEnvironmentalOpen in IMG/M
3300020583Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-MEnvironmentalOpen in IMG/M
3300021088Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-MEnvironmentalOpen in IMG/M
3300021168Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-MEnvironmentalOpen in IMG/M
3300021406Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-OEnvironmentalOpen in IMG/M
3300021475Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-OEnvironmentalOpen in IMG/M
3300021479Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-MEnvironmentalOpen in IMG/M
3300022726Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300023090Peat soil microbial communities from Stordalen Mire, Sweden - 717 S3 20-24EnvironmentalOpen in IMG/M
3300025482Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210 shallow-092012 (SPAdes)EnvironmentalOpen in IMG/M
3300025581Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-3 deep-072012 (SPAdes)EnvironmentalOpen in IMG/M
3300025924Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026515Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-03-AEnvironmentalOpen in IMG/M
3300026551Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes)EnvironmentalOpen in IMG/M
3300026552Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes)EnvironmentalOpen in IMG/M
3300026880Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300027164Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_O3 (SPAdes)EnvironmentalOpen in IMG/M
3300027432Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O2 (SPAdes)EnvironmentalOpen in IMG/M
3300027570Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027660Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M3 (SPAdes)EnvironmentalOpen in IMG/M
3300027667Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M2 (SPAdes)EnvironmentalOpen in IMG/M
3300027698Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM2 (SPAdes)EnvironmentalOpen in IMG/M
3300027737Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM3 (SPAdes)EnvironmentalOpen in IMG/M
3300027846Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027855Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes)EnvironmentalOpen in IMG/M
3300027889Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes)EnvironmentalOpen in IMG/M
3300027894Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes)EnvironmentalOpen in IMG/M
3300027986Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300028759Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_1EnvironmentalOpen in IMG/M
3300028788Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_E2_2EnvironmentalOpen in IMG/M
3300028798Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E2_2EnvironmentalOpen in IMG/M
3300028863Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E1_1EnvironmentalOpen in IMG/M
3300029943I_Palsa_N3 coassemblyEnvironmentalOpen in IMG/M
3300029953II_Bog_E3 coassemblyEnvironmentalOpen in IMG/M
3300029999I_Palsa_E3 coassemblyEnvironmentalOpen in IMG/M
3300030007I_Palsa_E1 coassemblyEnvironmentalOpen in IMG/M
3300030013Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_3EnvironmentalOpen in IMG/M
3300030051Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N1_2EnvironmentalOpen in IMG/M
3300030054Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_1EnvironmentalOpen in IMG/M
3300030659Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG (v2)EnvironmentalOpen in IMG/M
3300031057Oak Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031231Coassembly Site 11 (all samples) - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031236Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1EnvironmentalOpen in IMG/M
3300031715Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05EnvironmentalOpen in IMG/M
3300031823Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05EnvironmentalOpen in IMG/M
3300031837Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N3_1EnvironmentalOpen in IMG/M
3300031962Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515EnvironmentalOpen in IMG/M
3300032160Sb_50d combined assembly (MetaSPAdes)EnvironmentalOpen in IMG/M
3300032174Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300032955Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5EnvironmentalOpen in IMG/M
3300034125Peat soil microbial communities from wetlands in Alaska, United States - Sheep_creek_tus_01_15EnvironmentalOpen in IMG/M
3300034163Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_04D_14EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI12269J14319_1036188213300001356Peatlands SoilENRNASADGVEKNIEALCLEFERLKPYLLELWKSRE*
JGI12053J15887_1063027313300001661Forest SoilTFLVENRDTSSKDVENEIENLCLEFERLKAYLLEMWNGRK*
Ga0070669_10071931623300005353Switchgrass RhizosphereLFRGRVLTFLIENRNGSAEDVESSVENLCLEFERLKPHLLELWK*
Ga0070735_1011142013300005534Surface SoilTENRTASAANVEDDIEALCLEFERMKPYLREIWNGRE*
Ga0070732_1092104223300005542Surface SoilGRVFTFVVENRNGSANDVANHIEGLCLEFERLKPYLLEMWESKE*
Ga0070664_10018816313300005564Corn RhizosphereSSESEIEQHIESLCQTFERLKPYLLELWATGQGGS*
Ga0070664_10061521733300005564Corn RhizosphereLVENRTASAAEVGNNIESLCLEFERLKPYLLELWNGRK*
Ga0068864_10198223223300005618Switchgrass RhizosphereRIFTFLVENRIGSAQDVENSVELLCCEFERQKPYLLELWEGERVRT*
Ga0070766_1019533533300005921SoilGRMFTFLMENRNASAGDVENNIEALCLEFERLKPYLLQLWKS*
Ga0075017_10032558633300006059WatershedsNRNGSAADVEDNIEGLSLEFERMKPYLLEIWNGRE*
Ga0070716_10168354013300006173Corn, Switchgrass And Miscanthus RhizosphereFLIENRNSSADEVEQHIEELCLEFERLKPDLLQVWKSRE*
Ga0070765_10005434513300006176SoilVENRNSSADLVENNIENLCLEFERLKPYLLQMWNGGK*
Ga0070765_10227777623300006176SoilNRNGSADDVENNIEGLCLEFERMKPYLLQIWNGRE*
Ga0075021_1000791213300006354WatershedsRALTFLLQNNQGSSDDVVNNIETLCLEFERLKPYLLEKMEL*
Ga0073928_1089340213300006893Iron-Sulfur Acid SpringGRAFTFLTENRNASAGDVENNIEALCLEFERLKPYLLQMWKSRE*
Ga0099794_1080881623300007265Vadose Zone SoilMENRNASADDVENNIEGLCLEFERLKPYLLQMWKSRE*
Ga0102924_134723913300007982Iron-Sulfur Acid SpringLSENRTGSANDVENNIEGLCLEFERLKPYLLEMWKSRE*
Ga0099829_1147561813300009038Vadose Zone SoilENRSSSAEEVEKNIESLCIEFERLKPYLLEVWNTKK*
Ga0116225_102599813300009524Peatlands SoilAFTFLVENRNGSAANVEDDIEALCLEFERLKPYLLKIWNGRE*
Ga0116225_122630013300009524Peatlands SoilNRNSSAAEVGAHIESLCLEFERLKPYLLEMWTGRE*
Ga0105237_1001123283300009545Corn RhizosphereGRVLTFLIENRNGSAEDVESSVENLCLEFERLKPHLLELWK*
Ga0116136_104083333300009547PeatlandENRNASADDVENNIEGLCLEFERLKPYLLQLWKSRE*
Ga0116123_116318013300009617PeatlandFLVENRNASADDVENNIEGLCLEFERLKPYLLQLWKSRE*
Ga0116122_101879433300009639PeatlandGRVLAFLMEHRNGSAEDVENGIESLCLEFERLKPYLLQMWKSRE*
Ga0116215_150192523300009672Peatlands SoilGRAFTFLLENRNSSAAEVEAHIESLCLEFERLKPYLLEMWTGRE*
Ga0150983_1306405733300011120Forest SoilGRVFTFVLENRNGSASDVANHIEDLCLEFERLKPYLLEIWKSKQ*
Ga0137392_1097374423300011269Vadose Zone SoilVENRSGSANDVANNIEGVCLEFERLKPYLIEMWKSKE*
Ga0137383_1083896923300012199Vadose Zone SoilFVVENRNGSANDVANNIESLCLEFERLKPYLLEIWKSKQ*
Ga0137363_1074824313300012202Vadose Zone SoilGRAFTFLMDNRNASADEVENNIELLCLEFERLKPYLLQLWKSRE*
Ga0137378_1027031333300012210Vadose Zone SoilVCTFLIENRNATANDVENNIGALCLEFERLKPDLLQMWKSRE*
Ga0137396_1042616213300012918Vadose Zone SoilRDASANDVENNIGSLCLEFERLKPYLLEMWNGRK*
Ga0164305_1067397723300012989SoilRQGSAEDIERHVENLCLEFERLKPYLLAMWTTGK*
Ga0181517_1014802723300014160BogRVFTFLTENRNVSADDVENNIEGLCLEFERLKPYLLQLWETR*
Ga0181526_1002332553300014200BogVFTFLTENRNVSADDVENNIEGLCLEFERLKPYLLQLWETR*
Ga0182016_1035737723300014493BogFRGRAFTFLMENRNSSAQDVENNIEGLCLEFERLKPYLLQLWKSGE*
Ga0137411_112399243300015052Vadose Zone SoilRNGSANDVENNLEGLCLEFERLKPYLLEMWKSRE*
Ga0187818_1007461213300017823Freshwater SedimentLFRGRVFTFVVENRNGSAAAVENNIEGLCLEFERMKPYLLEIWNGRE
Ga0187820_124576313300017924Freshwater SedimentLFRGRVFTFVVENRNGSANDIANNIEGLCLEFERLKPYLLEMWKSKE
Ga0187825_1019775923300017930Freshwater SedimentAYSFLVENRNAGELAVENHIESLCLDFERLKPYLLQRWSSRE
Ga0187848_1031389413300017935PeatlandVIENRNASADEVEKNIEALCLEFERLKPYLLQLWKSRE
Ga0187854_1017477233300017938PeatlandFLMENRNASADDVENNIEGLCLEFERLKPYLLQLWKSRE
Ga0181520_1010466913300017988BogGRVFTLVIENRNASADDVENNIEGLCLEFERLKPYLLQLWESRE
Ga0187888_127223313300018008PeatlandFLVENRNASADDVENNIEGLCLEFERLKPYLLQLWKSRE
Ga0187880_106392243300018016PeatlandFVIENRNASADDVENNIEALCLEFERLKPYLLQLWKSRE
Ga0187861_1042268413300018020PeatlandNRNASADDVENNIEGLCLEFERLKPYLLQMWDSRE
Ga0187882_135735423300018021PeatlandRVFTFLVENRNASADDVENNIEGLCLEFERLKPYLLQLWKSRE
Ga0187857_1052687113300018026PeatlandLMENRNASADDVENNIEGLCLEFERLKPYLLQLWKSRE
Ga0187863_1011216033300018034PeatlandFLVENRNASEDEVENNIEGLCLEFERLKPYLLQLWESRE
Ga0187863_1018365913300018034PeatlandVFTFLMENRNASADEVENNIEGLCLEFERLKPYLLQMWESRE
Ga0187863_1022597113300018034PeatlandRGRVFTFLMENRNASADKVENNIEGLCLEFERLKPYLLEMWKSRE
Ga0187883_1023909723300018037PeatlandLAENINGSAADVENNIESLCLEFERTKPYLLEIWKQ
Ga0187871_1027585313300018042PeatlandRENRNASEEAIEQNIEGLCLEFERLKPYLLQLWKTRE
Ga0187858_1071241523300018057PeatlandFTFLVENRNASADDVENNIEGLCLEFERLKPYLLQLWKSRE
Ga0182025_101892633300019786PermafrostFLMENRNGSAADVETNIEGLCLEFERLKPYLLQKWKSRE
Ga0182025_105025913300019786PermafrostNRNGSAADVENNIEGLCLEFERLKPYLLQKWKSRE
Ga0210407_1003678713300020579SoilENRNASADDVENNIEGLCLEFERLKPYLLQMWKSRE
Ga0210407_1034189023300020579SoilNRNGSAEDLENNIEGLCLEFERWKPYLLQMWKSRE
Ga0210395_1066323723300020582SoilNRTGSANDVENNIEGLCLEFERLKPYLLDLWKSRE
Ga0210401_1074181923300020583SoilNRNSSADRVEANIESLCLEFERLKPYLLEMWSGKK
Ga0210404_1068862023300021088SoilTFLMENRNASADDVENNIEGLCLEFERLKPYLLQMWKSRE
Ga0210404_1091409313300021088SoilFRGRALTFLIENRNGSADDVENNIEGLCLEFERLKPYLLQLWKSRE
Ga0210406_1071624323300021168SoilMFTFLMENRDASANDVENNIEGLCLEFERLKPYLLQMWKPRE
Ga0210386_1098490523300021406SoilGRVFTFIVENRNGSANDVAKNIEGLCLEFERLKPYLLDIWKSKE
Ga0210392_1010385013300021475SoilNRNVSAGDVEKNVEDLCLEFERLKPYLLQLWKTRE
Ga0210410_1012756053300021479SoilNHNGSTDDIEDNIEGLCLEFERMKPYLLEIWNARE
Ga0242654_1033858723300022726SoilGRVFTFVVENRSGSANDVANNIEGLCLEFERLKPYLLEMWKSKE
Ga0224558_124626523300023090SoilLTENREASAEDVENNIEGLCLEFERLKPYLLQLWKSRE
Ga0208715_103137633300025482Arctic Peat SoilTFVVENRNSSANDVANNIEGLCLEFERLKPYLLEMWKSKE
Ga0208355_105612413300025581Arctic Peat SoilLTFVIENRNASADDVESNIEGLCLEFERLKPYLLQMWKSRK
Ga0207694_1124680513300025924Corn RhizosphereNRTASAAEVGNNIESLCLEFERLKPYLLELWNGRK
Ga0257158_109939113300026515SoilYTFVVENRNGSANDVANNIESLCLEFERLKPYLLEIWKSKQ
Ga0209648_1070705013300026551Grasslands SoilNRDTSANEVENNIESLCLEFERLKPYLLEMWNGRK
Ga0209577_1034856433300026552SoilMVTFVTENRSGSMTDVENNIENLCLEFERLKPYFIELWNGRK
Ga0209623_101799023300026880Forest SoilAPLFRGRVFTFLVENRNGSAEDLENNIEGLCLEFERWKPYLLQMWKSRE
Ga0208994_105771323300027164Forest SoilFRGRVFTFLMENRNASADDVENNIEGLCLEFERLKPYLLQMWKS
Ga0209421_104980313300027432Forest SoilENRNASADQVENNVESLCLEFERLKPYLLQMWNERK
Ga0208043_113842613300027570Peatlands SoilFTFVIENRNASADGVENNIEALCLEFERLKPYLLELWKSRE
Ga0209736_114888213300027660Forest SoilLAPLFRGRVFTFLVENRNGSTEDLENNIEGLCLEFERWKPYLLQMWKSRE
Ga0209009_105493613300027667Forest SoilFRGRAFTFLTENRNASAGDVENNIEALCLEFERLKPYLLQMWKSRE
Ga0209009_109096813300027667Forest SoilFTFLLENRNASADDVENNIEGLCLEFERLKPYLLQMWKSRE
Ga0209446_107630213300027698Bog Forest SoilGRAFTFLMENRNASAADVENNIEALCVEFERVKPYLLQMWKSRE
Ga0209038_1023720213300027737Bog Forest SoilRAFTFLMENRNASADDVENNIEGLCLEFERLKPYLLQLWKSRE
Ga0209180_1065534713300027846Vadose Zone SoilENRSSSAEEVEKNIESLCIEFERLKPYLLEVWNTKK
Ga0209693_1023468313300027855SoilEQRNGSEQDVENCIESLCLEFERLKPYLLQMWKSRE
Ga0209693_1033281223300027855SoilVFTFLVENRNGSAEDLENNIEGLCLEFERWKPYLLQMWKSRE
Ga0209693_1038875013300027855SoilNRNGSADDVENNIEGLCLEFERMKPYLLQIWNGRE
Ga0209380_1028296923300027889SoilMENRNSSADEVEANVESLCLEFERLKPYLLEMWSGKK
Ga0209380_1049291213300027889SoilRGRAFTFLTENRNGSADDVENNIEGLCLEFERMKPYLLQIWNGRE
Ga0209068_1000667513300027894WatershedsFRGRALTFLLQNNQGSSDDVVNNIETLCLEFERLKPYLLEKMEL
Ga0209168_1001488013300027986Surface SoilLTENRTASAANVEDDIEALCLEFERMKPYLREIWNGRE
Ga0302224_1039678613300028759PalsaTFLMENRDASAEDVENNIEGLCLEFERLKPYLLQMWKSRE
Ga0302189_1041271923300028788BogLVENEQSTAAGVENNIEGLCLEFERWKPYLLELWQDGE
Ga0302222_1025803623300028798PalsaVVENRNGSAKDVANNIEGLCLEFERLKPYLLEMWKSKE
Ga0302218_1032618623300028863PalsaGRVFTFLIENRNSSANDVENNIEGLCLEFERLKPYLLQLWKSRE
Ga0311340_1085683123300029943PalsaGRAFTFLTENINGSDADVENNIESLCLEFERTKPYLLEIWKQ
Ga0311343_1014362943300029953BogRGRAFTFITENRNASAGDVENNIENLCLEFERLKPYLQQMWSV
Ga0311339_1098965023300029999PalsaPLFRGRVLTVLRENRNASEETIEQNTEALCLEFEQLKPYLLQLWKTRE
Ga0311338_1033914533300030007PalsaFLIENRTGSAEDVEKNIEDLCMEFERLKPYLLQMWKSRE
Ga0302178_1053158923300030013PalsaRGRAFTFLMENRNGSANDVGNNIEGLCLEFERMKPYLLEMWSGRQ
Ga0302195_1049857413300030051BogRGRAFTFITENRNASAGDVENNIENLCLEFERLKPYLQRMWSV
Ga0302182_1024558223300030054PalsaLMENRDASAEDVENNIEGLCLEFERLKPYLLQMWKSRE
Ga0316363_1019190923300030659Peatlands SoilFVIENRNASADGVEKNIEALCLEFERLKPYLLQLWKSRE
Ga0170834_10507359383300031057Forest SoilENRTSSAIEVENNIENLCLEFERSKPNLLAMWKSRE
Ga0170824_11178861013300031231Forest SoilYTFLVENRNGSADEVENNIEALCLAFERGKPYLLELWNGRE
Ga0302324_10008121853300031236PalsaRGRAFTFLTENINGSDADVENNIESLCLEFERTKPYLLEIWKQ
Ga0307476_1096777423300031715Hardwood Forest SoilLVENRNGSAEDLENNIEGLCLEFERWKPYLLQMWKSRE
Ga0307478_1071064623300031823Hardwood Forest SoilNRNASADDVENNIEGLCLEFERLKPYLLQMWKSRE
Ga0307478_1164898923300031823Hardwood Forest SoilGRVFTFLVENRNASAIEVENNIEGLCVEFERLKPYLLQMWKSRE
Ga0302315_1076588223300031837PalsaTFLMENRNGSANDVGNNIEGLCLEFERMKPYLLEMWSGRQ
Ga0307479_1031254243300031962Hardwood Forest SoilRGRVFTFLMENRNASADDVENNIEGLCLEFERLKPDLLQMWKSRE
Ga0307479_1201004523300031962Hardwood Forest SoilFRGRVFTFLAENRNASANDVENNIEGLCLEFERLKPYLLQMWKSRE
Ga0311301_1104658213300032160Peatlands SoilFLVENSSGSADNVEHNIEALCLEFERMKPYLLQIWNGGE
Ga0307470_1128646613300032174Hardwood Forest SoilRVFTFVVENRNGSADDVARNIEGLCLEFERLKPYLLEIWKSKE
Ga0307472_10120091613300032205Hardwood Forest SoilTFVVENRNGSANDVANNIESLCLEFERLKPYLLEIWKSKQ
Ga0335076_1091668023300032955SoilNRSSSAEDVERNIENLCLEFERLKPYLVELWNSGK
Ga0370484_0096475_25_1383300034125Untreated Peat SoilMENRNATAADVENNIEGLCLEFERLKPYLLQLWKSRK
Ga0370515_0415827_2_1213300034163Untreated Peat SoilFVVENRNASANDVANNIEGLCLEFERLKPYLLEMWKSKE

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.