Basic Information | |
---|---|
Family ID | F078432 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 116 |
Average Sequence Length | 40 residues |
Representative Sequence | MTKKMSKEEKRVTELVRQRMKESRSTELLGFDVESVHAGR |
Number of Associated Samples | 98 |
Number of Associated Scaffolds | 116 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 74.14 % |
% of genes near scaffold ends (potentially truncated) | 99.14 % |
% of genes from short scaffolds (< 2000 bps) | 89.66 % |
Associated GOLD sequencing projects | 92 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.47 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (98.276 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (28.448 % of family members) |
Environment Ontology (ENVO) | Unclassified (28.448 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (44.828 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Mixed | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 27.94% β-sheet: 5.88% Coil/Unstructured: 66.18% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.47 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 116 Family Scaffolds |
---|---|---|
PF13561 | adh_short_C2 | 76.72 |
PF13439 | Glyco_transf_4 | 11.21 |
PF00106 | adh_short | 6.90 |
PF13460 | NAD_binding_10 | 0.86 |
PF06580 | His_kinase | 0.86 |
PF03544 | TonB_C | 0.86 |
PF13185 | GAF_2 | 0.86 |
PF00150 | Cellulase | 0.86 |
COG ID | Name | Functional Category | % Frequency in 116 Family Scaffolds |
---|---|---|---|
COG0810 | Periplasmic protein TonB, links inner and outer membranes | Cell wall/membrane/envelope biogenesis [M] | 0.86 |
COG2730 | Aryl-phospho-beta-D-glucosidase BglC, GH1 family | Carbohydrate transport and metabolism [G] | 0.86 |
COG2972 | Sensor histidine kinase YesM | Signal transduction mechanisms [T] | 0.86 |
COG3275 | Sensor histidine kinase, LytS/YehU family | Signal transduction mechanisms [T] | 0.86 |
COG3934 | Endo-1,4-beta-mannosidase | Carbohydrate transport and metabolism [G] | 0.86 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 98.28 % |
Unclassified | root | N/A | 1.72 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300002245|JGIcombinedJ26739_101193461 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 650 | Open in IMG/M |
3300002245|JGIcombinedJ26739_101786946 | Not Available | 515 | Open in IMG/M |
3300005176|Ga0066679_10982167 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 527 | Open in IMG/M |
3300005179|Ga0066684_10211853 | All Organisms → cellular organisms → Bacteria | 1258 | Open in IMG/M |
3300005187|Ga0066675_10328298 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1113 | Open in IMG/M |
3300005332|Ga0066388_103582883 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 793 | Open in IMG/M |
3300005439|Ga0070711_102056120 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 503 | Open in IMG/M |
3300005552|Ga0066701_10222322 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1163 | Open in IMG/M |
3300005586|Ga0066691_10532837 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 701 | Open in IMG/M |
3300006046|Ga0066652_101443580 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 641 | Open in IMG/M |
3300006800|Ga0066660_11258753 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 579 | Open in IMG/M |
3300007265|Ga0099794_10322490 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 801 | Open in IMG/M |
3300007265|Ga0099794_10714209 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 534 | Open in IMG/M |
3300009088|Ga0099830_10410889 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1095 | Open in IMG/M |
3300009089|Ga0099828_10382936 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1268 | Open in IMG/M |
3300009683|Ga0116224_10473306 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 597 | Open in IMG/M |
3300010325|Ga0134064_10064631 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1145 | Open in IMG/M |
3300011269|Ga0137392_11145024 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 636 | Open in IMG/M |
3300011270|Ga0137391_10333223 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1305 | Open in IMG/M |
3300011271|Ga0137393_11628037 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 535 | Open in IMG/M |
3300012096|Ga0137389_10636069 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 917 | Open in IMG/M |
3300012189|Ga0137388_10844799 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 848 | Open in IMG/M |
3300012198|Ga0137364_10244524 | All Organisms → cellular organisms → Bacteria | 1325 | Open in IMG/M |
3300012202|Ga0137363_10665686 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 880 | Open in IMG/M |
3300012203|Ga0137399_10875438 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 756 | Open in IMG/M |
3300012205|Ga0137362_10176989 | All Organisms → cellular organisms → Bacteria | 1832 | Open in IMG/M |
3300012205|Ga0137362_10434861 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1136 | Open in IMG/M |
3300012207|Ga0137381_10521840 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1036 | Open in IMG/M |
3300012209|Ga0137379_10627000 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 982 | Open in IMG/M |
3300012361|Ga0137360_10019022 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4545 | Open in IMG/M |
3300012361|Ga0137360_10618052 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 928 | Open in IMG/M |
3300012362|Ga0137361_10341823 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1373 | Open in IMG/M |
3300012363|Ga0137390_10361500 | All Organisms → cellular organisms → Bacteria | 1432 | Open in IMG/M |
3300012683|Ga0137398_10012086 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4415 | Open in IMG/M |
3300012683|Ga0137398_10414631 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 918 | Open in IMG/M |
3300012944|Ga0137410_10215783 | All Organisms → cellular organisms → Bacteria | 1492 | Open in IMG/M |
3300014150|Ga0134081_10195288 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 685 | Open in IMG/M |
3300014152|Ga0181533_1111993 | Not Available | 1189 | Open in IMG/M |
3300014166|Ga0134079_10113324 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1051 | Open in IMG/M |
3300014166|Ga0134079_10334139 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 684 | Open in IMG/M |
3300015052|Ga0137411_1048261 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 939 | Open in IMG/M |
3300015052|Ga0137411_1066370 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 780 | Open in IMG/M |
3300016371|Ga0182034_10093096 | All Organisms → cellular organisms → Bacteria | 2136 | Open in IMG/M |
3300016422|Ga0182039_10672988 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 910 | Open in IMG/M |
3300016422|Ga0182039_10882820 | All Organisms → cellular organisms → Bacteria | 797 | Open in IMG/M |
3300017822|Ga0187802_10401277 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 543 | Open in IMG/M |
3300017933|Ga0187801_10040375 | All Organisms → cellular organisms → Bacteria | 1671 | Open in IMG/M |
3300017959|Ga0187779_10717611 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 677 | Open in IMG/M |
3300017959|Ga0187779_11009506 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 578 | Open in IMG/M |
3300017974|Ga0187777_10383745 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 970 | Open in IMG/M |
3300017995|Ga0187816_10001670 | All Organisms → cellular organisms → Bacteria | 7200 | Open in IMG/M |
3300018006|Ga0187804_10263977 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 745 | Open in IMG/M |
3300018090|Ga0187770_10388202 | All Organisms → cellular organisms → Bacteria | 1096 | Open in IMG/M |
3300018090|Ga0187770_11398083 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 568 | Open in IMG/M |
3300018482|Ga0066669_11756430 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 572 | Open in IMG/M |
3300020170|Ga0179594_10341934 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 567 | Open in IMG/M |
3300020199|Ga0179592_10374391 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 624 | Open in IMG/M |
3300020579|Ga0210407_10039739 | All Organisms → cellular organisms → Bacteria | 3499 | Open in IMG/M |
3300020579|Ga0210407_11260426 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 554 | Open in IMG/M |
3300020580|Ga0210403_11487558 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 510 | Open in IMG/M |
3300021086|Ga0179596_10371798 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 719 | Open in IMG/M |
3300021168|Ga0210406_10674540 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 799 | Open in IMG/M |
3300021170|Ga0210400_10457460 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1053 | Open in IMG/M |
3300021402|Ga0210385_11499025 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 515 | Open in IMG/M |
3300021479|Ga0210410_10171145 | All Organisms → cellular organisms → Bacteria | 1940 | Open in IMG/M |
3300021479|Ga0210410_10578800 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 998 | Open in IMG/M |
3300021559|Ga0210409_10761795 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 840 | Open in IMG/M |
3300021559|Ga0210409_11522411 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 545 | Open in IMG/M |
3300022557|Ga0212123_10740510 | All Organisms → cellular organisms → Bacteria | 599 | Open in IMG/M |
3300024227|Ga0228598_1102290 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 578 | Open in IMG/M |
3300026316|Ga0209155_1200877 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 628 | Open in IMG/M |
3300026316|Ga0209155_1258231 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 539 | Open in IMG/M |
3300026332|Ga0209803_1346485 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 515 | Open in IMG/M |
3300026333|Ga0209158_1211737 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 672 | Open in IMG/M |
3300026555|Ga0179593_1074879 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2502 | Open in IMG/M |
3300026557|Ga0179587_10594020 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 728 | Open in IMG/M |
3300026847|Ga0207802_1019145 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 593 | Open in IMG/M |
3300026854|Ga0207727_109361 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 957 | Open in IMG/M |
3300027014|Ga0207815_1005875 | All Organisms → cellular organisms → Bacteria | 1658 | Open in IMG/M |
3300027616|Ga0209106_1065358 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 815 | Open in IMG/M |
3300027854|Ga0209517_10235545 | All Organisms → cellular organisms → Bacteria | 1105 | Open in IMG/M |
3300027862|Ga0209701_10640087 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 557 | Open in IMG/M |
3300027875|Ga0209283_10497835 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 784 | Open in IMG/M |
3300027903|Ga0209488_10033263 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3760 | Open in IMG/M |
3300029636|Ga0222749_10568116 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 618 | Open in IMG/M |
3300030991|Ga0073994_10067040 | All Organisms → cellular organisms → Bacteria | 1633 | Open in IMG/M |
3300031545|Ga0318541_10279139 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 930 | Open in IMG/M |
3300031545|Ga0318541_10782511 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 532 | Open in IMG/M |
3300031561|Ga0318528_10505654 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 649 | Open in IMG/M |
3300031668|Ga0318542_10480817 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 645 | Open in IMG/M |
3300031679|Ga0318561_10008902 | All Organisms → cellular organisms → Bacteria | 4284 | Open in IMG/M |
3300031682|Ga0318560_10819503 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 502 | Open in IMG/M |
3300031715|Ga0307476_10505727 | All Organisms → cellular organisms → Bacteria | 895 | Open in IMG/M |
3300031718|Ga0307474_10082970 | All Organisms → cellular organisms → Bacteria | 2386 | Open in IMG/M |
3300031720|Ga0307469_10183994 | All Organisms → cellular organisms → Bacteria | 1611 | Open in IMG/M |
3300031744|Ga0306918_10125880 | All Organisms → cellular organisms → Bacteria | 1863 | Open in IMG/M |
3300031771|Ga0318546_11278031 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 515 | Open in IMG/M |
3300031779|Ga0318566_10308269 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 783 | Open in IMG/M |
3300031782|Ga0318552_10336220 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 769 | Open in IMG/M |
3300031833|Ga0310917_10230810 | All Organisms → cellular organisms → Bacteria | 1243 | Open in IMG/M |
3300031890|Ga0306925_10267706 | All Organisms → cellular organisms → Bacteria | 1841 | Open in IMG/M |
3300031890|Ga0306925_10649208 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1109 | Open in IMG/M |
3300031910|Ga0306923_10250839 | All Organisms → cellular organisms → Bacteria | 2024 | Open in IMG/M |
3300031941|Ga0310912_10012940 | All Organisms → cellular organisms → Bacteria | 5332 | Open in IMG/M |
3300031941|Ga0310912_10541967 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 906 | Open in IMG/M |
3300031946|Ga0310910_10888805 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 699 | Open in IMG/M |
3300031954|Ga0306926_12569233 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 557 | Open in IMG/M |
3300032001|Ga0306922_10944247 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 893 | Open in IMG/M |
3300032055|Ga0318575_10133053 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1228 | Open in IMG/M |
3300032160|Ga0311301_10440829 | All Organisms → cellular organisms → Bacteria | 1968 | Open in IMG/M |
3300032180|Ga0307471_100194584 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2020 | Open in IMG/M |
3300032180|Ga0307471_102155549 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 701 | Open in IMG/M |
3300032205|Ga0307472_100504524 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1044 | Open in IMG/M |
3300032893|Ga0335069_10834834 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1035 | Open in IMG/M |
3300032955|Ga0335076_10937601 | All Organisms → cellular organisms → Bacteria | 748 | Open in IMG/M |
3300033289|Ga0310914_10542180 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1051 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 28.45% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 23.28% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 7.76% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 7.76% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 5.17% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 4.31% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 3.45% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 3.45% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 3.45% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 2.59% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 2.59% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.72% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.72% |
Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.86% |
Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.86% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.86% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.86% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.86% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
3300009683 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaG | Environmental | Open in IMG/M |
3300010325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_0_1 metaG | Environmental | Open in IMG/M |
3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300014150 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300014152 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_60_metaG | Environmental | Open in IMG/M |
3300014166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015 | Environmental | Open in IMG/M |
3300015052 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
3300017822 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2 | Environmental | Open in IMG/M |
3300017933 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1 | Environmental | Open in IMG/M |
3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
3300017995 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1 | Environmental | Open in IMG/M |
3300018006 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4 | Environmental | Open in IMG/M |
3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
3300020170 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
3300021086 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Host-Associated | Open in IMG/M |
3300026316 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 (SPAdes) | Environmental | Open in IMG/M |
3300026332 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 (SPAdes) | Environmental | Open in IMG/M |
3300026333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 (SPAdes) | Environmental | Open in IMG/M |
3300026555 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
3300026847 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 20 (SPAdes) | Environmental | Open in IMG/M |
3300026854 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 48 (SPAdes) | Environmental | Open in IMG/M |
3300027014 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 4 (SPAdes) | Environmental | Open in IMG/M |
3300027616 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM1_M3 (SPAdes) | Environmental | Open in IMG/M |
3300027854 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes) | Environmental | Open in IMG/M |
3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300030991 | Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Soil GP-1A (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
3300031682 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22 | Environmental | Open in IMG/M |
3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
3300031779 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22 | Environmental | Open in IMG/M |
3300031782 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20 | Environmental | Open in IMG/M |
3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
3300032055 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23 | Environmental | Open in IMG/M |
3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
3300032893 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1 | Environmental | Open in IMG/M |
3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGIcombinedJ26739_1011934611 | 3300002245 | Forest Soil | MSRKMTPEEKQATELVRRRMKESQSSEFLGFDVES |
JGIcombinedJ26739_1017869461 | 3300002245 | Forest Soil | MAPELTELEKQMTELVRQRMQASNSSEMLGFEVESVHDGRAVFVLR |
Ga0066679_109821671 | 3300005176 | Soil | MTKKMSKEEKRVTELVRQRMKESRSTELLGFDVESVHAGRAIFRLDV |
Ga0066684_102118533 | 3300005179 | Soil | MAKKMSKEEKRVTELVRRRMRESRSTELLGFDVESVHAGRAIFRLDV |
Ga0066675_103282982 | 3300005187 | Soil | MTRKMSKAEKQVTELVRRRMKESRSTELLGFDVESVHAGR |
Ga0066388_1035828832 | 3300005332 | Tropical Forest Soil | MVPKLTDEEKRVTELVRQRIKESKAIELLGFDVESVHEGRAI |
Ga0070711_1020561202 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | MSRKMSKEEERVTELVRQRMKESMATELLGFDVESVHDGRAIFRLDV |
Ga0066701_102223222 | 3300005552 | Soil | MTKKMSKGEKRFTELVRQRMKESRSTELLGFDVESVHAGRAIFRLDV |
Ga0066691_105328371 | 3300005586 | Soil | MTKKMSKGEKRVTQLVRRRMKESRSTELLGFDVESVHAG |
Ga0066652_1014435802 | 3300006046 | Soil | MTKKMSKEEKRVTELVRQRMKESRSTELLGFDVESV |
Ga0066660_112587531 | 3300006800 | Soil | MTRKMSKAEKQVTELVRRRMKESRSTELLGFDVESVHAG |
Ga0099794_103224901 | 3300007265 | Vadose Zone Soil | MTKKISKEEKRVTELVRQRMKASHSMEMLGFDVESV |
Ga0099794_107142091 | 3300007265 | Vadose Zone Soil | MTKGMSKEEKRVTELVRRRMKESRSTELLGFEVESVHKGRAIFRL |
Ga0099830_104108892 | 3300009088 | Vadose Zone Soil | MTKKMTKEEKRVTELVRRRMKESRSTELLGFDVESVHAGRAIF |
Ga0099828_103829361 | 3300009089 | Vadose Zone Soil | MTKKMSNEEKRVTEMVRQRMKESRSTELLGFDVESVHA |
Ga0116224_104733061 | 3300009683 | Peatlands Soil | MARKFSNAEKRATELVRQRMKESKATELLGFDVESVQE |
Ga0134064_100646311 | 3300010325 | Grasslands Soil | MTKKMSKEEKRVTELVRQRMKESRSTEFLGFDVESVHAGR |
Ga0137392_111450241 | 3300011269 | Vadose Zone Soil | MAGKRRNTMTKRMSKEEKRVTELVRRRMKESRSTELLGF |
Ga0137391_103332231 | 3300011270 | Vadose Zone Soil | MSKEEKRITEMVRQRIKESRSTELLGFDVESVHEGRAIFR |
Ga0137393_116280371 | 3300011271 | Vadose Zone Soil | MTKKMSKEEKRVTELVRQRMKESRSMELLGFDVESVHEGRA |
Ga0137389_106360691 | 3300012096 | Vadose Zone Soil | MTKKMTKEEKRVTELVRRRMKESRSTELLGFDVESV |
Ga0137388_108447992 | 3300012189 | Vadose Zone Soil | MTKKMSNEEKRVTELVRRRMKESRSTELLGFDVESVQAGRA |
Ga0137364_102445241 | 3300012198 | Vadose Zone Soil | MSKKMSKEERRVTELVRLRMKESRSTELLGFDVERVHAGRAI |
Ga0137363_106656862 | 3300012202 | Vadose Zone Soil | MTKKMSREEKRVTELVRQRMKESHSMEMLGFDVESVREGRAIFRL |
Ga0137399_108754381 | 3300012203 | Vadose Zone Soil | MTKKMSKEEKRITELVRQRMKESRSTELLGFDVESV |
Ga0137362_101769891 | 3300012205 | Vadose Zone Soil | MERLDKMTKKMSREEKRVTELVRQRMKESHSMEMLGFDVESVREGRA |
Ga0137362_104348611 | 3300012205 | Vadose Zone Soil | MSKEEKRVTELVRRRMKESRSTDLLGFEVESVHKGRAIFRL |
Ga0137381_105218401 | 3300012207 | Vadose Zone Soil | MTKKMSKEEKRVTELVRRRMKESRSTELLGFDVESVHAGRAI |
Ga0137379_106270002 | 3300012209 | Vadose Zone Soil | MSKDEKRITELVRQRMKESRSTELLGFEVESVHQG |
Ga0137360_100190221 | 3300012361 | Vadose Zone Soil | MTKKMSREEKRVTELVRQRMKESHSMEMLGFDVESVREGRAI |
Ga0137360_106180521 | 3300012361 | Vadose Zone Soil | MERLDKMTKKMSREEKRVTELVRQRMKESHSMEMLGFDVESVREG |
Ga0137361_103418231 | 3300012362 | Vadose Zone Soil | MSKEEKRITELVRRRMKESRSTELLGFDVESVHAGRAIFRLDVR |
Ga0137390_103615003 | 3300012363 | Vadose Zone Soil | MTKKMSKEEKRVTELVRRRMKESRSTELLGFDVESVHTGRA |
Ga0137398_100120861 | 3300012683 | Vadose Zone Soil | MTKKMSREEKRVTELVRQRMKESHSMEMLGFDVESVREGRA |
Ga0137398_104146312 | 3300012683 | Vadose Zone Soil | MERLDKMTKKMSREEKRVTELVRQRMKESHSMEMLGFDVESVREGRAIFR |
Ga0137410_102157831 | 3300012944 | Vadose Zone Soil | MTKGMSKEEKRVTELVRRRMKESRSTELLGFEVESVHKGRAI |
Ga0134081_101952881 | 3300014150 | Grasslands Soil | MTKKMSKGEKRFTELVRRRMKESRSTELLGFDVESV |
Ga0181533_11119932 | 3300014152 | Bog | MSRKLSREEKKVTGLVRRRMRESKATELLGFDVES |
Ga0134079_101133241 | 3300014166 | Grasslands Soil | MTKKMSKEEKRVTELVRQRMKESRSTELLGFDVESVHAGR |
Ga0134079_103341391 | 3300014166 | Grasslands Soil | MAKKMSKEEKRVTELVRRRMRESRSTELLGFDVESV |
Ga0137411_10482612 | 3300015052 | Vadose Zone Soil | MSKEEKRVTELVRRRMKESRSTDLLGFEVESVHKG |
Ga0137411_10663702 | 3300015052 | Vadose Zone Soil | MSKEEKRVTELVRRRMKESRSTELLGFEVESVHKGRAIFRL |
Ga0182034_100930963 | 3300016371 | Soil | MPRKMTVEEKRATELVRARMRESKSTELLGFDVESVH |
Ga0182039_106729882 | 3300016422 | Soil | MAKARKLSSEEKLVTELVRQRMRESKATELLGFDVES |
Ga0182039_108828203 | 3300016422 | Soil | MARKMSKEEKRVTELVRQRMKECMATELLGFDVESVHD |
Ga0187802_104012771 | 3300017822 | Freshwater Sediment | VRKSPKMSGEEKRVTELVRQRMKESKATELLGFDVESVQ |
Ga0187801_100403753 | 3300017933 | Freshwater Sediment | MRRKLTKEEKRVTELVRLRMKESQSSELLGFDVESVHDGRAIFGM |
Ga0187779_107176112 | 3300017959 | Tropical Peatland | MTRKLTPEEQKATELVRQRMKESKSTELLGFDVESVQDGRAVFRL |
Ga0187779_110095061 | 3300017959 | Tropical Peatland | MPRKMTEEEQKATELVRQRMKESKSTELLGFDVESVHDG |
Ga0187777_103837451 | 3300017974 | Tropical Peatland | MPRKMTEEEQKATELVRQRMKESKSTELLGFDVESVHDGRAI |
Ga0187816_1000167010 | 3300017995 | Freshwater Sediment | MVRKSPKMSDQEKRVTELVRQRMKESKAIALLGFDVE |
Ga0187804_102639772 | 3300018006 | Freshwater Sediment | MGRKMSREEKRATELVRLRMKESKSSELLGFDVESVHD |
Ga0187770_103882021 | 3300018090 | Tropical Peatland | MSRKLSREEKRITGLVRRRMRESKATELLGFDVESVHDGRAIF |
Ga0187770_113980831 | 3300018090 | Tropical Peatland | MSRKLTKEEKRVTELVRQRMKESKSSELLGFDVESVHDGRAIFR |
Ga0066669_117564301 | 3300018482 | Grasslands Soil | MTKKMSKAEKQVTELVRRRMKESRSTELLGFDVESVHA |
Ga0179594_103419342 | 3300020170 | Vadose Zone Soil | MTKKMSKEEKRVTELVRRRMKESRSTELLGFDVESVH |
Ga0179592_103743911 | 3300020199 | Vadose Zone Soil | MSRKMTAQEKQVTEMVRRRIKESDSTELLGFDVESVHDGRAIFR |
Ga0210407_100397394 | 3300020579 | Soil | MSRKMSKEEERVTELVRQRMKESMATELLGFDVESVHDGRAIFR |
Ga0210407_112604261 | 3300020579 | Soil | MSRKMSKEEKRVTELVRQRMKESMATELLGFDVESVHDGR |
Ga0210403_114875582 | 3300020580 | Soil | MTKNKKMSKEEKRVTELVRRRIKESRSTELLGFDVESVHAGRAIF |
Ga0179596_103717982 | 3300021086 | Vadose Zone Soil | MTKKMSKEEKRVTELVRRRMKESRSTELLGFDVESVHA |
Ga0210406_106745402 | 3300021168 | Soil | MSRKLTEEEKRVTELVRQRMKESKSTELLGFEVESVHEG |
Ga0210400_104574601 | 3300021170 | Soil | MARKMTPEEKQATELVRRRMKESMSSDLLGFDVESVHDGRAIFRL |
Ga0210385_114990252 | 3300021402 | Soil | MTKKMSKAEKQATEMVRQRLRESRSTELLGFDVESVQTG |
Ga0210410_101711451 | 3300021479 | Soil | MSRKMTPEEKQATELVRRRMKESKSSELLGFDVESVHDGRAIFRLD |
Ga0210410_105788002 | 3300021479 | Soil | MARKMTPEEKQATELVRRRMKESMSSELLGFDVES |
Ga0210409_107617952 | 3300021559 | Soil | MTKKMSKDEKRVTAMVRRRIKESRSTELLGFDVESVHTGRA |
Ga0210409_115224111 | 3300021559 | Soil | MSRKLTEEEKRITEFVRQRMKESKSTELLGFEVESVHEGRAIFRLD |
Ga0212123_107405101 | 3300022557 | Iron-Sulfur Acid Spring | MAPELTELEKQMTELVRQRMQESNSSEMLGFEVES |
Ga0228598_11022902 | 3300024227 | Rhizosphere | MTKKMSKEEKRVTEMVRRRIKESRSTELLGFDVESVQAGRAVF |
Ga0209155_12008772 | 3300026316 | Soil | MTRKMSKAEKQVTELVRRRMKESRSTELLGFDVES |
Ga0209155_12582312 | 3300026316 | Soil | MTKKMSKAEKQVTELVRRRMKESRSTELLGFDVES |
Ga0209803_13464851 | 3300026332 | Soil | MTKRMSKEEKRVTELVRRRMKESRSTDLLGFEVES |
Ga0209158_12117371 | 3300026333 | Soil | MTKKMSREEKRVTELVRQRMKESHSMEMLGFDVESVREGR |
Ga0179593_10748791 | 3300026555 | Vadose Zone Soil | MTKKMSKEEKRITELVRQRMKEKPLDGASGFDVESVHAGRAFSGWT |
Ga0179587_105940202 | 3300026557 | Vadose Zone Soil | MSRKMTPEEKHVTELVRRRMKESKSSELLGFDVES |
Ga0207802_10191451 | 3300026847 | Tropical Forest Soil | MARKMTAEEKRATELVRARMRESKSTELLGFDVESV |
Ga0207727_1093612 | 3300026854 | Tropical Forest Soil | MGRKLTADEQKITELVRQRMKESKSTELLGFDVESVHDGRAVFR |
Ga0207815_10058751 | 3300027014 | Tropical Forest Soil | MPRKMTAEEKRATELVRARMRESNSTELLGFDVESVHNGRAV |
Ga0209106_10653582 | 3300027616 | Forest Soil | MNKKMSKEEKRITELVRRRMKESRSTELLGFDVES |
Ga0209517_102355452 | 3300027854 | Peatlands Soil | MSRKLSSEEKRVTRLVRRRMRESKATELLGFDVESVHDGRAIFRLDV |
Ga0209701_106400871 | 3300027862 | Vadose Zone Soil | MTKKMSNEEKRITELVRRRMKESRSTELLGFDVESVHAGRAI |
Ga0209283_104978351 | 3300027875 | Vadose Zone Soil | LTWRQNEMTKKMSKEEKRVTELVRRRMKESRSTELLGFDVE |
Ga0209488_100332631 | 3300027903 | Vadose Zone Soil | MTKRMSKEEKRVTELVRRRMKESRSTELLGFEVESVH |
Ga0222749_105681162 | 3300029636 | Soil | MTKKMSKAEKQATEMVRQRLRESRSTELLGFDVESV |
Ga0073994_100670403 | 3300030991 | Soil | MTKKMSKEEKRITELVRQRMKESRSTELLGFDVESVHA |
Ga0318541_102791392 | 3300031545 | Soil | MVRKLTRKEQRITELVRQRMRESKSTELLGFAVESVHDGRA |
Ga0318541_107825112 | 3300031545 | Soil | MPRKMSVEEKRATELVRARMRESKSTELLGFDVESVHNGRAVFF |
Ga0318528_105056541 | 3300031561 | Soil | MVRKLTRKEQRITELVRQRMRESKSTELLGFAVESVHDGRAVF |
Ga0318542_104808172 | 3300031668 | Soil | MAKARKLSSEEKLVTELVRQRMRESKATELLGFDVESVQD |
Ga0318561_100089021 | 3300031679 | Soil | MPRKMNADEKRATELVRARMRESKSTELLGFDVESVH |
Ga0318560_108195031 | 3300031682 | Soil | MPRKMNADEKRATELVRARMRESKSTELLGFDVESVHNG |
Ga0307476_105057271 | 3300031715 | Hardwood Forest Soil | MVRKLSKEEKRATELVRRRMKGNESSELLGFEVESV |
Ga0307474_100829703 | 3300031718 | Hardwood Forest Soil | MTKRMSKVEKRVTELVRRRIRESRSTELLGFDVESVHEGRAIFR |
Ga0307469_101839941 | 3300031720 | Hardwood Forest Soil | MTKRMTKEEKRVTEMVRRRIKESRSTELLGFDVESVQ |
Ga0306918_101258803 | 3300031744 | Soil | MAKARKLSSEEKLVTELVRQRMRESKATELLGFDV |
Ga0318546_112780311 | 3300031771 | Soil | MPRKMNADEKRATELVRARMRESKSTELLGFDVESVHNGRAVFFLDV |
Ga0318566_103082692 | 3300031779 | Soil | MAKARKLSSEEKLVTELVRQRMRESKATELLGFDVESVQDGRAI |
Ga0318552_103362202 | 3300031782 | Soil | MPRKMTVEEKRATELVRARMRESKSTELLGFDVESVHNGRAVF |
Ga0310917_102308101 | 3300031833 | Soil | MPRKMTAEEKRATELVRARMRESKSTELLGFDVESVHDGRAVFFLD |
Ga0306925_102677061 | 3300031890 | Soil | MAGPLSDEEKRLTELVRLRMKESKSSALLGFDVESVHDGRAVFRLKV |
Ga0306925_106492082 | 3300031890 | Soil | MPRKMSVEEKRATELVRARMRESKSTELLGFDVES |
Ga0306923_102508393 | 3300031910 | Soil | MPRKMTAEEKRATELVRARMRESKSTELLGFDVESVHDGRA |
Ga0310912_100129407 | 3300031941 | Soil | MPRRMTAEEKRATELVRARMRESKSTELLGFDVES |
Ga0310912_105419671 | 3300031941 | Soil | MAGPLSDEEKRLTELVRLRMKESKSSALLGFDVESVHDGRAVFRLKVG |
Ga0310910_108888052 | 3300031946 | Soil | MPRKMTAEEKRATELVRARMRESKSTELLGFDVESVHDGRAVFF |
Ga0306926_125692331 | 3300031954 | Soil | MSRKMTAQEKQATELVRRRMKESKSSELLGFDVESVHDGRAVFRL |
Ga0306922_109442472 | 3300032001 | Soil | MPRKMSVEEKRATELVRARMRESKSTELLGFDVESVHNGRAV |
Ga0318575_101330533 | 3300032055 | Soil | MPRKMNADEKRATELVRARMRESKSTELLGFDVESVHSGRAVFF |
Ga0311301_104408291 | 3300032160 | Peatlands Soil | MSRKLSREEKNATELVRRRMRESKATELFGFDVESVHDGRAI |
Ga0307471_1001945843 | 3300032180 | Hardwood Forest Soil | MSKEEKRVTELVRRRMKESRSTELLGFEVESVHKGRAIFRLDVR |
Ga0307471_1021555491 | 3300032180 | Hardwood Forest Soil | MSRKMTAQEKQVTEMVRRRIKESDSTELLGFDVESVHDGRAVFRLDV |
Ga0307472_1005045241 | 3300032205 | Hardwood Forest Soil | MSRKMTPEEKQATELVRRRMKESKSSELLGFDVESVHDGRAIF |
Ga0335069_108348341 | 3300032893 | Soil | MARKLTKEEKRVTELVRQRMKESKSSELLGFDVESVHDGRAIFRLDV |
Ga0335076_109376012 | 3300032955 | Soil | MVRKLTEEEQKATELVRQRMKESKSSELLGFDVESVHD |
Ga0310914_105421801 | 3300033289 | Soil | MPRKMTAEVKRATELVRARMRESKSTELLGFDVESVH |
⦗Top⦘ |