NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F078151

Metagenome / Metatranscriptome Family F078151

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F078151
Family Type Metagenome / Metatranscriptome
Number of Sequences 116
Average Sequence Length 117 residues
Representative Sequence MKKLLYTLVVCALAAVSAAAQSSLSGTWQIEYHDKNGKEIDTPMVTLLQNGGRLDGVFGNQHWKVEGKVVGDQVQFSFHPPQRPDITVRYQGTLESSNQMRGTMASEVQSGTFVAVRK
Number of Associated Samples 94
Number of Associated Scaffolds 116

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 73.28 %
% of genes near scaffold ends (potentially truncated) 31.03 %
% of genes from short scaffolds (< 2000 bps) 76.72 %
Associated GOLD sequencing projects 86
AlphaFold2 3D model prediction Yes
3D model pTM-score0.75

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (100.000 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland
(16.379 % of family members)
Environment Ontology (ENVO) Unclassified
(47.414 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Water (non-saline)
(39.655 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: Yes Secondary Structure distribution: α-helix: 11.64%    β-sheet: 43.15%    Coil/Unstructured: 45.21%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.75
Powered by PDBe Molstar

Structural matches with SCOPe domains

SCOP familySCOP domainRepresentative PDBTM-score
b.61.1.1: Avidin/streptavidind2f01a_2f010.81
b.61.1.1: Avidin/streptavidind1y55x11y550.79
b.61.1.0: Avidin/streptavidind3szha_3szh0.79
b.61.1.0: Avidin/streptavidind4z2oa_4z2o0.79
b.61.1.0: Avidin/streptavidind4bj8a_4bj80.78


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 116 Family Scaffolds
PF03551PadR 17.24
PF00989PAS 2.59
PF00196GerE 1.72
PF13620CarboxypepD_reg 1.72
PF01212Beta_elim_lyase 1.72
PF02562PhoH 0.86
PF04255DUF433 0.86
PF13561adh_short_C2 0.86
PF01436NHL 0.86
PF01979Amidohydro_1 0.86
PF00488MutS_V 0.86
PF01704UDPGP 0.86
PF05299Peptidase_M61 0.86
PF03544TonB_C 0.86
PF08818DUF1801 0.86
PF00528BPD_transp_1 0.86
PF00150Cellulase 0.86
PF01578Cytochrom_C_asm 0.86
PF13460NAD_binding_10 0.86
PF02594DUF167 0.86
PF01175Urocanase 0.86
PF02321OEP 0.86
PF07676PD40 0.86
PF00691OmpA 0.86
PF00295Glyco_hydro_28 0.86
PF06739SBBP 0.86
PF07244POTRA 0.86
PF02823ATP-synt_DE_N 0.86
PF10142PhoPQ_related 0.86

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 116 Family Scaffolds
COG1695DNA-binding transcriptional regulator, PadR familyTranscription [K] 17.24
COG1733DNA-binding transcriptional regulator, HxlR familyTranscription [K] 17.24
COG1846DNA-binding transcriptional regulator, MarR familyTranscription [K] 17.24
COG1167DNA-binding transcriptional regulator, MocR family, contains an aminotransferase domainTranscription [K] 3.45
COG0075Archaeal aspartate aminotransferase or a related aminotransferase, includes purine catabolism protein PucGAmino acid transport and metabolism [E] 1.72
COG0076Glutamate or tyrosine decarboxylase or a related PLP-dependent proteinAmino acid transport and metabolism [E] 1.72
COG0112Glycine/serine hydroxymethyltransferaseAmino acid transport and metabolism [E] 1.72
COG01567-keto-8-aminopelargonate synthetase or related enzymeCoenzyme transport and metabolism [H] 1.72
COG0399dTDP-4-amino-4,6-dideoxygalactose transaminaseCell wall/membrane/envelope biogenesis [M] 1.72
COG0436Aspartate/methionine/tyrosine aminotransferaseAmino acid transport and metabolism [E] 1.72
COG0520Selenocysteine lyase/Cysteine desulfuraseAmino acid transport and metabolism [E] 1.72
COG0626Cystathionine beta-lyase/cystathionine gamma-synthaseAmino acid transport and metabolism [E] 1.72
COG1003Glycine cleavage system protein P (pyridoxal-binding), C-terminal domainAmino acid transport and metabolism [E] 1.72
COG1104Cysteine desulfurase/Cysteine sulfinate desulfinase IscS or related enzyme, NifS familyAmino acid transport and metabolism [E] 1.72
COG1538Outer membrane protein TolCCell wall/membrane/envelope biogenesis [M] 1.72
COG1921Seryl-tRNA(Sec) selenium transferaseTranslation, ribosomal structure and biogenesis [J] 1.72
COG1982Arginine/lysine/ornithine decarboxylaseAmino acid transport and metabolism [E] 1.72
COG2008Threonine aldolaseAmino acid transport and metabolism [E] 1.72
COG2873O-acetylhomoserine/O-acetylserine sulfhydrylase, pyridoxal phosphate-dependentAmino acid transport and metabolism [E] 1.72
COG3033TryptophanaseAmino acid transport and metabolism [E] 1.72
COG4992Acetylornithine/succinyldiaminopimelate/putrescine aminotransferaseAmino acid transport and metabolism [E] 1.72
COG0249DNA mismatch repair ATPase MutSReplication, recombination and repair [L] 0.86
COG0308Aminopeptidase N, contains DUF3458 domainAmino acid transport and metabolism [E] 0.86
COG0355FoF1-type ATP synthase, epsilon subunitEnergy production and conversion [C] 0.86
COG0810Periplasmic protein TonB, links inner and outer membranesCell wall/membrane/envelope biogenesis [M] 0.86
COG1193dsDNA-specific endonuclease/ATPase MutS2Replication, recombination and repair [L] 0.86
COG1702Phosphate starvation-inducible protein PhoH, predicted ATPaseSignal transduction mechanisms [T] 0.86
COG1872Uncharacterized conserved protein YggU, UPF0235/DUF167 familyFunction unknown [S] 0.86
COG1875Predicted ribonuclease YlaK, contains NYN-type RNase and PhoH-family ATPase domainsGeneral function prediction only [R] 0.86
COG2442Predicted antitoxin component of a toxin-antitoxin system, DUF433 familyDefense mechanisms [V] 0.86
COG2730Aryl-phospho-beta-D-glucosidase BglC, GH1 familyCarbohydrate transport and metabolism [G] 0.86
COG2987Urocanate hydrataseAmino acid transport and metabolism [E] 0.86
COG3934Endo-1,4-beta-mannosidaseCarbohydrate transport and metabolism [G] 0.86
COG3975Predicted metalloprotease, contains C-terminal PDZ domainGeneral function prediction only [R] 0.86
COG4284UDP-N-acetylglucosamine pyrophosphorylaseCarbohydrate transport and metabolism [G] 0.86
COG4430Uncharacterized conserved protein YdeI, YjbR/CyaY-like superfamily, DUF1801 familyFunction unknown [S] 0.86
COG5434PolygalacturonaseCarbohydrate transport and metabolism [G] 0.86
COG5646Iron-binding protein Fra/YdhG, frataxin family (Fe-S cluster biosynthesis)Posttranslational modification, protein turnover, chaperones [O] 0.86
COG5649Uncharacterized conserved protein, DUF1801 domainFunction unknown [S] 0.86


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms100.00 %
UnclassifiedrootN/A0.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300004092|Ga0062389_102779104All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3653Open in IMG/M
3300005329|Ga0070683_100038056All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia4407Open in IMG/M
3300005336|Ga0070680_100634902All Organisms → cellular organisms → Bacteria917Open in IMG/M
3300005338|Ga0068868_101498793All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3631Open in IMG/M
3300005458|Ga0070681_11313388All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3646Open in IMG/M
3300005530|Ga0070679_100678184All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3973Open in IMG/M
3300005535|Ga0070684_100038443All Organisms → cellular organisms → Bacteria4111Open in IMG/M
3300005563|Ga0068855_101851723All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3612Open in IMG/M
3300005617|Ga0068859_101702708All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3696Open in IMG/M
3300006052|Ga0075029_100004156All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia8054Open in IMG/M
3300006086|Ga0075019_10248632All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA31061Open in IMG/M
3300009093|Ga0105240_10324705All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA31753Open in IMG/M
3300009523|Ga0116221_1393411All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3603Open in IMG/M
3300009524|Ga0116225_1182477All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3951Open in IMG/M
3300009545|Ga0105237_10114652All Organisms → cellular organisms → Bacteria → Acidobacteria2688Open in IMG/M
3300009545|Ga0105237_11006745All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3840Open in IMG/M
3300009616|Ga0116111_1000586All Organisms → cellular organisms → Bacteria28927Open in IMG/M
3300009630|Ga0116114_1182702All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3525Open in IMG/M
3300009641|Ga0116120_1190735All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3651Open in IMG/M
3300009644|Ga0116121_1179597All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3671Open in IMG/M
3300009700|Ga0116217_10823675All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3571Open in IMG/M
3300009764|Ga0116134_1118879All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3946Open in IMG/M
3300010379|Ga0136449_100146271All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA34654Open in IMG/M
3300010379|Ga0136449_101898529All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3885Open in IMG/M
3300010396|Ga0134126_10137791All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia2968Open in IMG/M
3300012212|Ga0150985_112837484All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA31447Open in IMG/M
3300013307|Ga0157372_10873934All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA31043Open in IMG/M
3300013307|Ga0157372_13350846All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3510Open in IMG/M
3300014151|Ga0181539_1312495All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3574Open in IMG/M
3300014158|Ga0181521_10000135All Organisms → cellular organisms → Bacteria → Acidobacteria82608Open in IMG/M
3300014162|Ga0181538_10317266All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium844Open in IMG/M
3300014164|Ga0181532_10099969All Organisms → cellular organisms → Bacteria1809Open in IMG/M
3300014164|Ga0181532_10422214All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3738Open in IMG/M
3300014165|Ga0181523_10105260All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA31691Open in IMG/M
3300014165|Ga0181523_10210217All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA31123Open in IMG/M
3300014167|Ga0181528_10250365All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3956Open in IMG/M
3300014167|Ga0181528_10510133All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3661Open in IMG/M
3300014168|Ga0181534_10654539All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3609Open in IMG/M
3300014169|Ga0181531_10313229All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3961Open in IMG/M
3300014199|Ga0181535_10266684All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA31029Open in IMG/M
3300014199|Ga0181535_10304092All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3951Open in IMG/M
3300014200|Ga0181526_11022912All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3519Open in IMG/M
3300014489|Ga0182018_10001747All Organisms → cellular organisms → Bacteria23766Open in IMG/M
3300014495|Ga0182015_10363117All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3938Open in IMG/M
3300014501|Ga0182024_11596318All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3740Open in IMG/M
3300014655|Ga0181516_10471531All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3643Open in IMG/M
3300014838|Ga0182030_10003982All Organisms → cellular organisms → Bacteria → Acidobacteria31498Open in IMG/M
3300014838|Ga0182030_10641925All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA31012Open in IMG/M
3300014839|Ga0182027_10435561All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA31447Open in IMG/M
3300016357|Ga0182032_11870157All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3525Open in IMG/M
3300016750|Ga0181505_10035418All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3959Open in IMG/M
3300017946|Ga0187879_10253513All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3980Open in IMG/M
3300017946|Ga0187879_10389531All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium772Open in IMG/M
3300017988|Ga0181520_10003417All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus27951Open in IMG/M
3300017988|Ga0181520_10215856All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA31495Open in IMG/M
3300017988|Ga0181520_10312691All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1171Open in IMG/M
3300018002|Ga0187868_1184203All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3735Open in IMG/M
3300018003|Ga0187876_1176548All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3730Open in IMG/M
3300018008|Ga0187888_1112044All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA31151Open in IMG/M
3300018009|Ga0187884_10000133All Organisms → cellular organisms → Bacteria → Acidobacteria73626Open in IMG/M
3300018019|Ga0187874_10000116All Organisms → cellular organisms → Bacteria → Acidobacteria103383Open in IMG/M
3300018034|Ga0187863_10060507All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA32151Open in IMG/M
3300018035|Ga0187875_10230145All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA31016Open in IMG/M
3300018037|Ga0187883_10131045All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA31295Open in IMG/M
3300018038|Ga0187855_10061153All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter2321Open in IMG/M
3300018038|Ga0187855_10086294All Organisms → cellular organisms → Bacteria1907Open in IMG/M
3300018038|Ga0187855_10709775All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3586Open in IMG/M
3300018042|Ga0187871_10030202All Organisms → cellular organisms → Bacteria3393Open in IMG/M
3300018044|Ga0187890_10429039All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3742Open in IMG/M
3300018047|Ga0187859_10169949All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA31159Open in IMG/M
3300018057|Ga0187858_10222934All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1221Open in IMG/M
3300018057|Ga0187858_10491830All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3751Open in IMG/M
3300021478|Ga0210402_10033342All Organisms → cellular organisms → Bacteria → Acidobacteria4454Open in IMG/M
3300021858|Ga0213852_1177296All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3532Open in IMG/M
3300021861|Ga0213853_10505381All Organisms → cellular organisms → Bacteria → Acidobacteria1874Open in IMG/M
3300022533|Ga0242662_10157778All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3690Open in IMG/M
3300025912|Ga0207707_11417723All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3553Open in IMG/M
3300025913|Ga0207695_10022328All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus7188Open in IMG/M
3300025913|Ga0207695_10333030All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA31406Open in IMG/M
3300025914|Ga0207671_10008455All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus8726Open in IMG/M
3300025917|Ga0207660_10549595All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3939Open in IMG/M
3300025944|Ga0207661_10790743All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3873Open in IMG/M
3300025949|Ga0207667_11873292All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3562Open in IMG/M
3300026023|Ga0207677_11186172All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3698Open in IMG/M
3300026078|Ga0207702_10797045All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3934Open in IMG/M
3300027854|Ga0209517_10074895All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus2384Open in IMG/M
3300029951|Ga0311371_10947927All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA31033Open in IMG/M
3300030002|Ga0311350_11504752All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3597Open in IMG/M
3300030007|Ga0311338_11099330All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3763Open in IMG/M
3300031234|Ga0302325_10820385All Organisms → cellular organisms → Bacteria → Acidobacteria1309Open in IMG/M
3300031234|Ga0302325_11028489All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA31121Open in IMG/M
3300031249|Ga0265339_10237473All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium886Open in IMG/M
3300031250|Ga0265331_10043925All Organisms → cellular organisms → Bacteria2162Open in IMG/M
3300031250|Ga0265331_10572597All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3510Open in IMG/M
3300031525|Ga0302326_10507260All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA31826Open in IMG/M
3300031525|Ga0302326_10977148All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA31193Open in IMG/M
3300031595|Ga0265313_10392862All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3545Open in IMG/M
3300031938|Ga0308175_103181264All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3509Open in IMG/M
3300031939|Ga0308174_10545974All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3954Open in IMG/M
3300031939|Ga0308174_10792743All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3795Open in IMG/M
3300032074|Ga0308173_10142901All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA31925Open in IMG/M
3300032160|Ga0311301_11050684All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA31068Open in IMG/M
3300032783|Ga0335079_11993454All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3559Open in IMG/M
3300032805|Ga0335078_10677229All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA31283Open in IMG/M
3300032828|Ga0335080_12418004All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3500Open in IMG/M
3300032892|Ga0335081_10552418All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1434Open in IMG/M
3300032897|Ga0335071_10355041All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA31419Open in IMG/M
3300032897|Ga0335071_11201827All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3703Open in IMG/M
3300032898|Ga0335072_10002004All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales32143Open in IMG/M
3300032898|Ga0335072_10106715All Organisms → cellular organisms → Bacteria → Acidobacteria3561Open in IMG/M
3300033134|Ga0335073_10003175All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia22797Open in IMG/M
3300033402|Ga0326728_10000334All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia190556Open in IMG/M
3300033402|Ga0326728_10036135All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia7988Open in IMG/M
3300033405|Ga0326727_10361505All Organisms → cellular organisms → Bacteria → Acidobacteria1366Open in IMG/M
3300033818|Ga0334804_000385All Organisms → cellular organisms → Bacteria → Acidobacteria26549Open in IMG/M
3300033887|Ga0334790_052252All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1518Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland16.38%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog15.52%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil7.76%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere6.90%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil6.03%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa5.17%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere5.17%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland4.31%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil3.45%
RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere3.45%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil2.59%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere2.59%
WatershedsEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds1.72%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds1.72%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil1.72%
BogEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Bog1.72%
PalsaEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa1.72%
SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Soil1.72%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere1.72%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.72%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil0.86%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.86%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.86%
FenEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Fen0.86%
PermafrostEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost0.86%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen0.86%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere0.86%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.86%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300004092Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3EnvironmentalOpen in IMG/M
3300005329Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaGEnvironmentalOpen in IMG/M
3300005336Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaGEnvironmentalOpen in IMG/M
3300005338Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2Host-AssociatedOpen in IMG/M
3300005458Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaGEnvironmentalOpen in IMG/M
3300005530Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaGEnvironmentalOpen in IMG/M
3300005535Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaGEnvironmentalOpen in IMG/M
3300005563Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2Host-AssociatedOpen in IMG/M
3300005617Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2Host-AssociatedOpen in IMG/M
3300006052Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013EnvironmentalOpen in IMG/M
3300006086Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013EnvironmentalOpen in IMG/M
3300009093Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaGHost-AssociatedOpen in IMG/M
3300009523Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaGEnvironmentalOpen in IMG/M
3300009524Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaGEnvironmentalOpen in IMG/M
3300009545Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaGHost-AssociatedOpen in IMG/M
3300009616Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_100EnvironmentalOpen in IMG/M
3300009630Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_40EnvironmentalOpen in IMG/M
3300009641Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_150EnvironmentalOpen in IMG/M
3300009644Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_10EnvironmentalOpen in IMG/M
3300009700Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaGEnvironmentalOpen in IMG/M
3300009764Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_40EnvironmentalOpen in IMG/M
3300010379Sb_50d combined assemblyEnvironmentalOpen in IMG/M
3300010396Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2EnvironmentalOpen in IMG/M
3300012212Combined assembly of Hopland grassland soilHost-AssociatedOpen in IMG/M
3300013307Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaGHost-AssociatedOpen in IMG/M
3300014151Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_60_metaGEnvironmentalOpen in IMG/M
3300014158Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_60_metaGEnvironmentalOpen in IMG/M
3300014162Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_30_metaGEnvironmentalOpen in IMG/M
3300014164Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaGEnvironmentalOpen in IMG/M
3300014165Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaGEnvironmentalOpen in IMG/M
3300014167Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_10_metaGEnvironmentalOpen in IMG/M
3300014168Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_10_metaGEnvironmentalOpen in IMG/M
3300014169Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaGEnvironmentalOpen in IMG/M
3300014199Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_30_metaGEnvironmentalOpen in IMG/M
3300014200Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaGEnvironmentalOpen in IMG/M
3300014489Permafrost microbial communities from Stordalen Mire, Sweden - 812P2M metaGEnvironmentalOpen in IMG/M
3300014495Permafrost microbial communities from Stordalen Mire, Sweden - 712P3M metaGEnvironmentalOpen in IMG/M
3300014501Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300014655Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_10_metaGEnvironmentalOpen in IMG/M
3300014838Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300014839Permafrost microbial communities from Stordalen Mire, Sweden - 712E1D metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300016357Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000EnvironmentalOpen in IMG/M
3300016750Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300017946Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10EnvironmentalOpen in IMG/M
3300017988Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_30_metaGEnvironmentalOpen in IMG/M
3300018002Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_40EnvironmentalOpen in IMG/M
3300018003Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_40EnvironmentalOpen in IMG/M
3300018008Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_40EnvironmentalOpen in IMG/M
3300018009Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_40EnvironmentalOpen in IMG/M
3300018019Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_150EnvironmentalOpen in IMG/M
3300018034Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10EnvironmentalOpen in IMG/M
3300018035Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_10EnvironmentalOpen in IMG/M
3300018037Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_10EnvironmentalOpen in IMG/M
3300018038Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_10EnvironmentalOpen in IMG/M
3300018042Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_10EnvironmentalOpen in IMG/M
3300018044Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_10EnvironmentalOpen in IMG/M
3300018047Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10EnvironmentalOpen in IMG/M
3300018057Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_150EnvironmentalOpen in IMG/M
3300021478Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-MEnvironmentalOpen in IMG/M
3300021858Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021861Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2016 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300022533Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-7-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300025912Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025913Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025914Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025917Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025944Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025949Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026023Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026078Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300027854Peat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes)EnvironmentalOpen in IMG/M
3300029951III_Palsa_N1 coassemblyEnvironmentalOpen in IMG/M
3300030002II_Fen_N1 coassemblyEnvironmentalOpen in IMG/M
3300030007I_Palsa_E1 coassemblyEnvironmentalOpen in IMG/M
3300031234Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2EnvironmentalOpen in IMG/M
3300031249Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaGHost-AssociatedOpen in IMG/M
3300031250Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaGHost-AssociatedOpen in IMG/M
3300031525Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3EnvironmentalOpen in IMG/M
3300031595Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaGHost-AssociatedOpen in IMG/M
3300031938Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1EnvironmentalOpen in IMG/M
3300031939Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R2EnvironmentalOpen in IMG/M
3300032074Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R1EnvironmentalOpen in IMG/M
3300032160Sb_50d combined assembly (MetaSPAdes)EnvironmentalOpen in IMG/M
3300032783Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3EnvironmentalOpen in IMG/M
3300032805Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2EnvironmentalOpen in IMG/M
3300032828Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4EnvironmentalOpen in IMG/M
3300032892Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5EnvironmentalOpen in IMG/M
3300032897Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.5EnvironmentalOpen in IMG/M
3300032898Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1EnvironmentalOpen in IMG/M
3300033134Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2EnvironmentalOpen in IMG/M
3300033402Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB31MNEnvironmentalOpen in IMG/M
3300033405Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB29MYEnvironmentalOpen in IMG/M
3300033818Peat soil microbial communities from Stordalen Mire, Sweden - 713 S-3-MEnvironmentalOpen in IMG/M
3300033887Peat soil microbial communities from Stordalen Mire, Sweden - 713 P-1-X1EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Ga0062389_10277910423300004092Bog Forest SoilAAQNSVSGTWQIEYHDKDGEEINRPMITLLQNGGRLDGVFGDKHWKVEGTVVGSQVKFSFHPPQRPDITVRYEGTLESNGLIRGTMASEVQSGTFTAVRK*
Ga0070683_10003805663300005329Corn RhizosphereMKMLHRVLIVCAFAAVSAFAQTQPNNLSGTWQIEYHDKNGKEVDTPMVSFLQSGGRLEGVFGNKHWRLEGTFVGDQIQFLFHPAGHPEITVRYSGKLDSSGQIRGSMVSEVQSGTFVAIRK*
Ga0070680_10063490213300005336Corn RhizosphereMRKLLYTGFVCALAALAQTEQQVNLSGTWQIEYHDKNGKEVDTPTVSFIQVGARLEGVFGDKHWKVDGSVVGDRVTFAFHPPSRSDITVRYQGTLESATQIRGAMASEVQSGTFVAIRK*
Ga0068868_10149879313300005338Miscanthus RhizosphereMKKLLQTLLVCAFAALAAVAQAEQPVNLSGSWQIEYHDRNGKEVDTPMVSLMQVGGRLEGVFGNKHWKVDGTVVGDQVTFAFHPPQRPDITVKYQGRLESPTQMRGTMASEVQSGTFVATRR*
Ga0070681_1131338813300005458Corn RhizosphereMRKLLYTGFVCALAALAQTEQLVNLSGTWQIEYHDKNGKEVDTPTVSFIQVGARLEGVFGDKHWKVDGSVVGDRVTFAFHPPSRPDITVKYQGTLESATQIRGAMASEVQSGTFVAIRK*
Ga0070679_10067818413300005530Corn RhizosphereMRKLLYTGFVCALAALAQTEQQVNLSGTWQIEYHDKNGKEVDTPTVSFIQVGARLEGVFGDKHWKVDGSVVGDRVTFAFHPPSRPDITVKYQGTLESATQIRGAMASEVQSGTFVAIRK*
Ga0070684_10003844333300005535Corn RhizosphereMKMLHRVLIVCAFAAVSAFAQTQPNNLSGTWQIEYHDKNGKEVDTPMVSFLQSGGRLEGVFGNKHWRLEGTFVGDQIQFLFHPAGHPEITVRYSGRLDSSGQIRGSMVSEVQSGTFVAIRK*
Ga0068855_10185172323300005563Corn RhizosphereMKMSHRALIVCAFAAVAAFAQTEPKNLSGTWQIEYHDKNGKEVDTPMVSFLQTGGRLEGVFGNKHWRLEGTFVGDQVQFLFHPAGHPEISVRYSGKLDASGQIRGSMVSEVQSGTFVAVRK*
Ga0068859_10170270823300005617Switchgrass RhizosphereNLSGTWQIEYHDKNGKEVDTPMVSLMQVGGRLEGVFGNKHWKVDGTVVGDQVTFAFHPPQRPDITVKYQGRLESPTQMRGTMASEVQSGTFVATRR*
Ga0075029_10000415623300006052WatershedsMRKLLYTAVVCALAAGCVAAQINLSGTWQIEYHDKNGKEVDTPMVSFLDNGGKLEGVFGNKHWKVEGSVSGAQVQFAFHPPARPDITVRYQGRLESANQIRGTMESEVQSGTFVAVRQ*
Ga0075019_1024863223300006086WatershedsVAAQINLSGTWQIEYHDKNGQEVDTPVVTFLDNGGKLEGVFGNKHWKVEGSVSGAKVQFTFHPPARPEITVRYQGTLESANQIRGTMDSEVQSGTFVAVRK*
Ga0105240_1032470523300009093Corn RhizosphereMKMSHRALIVCAFAAVTAFAQTETKNVSGTWQIEYHDKNGKEVDTPMVSFLQTGGRLEGVFGNKHWRLEGTVVADQVQFLFHPAGHPEITVRYAGKADSSGEIRGSMASEVQSGTFVAIRK*
Ga0116221_139341123300009523Peatlands SoilMKMLRYAQCVCVLASLGAFAQTDQKVNLSGTWQIEYHDKNGKEVDTPMVTFLQTGGRLEGVFGDKHWRLEGTVVGEQVQFLFHPPGHPEVTVRYQGKLESAGQMRGTMVSEVQSGTF
Ga0116225_118247733300009524Peatlands SoilMKKLLYTLVVCALAAISAAAQSSLSGTWQIEYHDKNGKEIDTPMVTLSQNGGRLDGVFGKYHWKVEGTVAGDTVQFWFHPPQAPDVTVRYQGTIESSNQMRGTMASEVQSGTFVAVRK*
Ga0105237_1011465233300009545Corn RhizosphereMKKLLYTLLVCAFAALAAVAQAEQPVNLSGTWQIEYHDKNGKEVDTPMVSLMQVGGRLEGVFGNKHWKVDGTVVGGQVTFAFHPLQRPDITVRYQGKLESATQMRGTMASEVQSGTFIATRK*
Ga0105237_1100674513300009545Corn RhizosphereRNHPTRRIGRHLKKEKSMKMLHRVLIVCAFAAVSAFAQTQPNNLSGTWQIEYHDKNGKEVDTPMVSFLQSGGRLEGVFGNKHWRLEGTFVGDQIQFLFHPAGHPEITVRYSGRLDSSGQIRGSMVSEVQSGTFVAIRK*
Ga0116111_100058683300009616PeatlandMKKLLYTLLVCAFAVLAAFAQTEQKVNLSGAWQIEYHDKNGKEVDKPMVSFMQTGDRLEGVFGDKHWKLEGTVVGDQVQFFFHPPARPDITVKYQGKLESSGQIRGAMASQVQSGTFVAVRK*
Ga0116114_118270223300009630PeatlandMRKLLYTVVLCAFAAFSVAAQTNLSGTWQIEYHDKNGKEVDTPMVSFLDNGGKLEGVFGNQHWKVEGSVSGAQVQFAFHPPARPDITVRYQGALESANQIRGTMESEVQSGTFVAVRK*
Ga0116120_119073523300009641PeatlandMKKLLYTLVVCALATVPAVAQSSLSGTWQIEYHDKNGKEIDTPMVTLSQNGGRLDGVFGKYHWKLEGTVVGDQVQFWFHPPQAPDVTVRYQGTIESSNQMRGTMASEVQSGTFVAVRK*
Ga0116121_117959723300009644PeatlandMKKLLNTLVVCALAAFLAAAQSGISGTWQIEYHDKNGKEVDTPMVTLLQNGGRLDGVFGNKHWRLEGTVVGDQVQFSFHPPQRPDITVRYQGTLESDNQMRGTMASEVQSGTFTAVRK*
Ga0116217_1082367513300009700Peatlands SoilMKMLRYALCVCVLASLGAFAQTDQKVNLSGTWQIEYHDKNGKEVDTPMVTFLQTGGRLEGVFGDKHWRLEGTVVGEQVQFLFHPPGHPEVTVRYQGKLESAGQMRGTMVSEVQSGTFVASRQ*
Ga0116134_111887913300009764PeatlandSSRDRQAWWLTPPKSERTKKMKKLLYTLVVCALAAISAAAQSSLSGTWQIDYHDKNGKEIDKPMVTLSQNGGRLDGVFGKYHWKLEGTVVGDRVQFWFHPPQAPDVTVRYQGTLESSNQMRGTMASEVQSGTFVAVRK*
Ga0136449_10014627163300010379Peatlands SoilMKKLLLWVVACAFAAFHVAAQTGTNTNLSGTWQIEYHDNNGKEVDMPMVSFVQSGGKLEGVFGDKHWKVEGLLAGDDIKFWFTPPMRRDVTVRYQGRLENANLMRGTMVSEVQSGSFVAVRKQ*
Ga0136449_10189852913300010379Peatlands SoilMKKLLYTLVVCALAAISAAAQSSLSGTWQIEYHDKNGKEIDTPMVTLSQNGGRLDGVFGKYHWKVEGTVAGDQVQFWFHPPQAPNVTVRYQGTLESSNQMRGTMASEVQSGTFVAVRK*
Ga0134126_1013779123300010396Terrestrial SoilMVTILMAAAVVCGLEAQNTQTPNVSGTWQIEYHDKNGKEVDTPMVTFLQTGGRLEGVFGNQHWRIEGTLVGTAVKFSFHPPQKPEITVAYQGALESPSLIRGTMASQVQSGTFTATRK*
Ga0150985_11283748423300012212Avena Fatua RhizosphereMKKLWMTLVVCALAAISATAQGNLSGTWQIEYHDKNGKEVDYPMVSLLQNGSQLEGVFGNKHWKVTGNVSGNQVQFSFHPPQRQDITVRYEGTLENANQIRGAMSSEVQSGTFVAVRRP*
Ga0157372_1087393413300013307Corn RhizosphereLIVCAFAAVSAFAQTQPNNLSGTWQIEYHDKNGKEVDTPMVSFLQSGGRLEGVFGNKHWRLEGTFVGDQIQFLFHPAGHPEITVRYSGKLDSSGQIRGSMVSEVQSGTFVAIRK*
Ga0157372_1335084613300013307Corn RhizosphereMKMSHRALIVCAFAAVTAFAQTETKNVSGTWQIEYHDKNGKEVDTPMVSFLQTGGRLEGVFGNKHWRLEGTVVADQVQFLFHPAGHPEITVRYAGKVDSSGEIRGSMVSEVQSGTFVAIRK*
Ga0181539_131249513300014151BogMKKLLYTLLVCAFTALVAFAQTEQKVNLSGTWQIEYHDKNGKEVDTPMVSFMQTGGRLEGVFGDKHWKVEGTVVGDQVQFFFHPPVRPDITVKYQGKLESSGQIRGAMASEVQSGTFVAVRK*
Ga0181521_10000135173300014158BogVVETTESTREENMKKTLLTLVVCALAALTAAAQTSLTGTWQIEYHDKNGKEVDTPMITFQQNGDRLEGVFGKYHWKVEGTVVGDRVQFSFHPPQAPEVTVRYQGTMESSSRMSGTMASEVQSGTFVATRK*
Ga0181538_1031726623300014162BogMKKLLYTLVVCALAAFSAAAQSGISGTWQIEYHDKNGKEIDTPMVTLLQNGGRLDGVFGKGHWKVEGTVVGDQVQFSFHPPQAPEVTVRYQGTMESGNLMRGTMASEVQSGTFTAVRKW*
Ga0181532_1009996943300014164BogMKKLLCTLVVCALAAISAAAQTSLSGTWQIEYHDKNGKEVDTPMVSLLQTGGRLEGVFGKYHWKVEGTVVGDQVQFAFHPPQAPDVTVRYQGTLESNNQIRGTMASEVQSGTFVATRKQ*
Ga0181532_1042221423300014164BogSSLSGTWQIEYHDKNGKEIDTPMVTLSQNGGRLDGVFGKYHWKLEGTLVGDQVQFWFHPPQAPDVTVRYQGTLESSNQMRGTMASEVQSGTFVAVRK*
Ga0181523_1010526023300014165BogMKKLLYTLVVCALAAVSAAAQSSLSGTWQIEYHDKNGKEIDTPMVTLSQNGGRLDGVFGKYHWKLEGTVAGDQVQFWFHPPQAPDVTVRYQGTLESSNQMRGTMASEVQSGTFVAVRK*
Ga0181523_1021021723300014165BogMKKLLYTLAVCALAAIPAVAQSGISGTWQIEYHDKNGKEVDTPMVTLLQNGGRLDGIFGDKHWKVEGTVVGDQVQFSFHPPQRPDITVRYQGTVEANNLIRGTMASEVQSGTFTAVRK*
Ga0181528_1025036513300014167BogMKKMLYTLVVCALAAISVAAQVNLSGTWQIEYHDKNGKEVDTPVVTLLQNGGRLDGVFGNQHWKVEGTIVGDEVQFAFHPPQRPDITVRYQGKMESTNQMRGTMASEVQSGTFTAVRKQ*
Ga0181528_1051013313300014167BogMKKLLYTLVVCALAAISAVAQASLSGTWQIEYHDKNGKEIDTPMVSFLQNGGRLDGVFGKDHWKVEGTVVGDQVQFFFHPPQAPNITVRYQGTLESDNQMRGTMASEVQSGTFTAVRKH*
Ga0181534_1065453913300014168BogMKKLLYTLVVCALAAVSAAAQSSLSGTWQIEYHDKNGKEIDTPMVTLLQNGGRLDGVFGNQHWKVEGKVVGDQVQFSFHPPQRPDITVRYQGTLESSNQMRGTMASEVQSGTFVAV
Ga0181531_1031322923300014169BogMKKLVYTLVVCALAAVSAAAQASLSGTWQIEYHDKNRKEIDTPMVTLSQNGGRLDGVFGKYHWKVEGTVVGDNVQFWFHPPQAPDVTVRYQGTLESNNQMRGTMASEVQSGTFVAVRK*
Ga0181535_1026668413300014199BogFAAFSVAAQTNLSGTWQIEYHDKNGKEVDTPMVSFLDNGGKLEGVFGNQHWKVEGSVSGAQVQFAFHPPARPDITVRYQGALESANQIRGTMESEVQSGTFVAVRK*
Ga0181535_1030409223300014199BogMKKLLYTLVVCALAAVSAAAQSSLSGTWQIEYHDKNGKEIDTPMVTLLQNGGRLDGVFGNQHWKVEGKVVGDQVQFSFHPPQRPDITVRYQGTLESSNQMRGTMASEVQSGTFVAVRK*
Ga0181526_1102291213300014200BogKTMKKLLNTLVVCALAAFLAAAQSGISGTWQIEYHDKNGKEVDTPMVTLLQNGGRLDGVFGNKHWRLEGTVVGDQVQFSFHPPQRPDITVRYQGTLESDNQMRGTMASEVQSGTFTAVRK
Ga0182018_10001747163300014489PalsaVADATEIREDQKMKKLLYTLVVCALAVVPAAAQSSLSGTWQIEYHDKNGKEIDTPMVTLLQNGGRLDGVFGNQHWKVEGTVTGDQVQFSFHPPQRPDITVRYQGTLESNSQMRGTMASEVQSGTFVAVRK*
Ga0182015_1036311713300014495PalsaVADATEIREDQKMKKLLYTLVVCALAVVPAAAQSSLSGTWQIEYHDKNGKEIDTPMVTLLQNGGRLDGVFGNQHWKVEGTVTGDQVQFSFHPPQRPDITVRYQGTLESNSQMRGTM
Ga0182024_1159631823300014501PermafrostSGRWEMGRLSIRSIFTRSPSLVADATEIREDQKMKKLLYTLVVCALAVVPAAAQSSLSGTWQIEYHDKNGKEIDTPMVTLLQNGGRLDGVFGNQHWKVEGTVTGDQVQFSFHPPQRPDITVRYQGTLESNSQMRGTMASEVQSGTFVAVRK*
Ga0181516_1047153113300014655BogMKKMLYTLVVCALAAISVAAQVNLSGTWQIEYHDKNGKEVDTPVVTLLQNGGRLDGVFGNQHWKVEGTIVGDEVQFAFHPPQRPDITVRYQGKMESTNQMRGTMASEVQS
Ga0182030_10003982163300014838BogMKTLLYTLVVCVLAAFSAAAQINLSGTWQIEYHDKNGKEVDYPMVSLLQNGGRLEGVFGNKHWKVEGTVTGDQVVFAFHPPQRPDITVRYQGKLESASQMRGTMASEVQSGTFVAVRKP*
Ga0182030_1064192523300014838BogMAAFAQTPPKANLSGTWQIEYHDKNGKEVDTPMISFLQTRSRLEGVFGNQHWKVEGTVVGDQVQFFFHPPSRPDITVRYEGTLESPVRMHGIMASQVQSGTFVAARK*
Ga0182027_1043556123300014839FenVCALTAFCVAAQINLSGTWQIEYHDKNGKEVDTPMVSFLDNGGKLEGVFGNKHWKVEGSVSGARVEFAFHPPTRPDITVRYQGTLESANQIRGTMESEVQSGTFVAVRK*
Ga0182032_1187015713300016357SoilMRKLLCTPLVCALAALAVAQTGQNVNLSGTWQIEYHDKNGKEVDTPMVSFLHTAGRLEGVFGNQHWKVEGTVAGDQVTFLFHPPSRPDITVRYQGRLESATRMRGTMASEVQSGMFVANRKW
Ga0181505_1003541823300016750PeatlandMKKLLYTLVVCALAAISAAAQSSLSGTWQIEYHDKNGKEIDTPMVTLLQDGGRLDGVFGKYHWKVEGTVVGDQVQFWFHPPQAPDVTVRYQGTLESNNQMRGTMASEVQSGTFVAVRK
Ga0187879_1025351313300017946PeatlandMKKLLYTLVLCALAAVSAAAQSSLSGTWQIEYHDKNGKEIDTPMVTLSQNGGRLDGVFGKYHWKVEGTVAGDQVQFWFHPPQDPDVTVRYQGTLESNSQMRGTMASEVQSGTFVAVRK
Ga0187879_1038953123300017946PeatlandSLSGTWQIEYHDKNGKEVDTPMVSLLQTGGRLEGVFGKYHWKVEGTVVGDQVQFAFHPPQAPDVTVRYQGTLESNNQIRGTMASEVQSGTFVATRKQ
Ga0181520_10003417223300017988BogMRKLLYTVVLCAFAAFSVAAQTNLSGTWQIEYHDKNGKEVDTPMVSFLDNGGKLEGVFGNQHWKVEGSVSGAQVQFAFHPPARPDITVRYQGALESANQIRGTMESEVQSGTFVAVRK
Ga0181520_1021585633300017988BogMKKLLYTLAVCALAAIPAVAQSGISGTWQIEYHDKNGKEVDTPMVTLLQNGGRLDGIFGDKHWKVEGTVVGDQVQFSFHPPQRPDITVRYQGTVEANNLIRGTMASEVQSGTFVATRK
Ga0181520_1031269113300017988BogMKKLSYTLVVCALAAISAAAQTSLSGTWQIEYHDKNGKEVDTPMVSLLQTGGRLEGVFGKYHWKVEGTVVGDQVQFAFHPPQAPDVTVRYQGTLESNNQIRGTMASEVQSGTFVATRKP
Ga0187868_118420313300018002PeatlandMKKLLYTLLVCAFAVLAAFAQTEQKVNLSGAWQIEYHDKNGKEVDTPMVSFMQTGGRLEGVFGDKHWKVEGTVVGDQVQFFFHPPVRPDITVKYQGKLESSGQIRGAMASEVQSGTFVAVRK
Ga0187876_117654823300018003PeatlandAFAVLAAFAQTEQKVNLSGAWQIEYHDKNGKEVDKPMVSFMQTGDRLEGVFGDKHWKLEGTVVGDQVQFFFHPPARPDITVKYQGKLESSGQIRGAMASQVQSGTFVAVRK
Ga0187888_111204413300018008PeatlandMKKLLYTLLVCAFTALVAFAQTEQKVNLSGTWQIEYHDKNGKEVDTPMVSFMQTGGRLEGVFGDKHWKVEGTVVGDQVQFFFHPPVRPDITVKYQGKLESSGQIRGAMASEVQSGTFVAVRK
Ga0187884_10000133143300018009PeatlandMKKLLYTLLVCAFAALAAFAQTEQKVNLSGAWQIEYHDKNGKEVDKPMVSFMQTGDRLEGVFGDKHWKLEGTVVGDQVQFFFHPPARPDITVKYQGKLESSGQIRGAMASQVQSGTFVAVRK
Ga0187874_10000116583300018019PeatlandMKKLLYTLLVCAFAVLAAFAQTEQKVNLSGAWQIEYHDKNGKEVDKPMVSFMQTGDRLEGVFGDKHWKLEGTVVGDQVQFFFHPPARPDITVKYQGKLESSGQIRGAMASQVQSGTFVAVRK
Ga0187863_1006050723300018034PeatlandMKKLLYTLVLCALAAVSAAAQSSLSGTWQIEYHDKNGKEIDTPMVTLSQNGGRLDGVFGKYHWKVEGTVAGDQVQFWFHPPQDPDVTVRYQGTLESSNQMRGTMASEVQSGTFVAVRK
Ga0187875_1023014533300018035PeatlandMKKLLYTLVVCALAAISAAAQSSLSGTWQIEYHDKNGKEIDTPMVTFLQNGGRLDGVFGKYHWKVEGTVVGDQVQFWFHPPQAPDVTVRYQGTIESSNQMRGTMASEVQSGTFVAVRK
Ga0187883_1013104523300018037PeatlandMKKLLYTLVVCALAVVPAAAQSSLSGTWQIEYHDKNGKEIDTPMVTLSQNGGRLDGVFGKYHWKVEGTVAGDQVQFWFHPPQDPDVTVRYQGTLESSNQMRGTMASEVQSGTFVAVRK
Ga0187855_1006115333300018038PeatlandMKKLLYTLVLCALAAVSAAAQSSLSGTWQIEYHDKNGKEIDTPMVTLSQNGGRLDGVFGKYHWKVEGTVAGDQVQFWFHPPQDPDVTVRYQGTLESNNQMRGTMASEVQSGTFVAVRK
Ga0187855_1008629413300018038PeatlandMKKLLYTLVVCAFAAISAAAQTSLSGTWQIEYHDKNGKEVDTPMVSLLQTGGRLEGVFGKYHWKVEGTVVGDQVQFAFHPPQAPDVTVRYQGTLESNNQIRGTMASEVQSGTFVATRKQ
Ga0187855_1070977513300018038PeatlandMKKLLYTLAVCALAAIPAVAQSGISGTWQIEYHDKNGKEVDTPMVTLLQNGGRLDGIFGDKHWKVEGTVVGDQVQFSFHPPQRPDITVRYQGTVEANNLIRGTMASEVQS
Ga0187871_1003020243300018042PeatlandMKKLLCTLVVCALAAISAAAQTSLSGTWQIEYHDKNGKEVDTPMVSLLQTGGRLEGVFGKYHWKVEGTVVGDQVQFAFHPPQAPDVTVRYQGTLESNNQIRGTMASEVQSGTFVATRKQ
Ga0187890_1042903913300018044PeatlandMKKLLYTLVVCALAAISAAAQSSLSGTWQIEYHDKNGKEIDTPMVTLSQNGGRLDGVFGKYHWKVEGTVVGDNVQFWFHPPQAPDVTVRYQGTIESSNQMRGTMASE
Ga0187859_1016994923300018047PeatlandMKKLLYTLVVCALAAISAAAQSSLSGTWQIEYHDKNGKEIDTPMVTLSQNGGRLDGVFGKYHWKLEGTVAGDQVQFWFHPPQAPDVTVRYQGTLESSNQMRGTMASEVQSGTFVAVRK
Ga0187858_1022293413300018057PeatlandPKSERTNTMKKLLCTLVVCALAAISAAAQTSLSGTWQIEYHDKNGKEVDTPMVSLLQTGGRLEGVFGKYHWKVEGTVVGDQVQFAFHPPQAPDVTVRYQGTLESNNQIRGTMASEVQSGTFVATRKQ
Ga0187858_1049183013300018057PeatlandSLSGTWQIDYHDKNGKEIDKPMVTLSQNGGRLDGVFGKYHWKLEGTVVGDQVQFWFHPPQAPDVTVRYQGTLESSNQMRGTMASEVQSGTFVAVRK
Ga0210402_1003334243300021478SoilMKTLQYALSVCALAALAAFAQTEQKVNLSGTWQIEYHDKNGNEVDTPTVSFMQTGGRLEGVFGDKHWKVEGTVVGDQVRFFFHPPVRPDITVRYQGKLESSGQMRGTMASEVQSGTFVATRK
Ga0213852_117729613300021858WatershedsLMRKLLYTAVVCALAAGCVAAQINLSGTWQIEYHDKNGKEVDTPMVSFLDNGGKLEGVFGNKHWKVEGSVSGAQVQFAFHPPARPDITVRYQGRLESANQIRGTMESEVQSGTFVAVRQ
Ga0213853_1050538133300021861WatershedsMRKLLYTAVVCALAAGCVAAQINLSGTWQIEYHDKNGKEVDTPMVSFLDNGGKLEGVFGNKHWKVEGSVSGAQVQFAFHPPARPDITVRYQGRLESANQIRGTMESEVQSGTFVAVRQ
Ga0242662_1015777813300022533SoilLAALAAFAQTEQKVNLSGTWQIEYHDKNGNEVDTPTVSFMQTGGRLEGVFGDKHWKVEGTVVGDQVRFFFHPPVRPDITVRYQGKLESSGQMRGTMASEVQSGTFVATRK
Ga0207707_1141772313300025912Corn RhizosphereMRKLLYTGFVCALAALAQTEQLVNLSGTWQIEYHDKNGKEVDTPTVSFIQVGARLEGVFGDKHWKVDGSVVGDRVTFAFHPPSRPDITVKYQGTLESATQIRGAMASEVQ
Ga0207695_1002232823300025913Corn RhizosphereMKMLHRVLIVCAFAAVSAFAQTQPNNLSGTWQIEYHDKNGKEVDTPMVSFLQSGGRLEGVFGNKHWRLEGTFVGDQIQFLFHPAGHPEITVRYSGRLDSSGQIRGSMVSEVQSGTFVAIR
Ga0207695_1033303023300025913Corn RhizosphereMKMSHRALIVCAFAAVTAFAQTETKNVSGTWQIEYHDKNGKEVDTPMVSFLQTGGRLEGVFGNKHWRLEGTVVADQVQFLFHPAGHPEITVRYAGKADSSGEIRGSMASEVQSGTFVAIR
Ga0207671_10008455113300025914Corn RhizosphereMKKLLYTLLVCAFAALAAVAQAEQPVNLSGTWQIEYHDKNGKEVDTPMVSLMQVGGRLEGVFGNKHWKVDGTVVGGQVTFAFHPLQRPDITVRYQGKLESATQMRGTMASEVQSGTFIATRK
Ga0207660_1054959513300025917Corn RhizosphereMRKLLYTGFVCALAALAQTEQQVNLSGTWQIEYHDKNGKEVDTPTVSFIQVGARLEGVFGDKHWKVDGSVVGDRVTFAFHPPSRSDITVRYQGTLESATQIRGAMASEVQSGTFVAIRK
Ga0207661_1079074323300025944Corn RhizosphereILALLIVCAFAAVSAFAQTQPNNLSGTWQIEYHDKNGKEVDTPMVSFLQSGGRLEGVFGNKHWRLEGTFVGDQIQFLFHPAGHPEITVRYSGKLDSSGQIRGSMVSEVQSGTFVAIRK
Ga0207667_1187329213300025949Corn RhizosphereMKMSHRALIVCAFAAVAAFAQTEPKNLSGTWQIEYHDKNGKEVDTPMVSFLQTGGRLEGVFGNKHWRLEGTFVGDQVQFLFHPAGHPEISVRYSGKLDGSGQIRGSMVSEVQSGTFVAVR
Ga0207677_1118617213300026023Miscanthus RhizosphereHVRTAEQPVNLSGSWQIEYHDRNGKEVDTPMVSLMQVGGRLEGVFGNKHWKVDGTVVGDQVTFAFHPPQRPDITVKYQGRLESPTQMRGTMASEVQSGTFVATRR
Ga0207702_1079704513300026078Corn RhizosphereMRKLLYTGFVCALAALAQTEQQVNLSGTWQIEYHDKNGKEVDTPTVSFIQVGARLEGVFGDKHWKVDGSVVGDRVTFAFHPPSRPDITVKYQGTLESATQIRGAMASEVQSGTFVAIRK
Ga0209517_1007489523300027854Peatlands SoilMKMLRYALCVCVLASLGAFAQTDQKVNLSGTWQIEYHDKNGKEVDTPMVTFLQTGGRLEGVFGDKHWRLEGTVVGEQVQFLFHPPGHPEVTVRYQGKLESAGQMRGTMVSEVQSGTFVASRQ
Ga0311371_1094792723300029951PalsaMKKLLHTLVVCALAAVSAAAQSGLSGTWQIEYHDTNGKEIDTPMVTLLQNGGRLDGVFGNQHWKVEGAVVGDQVQFSFHPPQRPDITVRYQGTLESSNQMRGTMASEVQSGTFVAVRK
Ga0311350_1150475213300030002FenMRKMVYALVVCALATFTVAAQVNLSGTWQIEYHDKNGKEVDTPMVSLMQTGSRLEGVFGNKHWKVEGAIAGDEVRFAFHPPQRPDITVQYQGKLESATVIRGTMASEVQSGTFTAVRK
Ga0311338_1109933013300030007PalsaREDQTMKKLLHTLVVCALAAVSAAAQSGLSGTWQIEYHDTNGKEIDTPMVTLLQNGGRLDGVFGNQHWKVEGAVVGDQVQFSFHPPQRPDITVRYQGTLESSNQMRGTMASEVQSGTFVAVRK
Ga0302325_1082038523300031234PalsaMKKMLYTLVVCALAAISVVAQVNVSGTWQIEYHDKDGKEVDTPMVTLLQNGGRLDGVFGKYHWKVEGTVAGDEVQFAFHPPQAPNVTVRYQGKMESTNQMRGTMDSEVQSGTFTAVRKP
Ga0302325_1102848913300031234PalsaVCALAAISAAAQTSLSGTWQIEYHDKNGKEVDTPMVTLMQSGGRLDGVFGKDHWKVEGTVVGNQIQFFFHPPQAPDVTVRYQGTLESNNQMRGTMASEVQSGTFTAVRKH
Ga0265339_1023747323300031249RhizosphereMKKLSHTLVVCALAAISAAAQGNLSGTWQIEYHDKNGKEVDTPMITLMQNGGRLDGVFGDKHWKVEGTVVGDQVQFAFHPPQAPNVTVRYQGKLESNNQMRGTMASEVQSGTFTAVRKQ
Ga0265331_1004392533300031250RhizosphereMLNTLVVCALAAISVTAQVNLSGTWQIEYRDKNGQEVDTPVVTFSQNGGRLDGTFGNQHWRVEGTIAGNEVKFSFHPPQRPDITVRYQGRMESSNRMHGTMASEVQSGTFTAVRRQ
Ga0265331_1057259723300031250RhizosphereMKKMWITLVVCALAALPVAAQVSLSGTWQIEYHDKNGKEIDYPMISFLQNGSRLEGVFGDKHWKVEGTVNGDQVQFAFHPPQRPEVTVRYQGKLESANQIRGTMASEVQSGTF
Ga0302326_1050726023300031525PalsaMKKLLYTLVVCALAAISAAAQTSLSGTWQIEYHDKNGKEVDTPMVTLMQSGGRLDGVFGKDHWKVEGTVVGNQIQFFFHPPQAPDVTVRYQGTLESNNQMRGTMASEVQSGTFTAVRKH
Ga0302326_1097714823300031525PalsaMKKMLYTLVVCALAAISVVAQVNVSGTWQIEYHDKDGKEVDTPMVTLLQNGGRLDGVFGKYHWKVEGTVAGDEVQFAFHPPQAPNVTVRYQGKMESTNQMRGTMASEVQSGTFTAVRKP
Ga0265313_1039286223300031595RhizosphereAAQINLSGTWQIEYHDKNGKEVDTPMVSFLHSGGQLEGVFADKHWKLQGTVVGGQVQFAFHPPQRPDITVRYQGRVESANQIRGTMASEVQSGTFVAVRK
Ga0308175_10318126423300031938SoilMKMSHRALIVCAFAAIAAFAQAEPKNLSGTWQIEYHDKNGKEVDTPMVSFLQTGGRLEGVFGNKHWRLEGTVVSDQVQFLFHPAGHPEITVRYSGKVDSSGEIR
Ga0308174_1054597423300031939SoilAIAAFAQAEPKNLSGTWQIEYHDKNGKEVDTPMVSFLQTGGRLEGVFGNKHWRLEGTVVADQVQFLFHPAGHPEISVRYTGKVDSSGEIRGSMVSEVQSGTFVAVRK
Ga0308174_1079274313300031939SoilFAQAEPKNLSGTWQIEYHDKNGKEVDTPMVSFLQTGGRLEGVFGNKHWRLEGTVVSDQVQFLFHPAGHPEITVRYSGKVDSSGEIRGSMVSEVQSGTFVAIRK
Ga0308173_1014290133300032074SoilMKMSHRALIVCAFAAIAAFAQAEPKNLSGTWQIEYHDKNGKEVDTPMVSFLQTGGRLEGVFGNKHWRLEGTVVADQVQFLFHPAGHPEISVRYTGKVDSSGEIRGSMVSEVQSGTFVAVR
Ga0311301_1105068413300032160Peatlands SoilMKKLLYTLVVCALAAISAAAQSSLSGTWQIEYHDKNGKEIDTPMVTLSQNGGRLDGVFGKYHWKVEGTVAGDTVQFWFHPPQAPDVTVRYQGTIESSNQMRGTMASEVQSGTFVAVRK
Ga0335079_1199345423300032783SoilMKKTLRTLVVCALATLSAAAQSSISGTWQIEYRDKNGQEVDTPMVTLLQNGNRIDGVFGNQHWKVEGTAVGGQIQFSFHPPHRSDITVHYRGTLESGSRMSGTMASEVQSGTFVAVRK
Ga0335078_1067722913300032805SoilMRMMLYTFVVCSLAAFSVAAQTNVSGTWQIEYHDKNGKEVDTPVVSFVDNGGKLEGVFGNKHWKVEGSVSGSQIQFAFHPPTRPDITVRYRGTLESANQIRG
Ga0335080_1241800413300032828SoilMKKLSHALVVCALAALSALAQNNLSGTWQIEYHDKNGKEVDTPVVTLLQNGGHLDGVFGNQHWRVTGTIVGDQVEFAFHPPQRPDITVHYTGKMESSNQMRGTMASEVQSGTFT
Ga0335081_1055241823300032892SoilMRMMLYTFVVCSLAAFSVAAQTNVSGTWQIEYHDKNGKEVDTPVVSFVDNGGKLEGVFGNKHWKVEGSVSGSQIQFAFHPPTRPDITVRYRGTLESANQIRGTMESEVQSGTFVAVRK
Ga0335071_1035504123300032897SoilMKTLSLALAVCALAASPAAAQVNLSGTWQIEYHDKSGKEVDYPMVSFLQTGERLEGVFGNKHWKVEGAVTGSKVRFSFHPPQRPDITVIYEGNLESANQMRGTMASEVQSGVFTAVRRP
Ga0335071_1120182713300032897SoilMKTLCMTLVVCALASVSALAQGNISGTWQIEYHDKNGKEVDYPMVSLLQTGGQLEGVFGTKHWKITGNVSGTQVQFSFHPPQRPDITVRYEGTLENADQMKGTMSSEVQSGTFIATRKP
Ga0335072_10002004143300032898SoilMKKTLLALVVCALAALSAAAQTSLSGTWQIEYHDKNGKEVDTPMITFLQTGGRLEGVFGKYHWKVEGTVAGDQVQFHFHPPQAPEVTVRYQGTLESANRMSGTMASEVQSGTFVATRR
Ga0335072_1010671513300032898SoilMKQLLYTLVVCALAAVAVAQTGLSGTWQIEYHDKNGKEVDTPMVTLLQNGARLDGVFGKEHWKVEGSVVGDQVQFSFHPPQAPDITVRYQGRLESTNQM
Ga0335073_10003175153300033134SoilMKKTLLALVVCALAALSAAAQTSLSGTWQIEYHDKNGKEVDTPMITFLQTGGRLEGVFGKYHWKVEGTVAGDQVQFRFHPPQAPEVTVRYQGTLESANRMSGTMASEVQSGTFVATRR
Ga0326728_100003341443300033402Peat SoilMKKLLYTLVVCALAAISATAQTSLSGTWQIEYHDKNGKEVDTPMVTLLQNGGRLDGVFGKYHWKVEGTVVGDQVVFSFHPPQRPDITVRYQGTLQSANQVSGTMASEVQSGTFVATRK
Ga0326728_1003613513300033402Peat SoilMKKLLYTLVVCALAAVSAAAQSSLSGTWQIEYHDKNGKEIDTPMVTLLQNGGRLDGVFGKYHWKVEGTVAGDQVQFSFHPPQRPDITVRYQGTIESNNQMRGTMASEVQSGTFVAVRK
Ga0326727_1036150523300033405Peat SoilMKKLLYTLVVCALATFTVEAQGNLSGTWQIEYHDNNGKEVDTPMVTLLQNGARLDGVFGDKHWKVEGTVVGDEVKFAFHPPQRPDITVRYQGKLESANQIRGTMASEVQAGSFVAVRKQ
Ga0334804_000385_25546_259413300033818SoilLVADATEIREDQKMKKLLYTLVVCALAVVPAAAQSSLSGTWQIEYHDKNGKEIDTPMVTLLQNGGRLDGVFGNQHWKVEGTVTGDQVQFSFHPPQRPDITVRYQGTLESNSQMRGTMASEVQSGTFVAVRK
Ga0334790_052252_755_11143300033887SoilMKKLLYTLVVCALAAISAAAQTSLSGTWRIEYHDKNGKEVDTPMVSFLQTGGRLEGVFGKQHWKVEGTVVGDQVQFAFHPPQRPDITVRYQGTMESNNQMRGTMASEVQSGTFVATRQP


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.