Metagenome Family F078544

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences

Select file to download:
Download

Overview

Basic Information
Family ID	F078544
Family Type	Metagenome
Number of Sequences	116
Average Sequence Length	38 residues
Representative Sequence	MGRHTAERGPANDLFMATVVGALLLLCVIILALAAN
Number of Associated Samples	89
Number of Associated Scaffolds	116

Quality Assessment
Transcriptomic Evidence	No
Most common taxonomic group	Bacteria
% of genes with valid RBS motifs	63.79 %
% of genes near scaffold ends (potentially truncated)	25.00 %
% of genes from short scaffolds (< 2000 bps)	81.03 %
Associated GOLD sequencing projects	86
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.52

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign

Most Common Taxonomy
Group	Bacteria (64.655 % of family members)
NCBI Taxonomy ID	2
Taxonomy	All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (31.034 % of family members)
Environment Ontology (ENVO)	Unclassified (31.034 % of family members)
Earth Microbiome Project Ontology (EMPO)	Free-living → Non-saline → Soil (non-saline) (48.276 % of family members)

Multiple Sequence Alignments

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Select alignment to view:

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification:	Transmembrane (alpha-helical)	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 40.62% β-sheet: 0.00% Coil/Unstructured: 59.38%
Feature Viewer

Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.52
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.52
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 116 Family Scaffolds
PF01565	FAD_binding_4	21.55
PF04030	ALO	5.17
PF13302	Acetyltransf_3	3.45
PF00588	SpoU_methylase	1.72
PF04672	Methyltransf_19	1.72
PF03824	NicO	0.86
PF01695	IstB_IS21	0.86
PF00561	Abhydrolase_1	0.86
PF06262	Zincin_1	0.86
PF10041	DUF2277	0.86

COG ID	Name	Functional Category	% Frequency in 116 Family Scaffolds
COG0277	FAD/FMN-containing lactate dehydrogenase/glycolate oxidase	Energy production and conversion [C]	5.17
COG0219	tRNA(Leu) C34 or U34 (ribose-2'-O)-methylase TrmL, contains SPOUT domain	Translation, ribosomal structure and biogenesis [J]	1.72
COG0565	tRNA C32,U32 (ribose-2'-O)-methylase TrmJ or a related methyltransferase	Translation, ribosomal structure and biogenesis [J]	1.72
COG0566	tRNA G18 (ribose-2'-O)-methylase SpoU	Translation, ribosomal structure and biogenesis [J]	1.72
COG1484	DNA replication protein DnaC	Replication, recombination and repair [L]	0.86
COG3824	Predicted Zn-dependent protease, minimal metalloprotease (MMP)-like domain	Posttranslational modification, protein turnover, chaperones [O]	0.86

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	64.66 %
Unclassified	root	N/A	34.48 %
Planomonospora	genus	Planomonospora	0.86 %

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	64.66 %
Unclassified	root	N/A	34.48 %
unclassified Planomonospora	no rank	Planomonospora → unclassified Planomonospora	0.86 %

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	64.66 %
Unclassified	root	N/A	34.48 %
Planomonospora sp. ID91781	species	Planomonospora → unclassified Planomonospora → Planomonospora sp. ID91781	0.86 %

Name	Rank	Taxonomy	Distribution
Terrabacteria group	clade	All Organisms → cellular organisms → Bacteria → Terrabacteria group	58.62 %
Unclassified	root	N/A	34.48 %
Planomonospora sp. ID91781	species	Planomonospora → unclassified Planomonospora → Planomonospora sp. ID91781	0.86 %

Name	Rank	Taxonomy	Distribution
Actinobacteria	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	42.24 %
Unclassified	root	N/A	34.48 %
Planomonospora sp. ID91781	species	Planomonospora → unclassified Planomonospora → Planomonospora sp. ID91781	0.86 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	34.48 %
Actinomycetia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	32.76 %
Planomonospora sp. ID91781	species	Planomonospora → unclassified Planomonospora → Planomonospora sp. ID91781	0.86 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	34.48 %
Actinomycetales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales	4.31 %
Streptosporangiales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales	2.59 %
Frankiales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales	1.72 %
Pseudonocardiales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales	1.72 %
Micrococcales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales	0.86 %
unclassified Actinomycetia	no rank	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia	0.86 %
Planomonospora sp. ID91781	species	Planomonospora → unclassified Planomonospora → Planomonospora sp. ID91781	0.86 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	34.48 %
Actinomycetales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales	4.31 %
Pseudonocardiaceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae	1.72 %
Frankiaceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae	1.72 %
Actinomycetia bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	0.86 %
Microbacteriaceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae	0.86 %
Streptosporangiaceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae	0.86 %
Planomonospora sp. ID91781	species	Planomonospora → unclassified Planomonospora → Planomonospora sp. ID91781	0.86 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	34.48 %
Actinomycetales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales	4.31 %
Frankia	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae → Frankia	1.72 %
Pseudonocardiaceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae	1.72 %
Microbispora	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Microbispora	0.86 %
Clavibacter	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae → Clavibacter	0.86 %
Actinomycetia bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	0.86 %
Planomonospora sp. ID91781	species	Planomonospora → unclassified Planomonospora → Planomonospora sp. ID91781	0.86 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	34.48 %
Actinomycetales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales	4.31 %
Frankia	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae → Frankia	1.72 %
Pseudonocardiaceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae	1.72 %
unclassified Microbispora	no rank	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Microbispora → unclassified Microbispora	0.86 %
Clavibacter michiganensis	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae → Clavibacter → Clavibacter michiganensis	0.86 %
Actinomycetia bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	0.86 %
Planomonospora sp. ID91781	species	Planomonospora → unclassified Planomonospora → Planomonospora sp. ID91781	0.86 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	34.48 %
Actinomycetales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales	4.31 %
Frankia	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae → Frankia	1.72 %
Pseudonocardiaceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae	1.72 %
Clavibacter cf. michiganensis LMG 26808	strain	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae → Clavibacter → Clavibacter michiganensis → Clavibacter cf. michiganensis LMG 26808	0.86 %
Microbispora sp. GKU 823	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Microbispora → unclassified Microbispora → Microbispora sp. GKU 823	0.86 %
Actinomycetia bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	0.86 %
Planomonospora sp. ID91781	species	Planomonospora → unclassified Planomonospora → Planomonospora sp. ID91781	0.86 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
3300005187\|Ga0066675_10454060	All Organisms → cellular organisms → Bacteria → Terrabacteria group	953	Open in IMG/M
3300005451\|Ga0066681_10079757	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae → Frankia	1844	Open in IMG/M
3300005533\|Ga0070734_10009043	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae	7653	Open in IMG/M
3300005536\|Ga0070697_100192820	All Organisms → cellular organisms → Bacteria → Terrabacteria group	1730	Open in IMG/M
3300005537\|Ga0070730_10136667	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	1672	Open in IMG/M
3300005540\|Ga0066697_10171758	Not Available	1285	Open in IMG/M
3300005541\|Ga0070733_10275851	Not Available	1109	Open in IMG/M
3300005764\|Ga0066903_100160879	All Organisms → cellular organisms → Bacteria	3255	Open in IMG/M
3300005764\|Ga0066903_100351773	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales	2382	Open in IMG/M
3300005764\|Ga0066903_101677987	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales	1209	Open in IMG/M
3300005764\|Ga0066903_102044876	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae → Frankia	1101	Open in IMG/M
3300005764\|Ga0066903_104716507	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales	725	Open in IMG/M
3300005764\|Ga0066903_106033132	All Organisms → cellular organisms → Bacteria → Terrabacteria group	634	Open in IMG/M
3300006028\|Ga0070717_10411648	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	1215	Open in IMG/M
3300006032\|Ga0066696_10878340	Not Available	571	Open in IMG/M
3300006755\|Ga0079222_11821014	Not Available	590	Open in IMG/M
3300006804\|Ga0079221_10991891	Not Available	629	Open in IMG/M
3300006806\|Ga0079220_10162685	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales	1246	Open in IMG/M
3300006854\|Ga0075425_100038270	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	5347	Open in IMG/M
3300006893\|Ga0073928_10272977	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales	1283	Open in IMG/M
3300007076\|Ga0075435_100007302	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	7868	Open in IMG/M
3300007076\|Ga0075435_100638505	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	924	Open in IMG/M
3300009089\|Ga0099828_10200459	All Organisms → cellular organisms → Bacteria	1781	Open in IMG/M
3300009090\|Ga0099827_11239595	Not Available	649	Open in IMG/M
3300009792\|Ga0126374_10643861	Not Available	789	Open in IMG/M
3300010043\|Ga0126380_10000761	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	11405	Open in IMG/M
3300010046\|Ga0126384_10420197	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	1134	Open in IMG/M
3300010046\|Ga0126384_10623063	Not Available	947	Open in IMG/M
3300010047\|Ga0126382_11610721	Not Available	602	Open in IMG/M
3300010048\|Ga0126373_11408102	All Organisms → cellular organisms → Bacteria → Terrabacteria group	763	Open in IMG/M
3300010048\|Ga0126373_11770615	Not Available	681	Open in IMG/M
3300010359\|Ga0126376_10722709	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	961	Open in IMG/M
3300010359\|Ga0126376_10849966	Not Available	897	Open in IMG/M
3300010361\|Ga0126378_10336515	All Organisms → cellular organisms → Bacteria	1617	Open in IMG/M
3300010366\|Ga0126379_11415143	All Organisms → cellular organisms → Bacteria → Terrabacteria group	801	Open in IMG/M
3300010366\|Ga0126379_12172065	Not Available	656	Open in IMG/M
3300010376\|Ga0126381_100499232	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	1716	Open in IMG/M
3300010376\|Ga0126381_101483556	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	980	Open in IMG/M
3300010398\|Ga0126383_11009306	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	921	Open in IMG/M
3300010937\|Ga0137776_1188013	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	4300	Open in IMG/M
3300010937\|Ga0137776_1207644	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	4572	Open in IMG/M
3300011270\|Ga0137391_11190081	All Organisms → cellular organisms → Bacteria → Terrabacteria group	610	Open in IMG/M
3300012199\|Ga0137383_10089550	All Organisms → cellular organisms → Bacteria → Terrabacteria group	2228	Open in IMG/M
3300012201\|Ga0137365_10108882	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	2084	Open in IMG/M
3300012210\|Ga0137378_10366728	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1338	Open in IMG/M
3300012210\|Ga0137378_10879148	All Organisms → cellular organisms → Bacteria → Terrabacteria group	809	Open in IMG/M
3300012211\|Ga0137377_10145548	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	2268	Open in IMG/M
3300012356\|Ga0137371_10546772	Not Available	892	Open in IMG/M
3300012357\|Ga0137384_10129861	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	2109	Open in IMG/M
3300012971\|Ga0126369_11086215	Not Available	889	Open in IMG/M
3300012971\|Ga0126369_12079994	Not Available	655	Open in IMG/M
3300012977\|Ga0134087_10451722	Not Available	637	Open in IMG/M
3300014157\|Ga0134078_10358938	Not Available	643	Open in IMG/M
3300015374\|Ga0132255_105376953	Not Available	542	Open in IMG/M
3300018482\|Ga0066669_10266083	All Organisms → cellular organisms → Bacteria → Terrabacteria group	1367	Open in IMG/M
3300020582\|Ga0210395_10903288	All Organisms → cellular organisms → Bacteria → Terrabacteria group	656	Open in IMG/M
3300021171\|Ga0210405_10570700	Not Available	883	Open in IMG/M
3300021401\|Ga0210393_10835229	Not Available	749	Open in IMG/M
3300021407\|Ga0210383_10311338	All Organisms → cellular organisms → Bacteria → Terrabacteria group	1355	Open in IMG/M
3300021432\|Ga0210384_10571292	All Organisms → cellular organisms → Bacteria → Terrabacteria group	1017	Open in IMG/M
3300021559\|Ga0210409_10137559	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales	2242	Open in IMG/M
3300021560\|Ga0126371_10350669	Planomonospora → unclassified Planomonospora → Planomonospora sp. ID91781	1611	Open in IMG/M
3300021560\|Ga0126371_10428447	Not Available	1467	Open in IMG/M
3300021560\|Ga0126371_11357844	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	843	Open in IMG/M
3300021560\|Ga0126371_11366792	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	840	Open in IMG/M
3300021560\|Ga0126371_12083652	All Organisms → cellular organisms → Bacteria → Terrabacteria group	683	Open in IMG/M
3300021560\|Ga0126371_12249441	Not Available	658	Open in IMG/M
3300021560\|Ga0126371_12350944	Not Available	644	Open in IMG/M
3300025910\|Ga0207684_10002984	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	16771	Open in IMG/M
3300025910\|Ga0207684_10236541	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	1576	Open in IMG/M
3300025922\|Ga0207646_10058850	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales	3432	Open in IMG/M
3300025929\|Ga0207664_10966965	All Organisms → cellular organisms → Bacteria	763	Open in IMG/M
3300026557\|Ga0179587_10021966	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	3450	Open in IMG/M
3300027527\|Ga0209684_1031158	All Organisms → cellular organisms → Bacteria	816	Open in IMG/M
3300027725\|Ga0209178_1036837	All Organisms → cellular organisms → Bacteria → Terrabacteria group	1549	Open in IMG/M
3300027826\|Ga0209060_10372421	Not Available	650	Open in IMG/M
3300027862\|Ga0209701_10538416	All Organisms → cellular organisms → Bacteria	629	Open in IMG/M
3300027882\|Ga0209590_10861649	Not Available	572	Open in IMG/M
3300031543\|Ga0318516_10775661	Not Available	542	Open in IMG/M
3300031543\|Ga0318516_10874899	Not Available	506	Open in IMG/M
3300031544\|Ga0318534_10300553	Not Available	925	Open in IMG/M
3300031544\|Ga0318534_10595996	Not Available	628	Open in IMG/M
3300031544\|Ga0318534_10610116	Not Available	620	Open in IMG/M
3300031572\|Ga0318515_10057946	All Organisms → cellular organisms → Bacteria → Terrabacteria group	1965	Open in IMG/M
3300031572\|Ga0318515_10341682	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	803	Open in IMG/M
3300031640\|Ga0318555_10033442	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	2522	Open in IMG/M
3300031640\|Ga0318555_10118351	All Organisms → cellular organisms → Bacteria → Terrabacteria group	1406	Open in IMG/M
3300031668\|Ga0318542_10056005	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1806	Open in IMG/M
3300031668\|Ga0318542_10454899	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	664	Open in IMG/M
3300031682\|Ga0318560_10743882	Not Available	530	Open in IMG/M
3300031708\|Ga0310686_106415828	Not Available	1688	Open in IMG/M
3300031713\|Ga0318496_10552182	Not Available	636	Open in IMG/M
3300031720\|Ga0307469_10490945	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	1074	Open in IMG/M
3300031724\|Ga0318500_10706754	Not Available	514	Open in IMG/M
3300031740\|Ga0307468_101792038	Not Available	581	Open in IMG/M
3300031748\|Ga0318492_10642208	All Organisms → cellular organisms → Bacteria → Terrabacteria group	567	Open in IMG/M
3300031751\|Ga0318494_10704278	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	591	Open in IMG/M
3300031765\|Ga0318554_10584986	Not Available	629	Open in IMG/M
3300031780\|Ga0318508_1189089	Not Available	589	Open in IMG/M
3300031805\|Ga0318497_10028040	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	2793	Open in IMG/M
3300031831\|Ga0318564_10135415	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	1097	Open in IMG/M
3300031833\|Ga0310917_10145831	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1559	Open in IMG/M
3300031890\|Ga0306925_10630858	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1129	Open in IMG/M
3300031893\|Ga0318536_10564749	All Organisms → cellular organisms → Bacteria → Terrabacteria group	570	Open in IMG/M
3300031912\|Ga0306921_11025540	All Organisms → cellular organisms → Bacteria	929	Open in IMG/M
3300031942\|Ga0310916_10009486	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae	6434	Open in IMG/M
3300031945\|Ga0310913_10209658	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Microbispora → unclassified Microbispora → Microbispora sp. GKU 823	1363	Open in IMG/M
3300032008\|Ga0318562_10050250	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	2287	Open in IMG/M
3300032035\|Ga0310911_10746684	Not Available	566	Open in IMG/M
3300032067\|Ga0318524_10048844	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae → Clavibacter → Clavibacter michiganensis → Clavibacter cf. michiganensis LMG 26808	2009	Open in IMG/M
3300032068\|Ga0318553_10747820	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	511	Open in IMG/M
3300032089\|Ga0318525_10687545	Not Available	521	Open in IMG/M
3300032091\|Ga0318577_10520917	All Organisms → cellular organisms → Bacteria → Terrabacteria group	566	Open in IMG/M
3300032180\|Ga0307471_102429395	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	662	Open in IMG/M
3300032261\|Ga0306920_102025141	Not Available	806	Open in IMG/M
3300032805\|Ga0335078_10004340	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	21024	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	96.55%
Host-Associated	Host-Associated	3.45%

Habitat	Taxonomy	Distribution
Terrestrial	Environmental → Terrestrial	93.97%
Plants	Host-Associated → Plants	3.45%
Aquatic	Environmental → Aquatic	2.59%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	93.97%
Thermal Springs	Environmental → Aquatic → Thermal Springs	2.59%
Rhizosphere	Host-Associated → Plants → Rhizosphere	2.59%
Rhizoplane	Host-Associated → Plants → Rhizoplane	0.86%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	81.90%
Loam	Environmental → Terrestrial → Soil → Loam	11.21%
Hot (42-90C)	Environmental → Aquatic → Thermal Springs → Hot (42-90C)	2.59%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	2.59%
Wetlands	Environmental → Terrestrial → Soil → Wetlands	0.86%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified	0.86%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	37.93%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	36.21%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil	6.03%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	5.17%
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	4.31%
Agricultural Land	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land	3.45%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	2.59%
Sediment	Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Sediment	1.72%
Acidic	Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic	0.86%
Unclassified	Environmental → Terrestrial → Soil → Wetlands → Unclassified	0.86%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified	0.86%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	31.03%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil	20.69%
Vadose Zone Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil	11.21%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil	6.03%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	4.31%
Surface Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil	3.45%
Agricultural Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil	3.45%
Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil	3.45%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	2.59%
Hardwood Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil	2.59%
Populus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere	2.59%
Sediment	Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Sediment → Sediment	1.72%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil	1.72%
Iron-Sulfur Acid Spring	Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring	0.86%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	0.86%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil	0.86%
Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil	0.86%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil	0.86%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere	0.86%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300005187	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124	Environmental	Open in IMG/M
3300005451	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130	Environmental	Open in IMG/M
3300005533	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1	Environmental	Open in IMG/M
3300005536	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG	Environmental	Open in IMG/M
3300005537	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1	Environmental	Open in IMG/M
3300005540	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146	Environmental	Open in IMG/M
3300005541	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1	Environmental	Open in IMG/M
3300005764	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)	Environmental	Open in IMG/M
3300006028	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG	Environmental	Open in IMG/M
3300006032	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145	Environmental	Open in IMG/M
3300006755	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter	Environmental	Open in IMG/M
3300006804	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200	Environmental	Open in IMG/M
3300006806	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100	Environmental	Open in IMG/M
3300006854	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4	Host-Associated	Open in IMG/M
3300006893	Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG	Environmental	Open in IMG/M
3300007076	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4	Host-Associated	Open in IMG/M
3300009089	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG	Environmental	Open in IMG/M
3300009090	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG	Environmental	Open in IMG/M
3300009792	Tropical forest soil microbial communities from Panama - MetaG Plot_12	Environmental	Open in IMG/M
3300010043	Tropical forest soil microbial communities from Panama - MetaG Plot_26	Environmental	Open in IMG/M
3300010046	Tropical forest soil microbial communities from Panama - MetaG Plot_36	Environmental	Open in IMG/M
3300010047	Tropical forest soil microbial communities from Panama - MetaG Plot_30	Environmental	Open in IMG/M
3300010048	Tropical forest soil microbial communities from Panama - MetaG Plot_11	Environmental	Open in IMG/M
3300010359	Tropical forest soil microbial communities from Panama - MetaG Plot_15	Environmental	Open in IMG/M
3300010361	Tropical forest soil microbial communities from Panama - MetaG Plot_23	Environmental	Open in IMG/M
3300010366	Tropical forest soil microbial communities from Panama - MetaG Plot_24	Environmental	Open in IMG/M
3300010376	Tropical forest soil microbial communities from Panama - MetaG Plot_28	Environmental	Open in IMG/M
3300010398	Tropical forest soil microbial communities from Panama - MetaG Plot_35	Environmental	Open in IMG/M
3300010937	Fumarole sediment microbial communities, Furnas, Sao Miguel, Azores. Combined Assembly of Gp0156138, Gp0156139	Environmental	Open in IMG/M
3300011270	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG	Environmental	Open in IMG/M
3300012199	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG	Environmental	Open in IMG/M
3300012201	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG	Environmental	Open in IMG/M
3300012210	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG	Environmental	Open in IMG/M
3300012211	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG	Environmental	Open in IMG/M
3300012356	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG	Environmental	Open in IMG/M
3300012357	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG	Environmental	Open in IMG/M
3300012971	Tropical forest soil microbial communities from Panama - MetaG Plot_1	Environmental	Open in IMG/M
3300012977	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaG	Environmental	Open in IMG/M
3300014157	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaG	Environmental	Open in IMG/M
3300015374	Col-0 rhizosphere combined assembly	Host-Associated	Open in IMG/M
3300018482	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118	Environmental	Open in IMG/M
3300020582	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O	Environmental	Open in IMG/M
3300021171	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M	Environmental	Open in IMG/M
3300021401	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O	Environmental	Open in IMG/M
3300021407	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O	Environmental	Open in IMG/M
3300021432	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M	Environmental	Open in IMG/M
3300021559	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M	Environmental	Open in IMG/M
3300021560	Tropical forest soil microbial communities from Panama - MetaG Plot_4	Environmental	Open in IMG/M
3300025910	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)	Environmental	Open in IMG/M
3300025922	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)	Environmental	Open in IMG/M
3300025929	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes)	Environmental	Open in IMG/M
3300026557	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal	Environmental	Open in IMG/M
3300027527	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 6 MoBio (SPAdes)	Environmental	Open in IMG/M
3300027725	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 (SPAdes)	Environmental	Open in IMG/M
3300027826	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 (SPAdes)	Environmental	Open in IMG/M
3300027862	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes)	Environmental	Open in IMG/M
3300027882	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes)	Environmental	Open in IMG/M
3300031543	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20	Environmental	Open in IMG/M
3300031544	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26	Environmental	Open in IMG/M
3300031572	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19	Environmental	Open in IMG/M
3300031640	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23	Environmental	Open in IMG/M
3300031668	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23	Environmental	Open in IMG/M
3300031682	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22	Environmental	Open in IMG/M
3300031708	FICUS49499 Metagenome Czech Republic combined assembly	Environmental	Open in IMG/M
3300031713	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22	Environmental	Open in IMG/M
3300031720	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515	Environmental	Open in IMG/M
3300031724	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20	Environmental	Open in IMG/M
3300031740	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05	Environmental	Open in IMG/M
3300031748	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22	Environmental	Open in IMG/M
3300031751	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24	Environmental	Open in IMG/M
3300031765	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22	Environmental	Open in IMG/M
3300031780	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f21	Environmental	Open in IMG/M
3300031805	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23	Environmental	Open in IMG/M
3300031831	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f20	Environmental	Open in IMG/M
3300031833	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178	Environmental	Open in IMG/M
3300031890	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2)	Environmental	Open in IMG/M
3300031893	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28	Environmental	Open in IMG/M
3300031912	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2)	Environmental	Open in IMG/M
3300031942	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176	Environmental	Open in IMG/M
3300031945	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082	Environmental	Open in IMG/M
3300032008	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18	Environmental	Open in IMG/M
3300032035	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170	Environmental	Open in IMG/M
3300032067	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22	Environmental	Open in IMG/M
3300032068	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21	Environmental	Open in IMG/M
3300032089	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23	Environmental	Open in IMG/M
3300032091	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25	Environmental	Open in IMG/M
3300032180	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515	Environmental	Open in IMG/M
3300032261	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)	Environmental	Open in IMG/M
3300032805	Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
Ga0066675_104540602	3300005187	Soil	MRGRLVYSFHMGRHTAERGPANDVFMATVVTALLLLCVIILALAAN*
Ga0066681_100797572	3300005451	Soil	MRGRLVYSFHMGRHTAERGPANDVFMATVVTALLLLCVIILALAAT*
Ga0070734_100090437	3300005533	Surface Soil	VYSFFMGRHTAERGPANDLFMATVVGALLLLCVIILALAMN*
Ga0070697_1001928201	3300005536	Corn, Switchgrass And Miscanthus Rhizosphere	SRVYSFLMGRHTAERGPANDLFMATILAALLLLCVATLALAMN*
Ga0070730_101366672	3300005537	Surface Soil	MGRHASERGPANDLFMAAVLGALLLLCTIVLALAAS*
Ga0066697_101717582	3300005540	Soil	MRGRLVYSFHMGRHTAERGPANDVFMATVVTALLLLCVIILALA
Ga0070733_102758512	3300005541	Surface Soil	MGRHTAERGPANDLFMAAVVVALLLLFMIIMALAANWA*
Ga0066903_1001608792	3300005764	Tropical Forest Soil	MGRHAAERGPSNDVFMATVLSALLLLCMIILALASWP*
Ga0066903_1003517732	3300005764	Tropical Forest Soil	MGRHAAERGPANDMFMATVVSALLLLCMIILALAGNWA*
Ga0066903_1016779872	3300005764	Tropical Forest Soil	MGRHAAERGPSNDMFMATVVSALVLLGMIMLTLAGNWA*
Ga0066903_1020448762	3300005764	Tropical Forest Soil	MGRHAAESGPSNDLFMATVLSALLLLFMIILTLASWH*
Ga0066903_1047165072	3300005764	Tropical Forest Soil	MGRHAAERGPSNDMFMATVLSALLLLCMIILALASWP*
Ga0066903_1060331322	3300005764	Tropical Forest Soil	GARVYSFFMGRHTAERGPANDLFMATVLGALLLLCVIILTLAAN*
Ga0070717_104116482	3300006028	Corn, Switchgrass And Miscanthus Rhizosphere	MGRHTAERGPANDLFMATVLGALLLLFVIVLALAAN*
Ga0066696_108783402	3300006032	Soil	MGRHTAERGPANDVFMATVVTALLLLCVIILALAAN*
Ga0079222_118210142	3300006755	Agricultural Soil	MGRHAAERGPSNDVFMATVLSALLLLSMIIFTLASWP*
Ga0079221_109918912	3300006804	Agricultural Soil	MGRHAAERGPSNDLFMATVLSALLLLCLIILALASWP*
Ga0079220_101626852	3300006806	Agricultural Soil	MGRHTAERGPANDLFMATIVGALLLLCVIILTLAAN*
Ga0075425_1000382705	3300006854	Populus Rhizosphere	MGRHAAERGPSNDLFMATVLSALLLLCMIILALASWP*
Ga0073928_102729772	3300006893	Iron-Sulfur Acid Spring	MGRHTAERGPANDLFMAAVVVALLLLFMIIMALAANWP*
Ga0075435_1000073025	3300007076	Populus Rhizosphere	MGRHAAERGPSNDLFMATVLSALLLLCIIILALASWP*
Ga0075435_1006385051	3300007076	Populus Rhizosphere	MGRHTAERGPANDLFMATVLGALFLLCVIILTLAAN*
Ga0099828_102004593	3300009089	Vadose Zone Soil	MGRHTAERGPANDMFMVTVVGALLLLWMIILALAANWP*
Ga0099827_112395952	3300009090	Vadose Zone Soil	MGRHAAERGPANDWFMAVVLSALLLLFTIILALSMN*
Ga0126374_106438612	3300009792	Tropical Forest Soil	MGRHAAERGPSNDMFMVTVVSTLLLLCTIVLTLAGNWA*
Ga0126380_100007617	3300010043	Tropical Forest Soil	MGRHAAERGPANDMFMVTVVSALILFCVIILTLAGNWA*
Ga0126384_104201972	3300010046	Tropical Forest Soil	MGRHAAERGPANDMFMVTVVSALILLCAIILTLAGNWA*
Ga0126384_106230632	3300010046	Tropical Forest Soil	MGRHAAERGPSNDMFMATVVSALFLLCMIVLTLAGNWA*
Ga0126382_116107212	3300010047	Tropical Forest Soil	VYSFFMGRHTAERGPANDLFMATILGALLLLCVIILTLAAS*
Ga0126373_114081021	3300010048	Tropical Forest Soil	MGRHAAERGPSNDVFMATVLSALLLLFMIILALASWP*
Ga0126373_117706152	3300010048	Tropical Forest Soil	MGRHTAERGPANDLFMATVLGALLLLCAIILALAAG*
Ga0126376_107227092	3300010359	Tropical Forest Soil	MGRHTAERGPANDLFMATILGALLLLCVIILTLAAS*
Ga0126376_108499662	3300010359	Tropical Forest Soil	MGRHTAERGPANDLFMATIVGALLLLCVIILTLAMN*
Ga0126378_103365152	3300010361	Tropical Forest Soil	VYSFFMGRHTAERGPANDLFMATVLGALLLLCVIILTLAAN*
Ga0126379_114151432	3300010366	Tropical Forest Soil	RVYSFFMGRHTAERGPANDLFMATVLAALLLLCVIILTLAAN*
Ga0126379_121720652	3300010366	Tropical Forest Soil	VYSFFMGRHTAERGPANDLFMATVVAALLLLCVIILALAAN*
Ga0126381_1004992322	3300010376	Tropical Forest Soil	MGRHAAERGPSNDMFMATVLSALLLLCLIILALASWP*
Ga0126381_1014835562	3300010376	Tropical Forest Soil	MGRHAAERGPSNDMFMATVLCALLLLCMIILALASWP*
Ga0126383_110093061	3300010398	Tropical Forest Soil	ARVYSFFMGRHTAERGPANDLFMATVVGALLLLCVIILTLAAN*
Ga0137776_11880134	3300010937	Sediment	MGRHTAERGPANDVFMTTVLAALLVLCVTILALAMN*
Ga0137776_12076443	3300010937	Sediment	VYSFFMGRHTAERGPANDLFMTTIVGALLLLCVIILALAMN*
Ga0137391_111900812	3300011270	Vadose Zone Soil	VYSFHMGRHTAERGPANDLFMVAVLSALLVLCAIILALAAN*
Ga0137383_100895502	3300012199	Vadose Zone Soil	MGRHAAERGPANDLFMAVVLSALLLLFAIILALSMN*
Ga0137365_101088822	3300012201	Vadose Zone Soil	MGRHAAERGPANDLFMSVVLSALLLLFTIILALSMN*
Ga0137378_103667282	3300012210	Vadose Zone Soil	MGRHAAERGPANDLFMAVVLSALLLLFTIILALSMN*
Ga0137378_108791481	3300012210	Vadose Zone Soil	MGRHTAERGPANDLFMVAVLSALLVLCAIILTLAAN*
Ga0137377_101455482	3300012211	Vadose Zone Soil	MGRHAAERGPSNDLFMATVLSALLLLCVIILALASWP*
Ga0137371_105467721	3300012356	Vadose Zone Soil	MGRHAAERGPANDLFMAVVLSALLLLFTIVLALSMN*
Ga0137384_101298613	3300012357	Vadose Zone Soil	RHAAERGPANDLFMAVVLSALLLLFTIVLALSMN*
Ga0126369_110862152	3300012971	Tropical Forest Soil	MGRHTAERGPANDLFMATVVGALLLLCVIILALAAN*
Ga0126369_120799941	3300012971	Tropical Forest Soil	MGRHEAGRGPANDMFMVTVVSALLVLLAIIVALAAG*
Ga0134087_104517222	3300012977	Grasslands Soil	MRGRLVYSFHMGRHTADRGPANDVFMATVVTALLLLCVIILALAVN*
Ga0134078_103589382	3300014157	Grasslands Soil	PMRGRLVYSFHMGRHTAERGPANDVFMATVVTALLLLCVIILALAAN*
Ga0132255_1053769532	3300015374	Arabidopsis Rhizosphere	GRHAAERGPSNDVFMATVLSALLLLSMIIFTLASWP*
Ga0066669_102660832	3300018482	Grasslands Soil	MRGRLVYSFHMGRHTAERGPANDVFMATVVTALLLLCVIILALAAN
Ga0210395_109032881	3300020582	Soil	MGRHTAERGPANDLFMAAVVVALLLLFMIIMALAANWP
Ga0210405_105707001	3300021171	Soil	MGRHTAERGPANDLFMATVVVALLLLFMIVMALAANWA
Ga0210393_108352291	3300021401	Soil	VYSFHMGRHTAERGPANDLFMVAVLSALLVLCAVILALAAN
Ga0210383_103113382	3300021407	Soil	MGRHTAERGPANDSFMAAVVVALLLLFLIIMALAAS
Ga0210384_105712921	3300021432	Soil	MGRHTAERGPANDLFMVAVVSALLVLCAVILALAAN
Ga0210409_101375591	3300021559	Soil	MGRHTAERGPANDLFMATVVVALLLLFMIIMALAANWP
Ga0126371_103506692	3300021560	Tropical Forest Soil	MGRHTAERGPANDLFMATVVGVLLLLCVIILALAMN
Ga0126371_104284472	3300021560	Tropical Forest Soil	MGRHEAGRGPANDMFMVTVVSALLVLLAIIVALAAG
Ga0126371_113578442	3300021560	Tropical Forest Soil	FFMGRHTAERGPANDLFMATVLGALLLLCAIILALAAG
Ga0126371_113667922	3300021560	Tropical Forest Soil	MGRHTAERGPANDLFMATVVGALLLLCVIILALAAN
Ga0126371_120836522	3300021560	Tropical Forest Soil	MGRHAAERGPSNDMFMATVLSALLLLCMIILALASWP
Ga0126371_122494411	3300021560	Tropical Forest Soil	MGRHGAERGPANDLFMATVLSALLLLCTIILALAM
Ga0126371_123509442	3300021560	Tropical Forest Soil	MGRHVAERGPSNDLFMATVLSALLLLCLVIFALASWP
Ga0207684_1000298415	3300025910	Corn, Switchgrass And Miscanthus Rhizosphere	MGRHAAERGPATDLFMATVLSALLLLFMIIMALAA
Ga0207684_102365411	3300025910	Corn, Switchgrass And Miscanthus Rhizosphere	MGRHTAERGPANDLFMAAVLAALLLLCVATLALAMN
Ga0207646_100588505	3300025922	Corn, Switchgrass And Miscanthus Rhizosphere	MGRHTAERGPANDLFMATILAALLLLCVATLALAMN
Ga0207664_109669652	3300025929	Agricultural Soil	RHAAERGPSNDLFMATVLSALLLLCVIILALASWP
Ga0179587_100219662	3300026557	Vadose Zone Soil	MGRHTAERGPANDLFMVAVLSALLVLCAVILALAAN
Ga0209684_10311582	3300027527	Tropical Forest Soil	MGRHAAERGPANDMFMATVVSALLLLCMIILALAGNWA
Ga0209178_10368371	3300027725	Agricultural Soil	VYSFFMGRHTAERGPANDLFMATVVTALLLLFVIILALAMN
Ga0209060_103724211	3300027826	Surface Soil	VYSFFMGRHTAERGPANDLFMATVVGALLLLCVIILALAMN
Ga0209701_105384162	3300027862	Vadose Zone Soil	MGRHTAERGPANDMFMVTVVGALLLLWMIILALAANWP
Ga0209590_108616491	3300027882	Vadose Zone Soil	MGRHAAERGPANDWFMAVVLSALLLLFTIILALSMN
Ga0318516_107756612	3300031543	Soil	MGRHAAERGPSTDLFMASVVSALLLLCTIILALAS
Ga0318516_108748991	3300031543	Soil	MGRHTAERGPANDLFMATVLGALLLLCVIILTLAAN
Ga0318534_103005532	3300031544	Soil	MGRHAAERGPSNDLFMATVLSALLLLCMIILALASWP
Ga0318534_105959962	3300031544	Soil	VYSFFMGRHTAERGPANDLFMATVVAALLLLCVIILTLAAN
Ga0318534_106101162	3300031544	Soil	MGRHTAERGPANDLFMATVLAALLLLCVIILALAAS
Ga0318515_100579462	3300031572	Soil	VYSFFMGRHTAERGPANDLFMATVLAALLLLCVIILALAAS
Ga0318515_103416822	3300031572	Soil	TQVYSFFMGRHTAERGPANDLFMATVVAALLLLCVIILTLAAN
Ga0318555_100334421	3300031640	Soil	MGRPAAERGPSTDLFMATVVSALLLLCTIILALAS
Ga0318555_101183511	3300031640	Soil	MGRHAAERGPSNDVFMATVLSALLLLFMIILALASWP
Ga0318542_100560052	3300031668	Soil	MGRHTAERGPANDLFMTTVVGTLLLLCVIILTLAAN
Ga0318542_104548992	3300031668	Soil	MGRHAAERGPANDMYMATVVSALLLLCMITLTLAGNWA
Ga0318560_107438821	3300031682	Soil	FFMGRHTAERGPANDLFMATVVAALLLLCVIILTLAAN
Ga0310686_1064158282	3300031708	Soil	MGRHTAERGPANDLFMATVVVALLLLFMIIMALAAS
Ga0318496_105521821	3300031713	Soil	MGRHTAERGPANDLFMATVLSALLLLCTVILALAS
Ga0307469_104909452	3300031720	Hardwood Forest Soil	MGRHAAERGPSNDLFMATVLSALLLLCVIILALASWP
Ga0318500_107067542	3300031724	Soil	MGRHTAERGPANDLFMATVVAALLLLCVIILTLAAN
Ga0307468_1017920382	3300031740	Hardwood Forest Soil	MGRHTAERGPANDLFIATVLGALLLLFVIVLALDAN
Ga0318492_106422082	3300031748	Soil	CRASYMGRHTAERGPANDLFMATVLSALLLLCTVILALAS
Ga0318494_107042782	3300031751	Soil	MGRHTAERGPANDLFMATVVAALLLLCVIILALAAS
Ga0318554_105849862	3300031765	Soil	MGRHAAERGPSNDLFMATVLSALLLLCMIVLALASW
Ga0318508_11890891	3300031780	Soil	CMGRHAAERGPSNDLFMATVLSALLLLCMIILALASWP
Ga0318497_100280403	3300031805	Soil	MGRHAAERGPANDLFMATVVSALLLLCTIILALAS
Ga0318564_101354151	3300031831	Soil	ASCMGRHAAERGPSNDLFMATVLSALLLLCMIILALASWP
Ga0310917_101458312	3300031833	Soil	MGRHAAERGPSNDLFMATVLSALLLLCMIILALAIWP
Ga0306925_106308582	3300031890	Soil	MGRHAAERGPANDMLMVTVVSALLLLCMIILALASWP
Ga0318536_105647492	3300031893	Soil	ASYMGRHTAERGPANDLFMATVLSALLLLCTVILALAS
Ga0306921_110255401	3300031912	Soil	GRHAAERGPSNDLFMATVLSALLLLCMIVLALASWP
Ga0310916_100094867	3300031942	Soil	MGRHTAERGPANDLFMATVVAVLLLLCVIILTLAAN
Ga0310913_102096582	3300031945	Soil	SCMGRHAAERGPSNDLFMATVLSALLLLCMIILALASWP
Ga0318562_100502501	3300032008	Soil	CRASYMGRHAAERGPSTDLFMASVVSALLLLCTIILALAS
Ga0310911_107466842	3300032035	Soil	MGRHAAERGPANDMYMATVVSALLLLCMITLTLAGN
Ga0318524_100488441	3300032067	Soil	MGRHAAERGPSTDLFMATVVSALLLLCTIILALAS
Ga0318553_107478202	3300032068	Soil	CMGRHAAERGPANDLFMATVLSALLLLCMIILALASWP
Ga0318525_106875452	3300032089	Soil	VYSFFMGRHTAERGPANDLFMATVLAALLLLCAIILTLAVN
Ga0318577_105209172	3300032091	Soil	YMGRHAAERGPSNDVFMATVLSALLLLFMIILALASWP
Ga0307471_1024293951	3300032180	Hardwood Forest Soil	ARGCRGSYMGRHAAERGPSNDVFMATVLSALLLLCVIILALASWP
Ga0306920_1020251412	3300032261	Soil	MGRHAAERGPANDMFMVTVVSALLLLCMIILALASWP
Ga0335078_100043405	3300032805	Soil	MGRHGAEREPANDLFMVTVVCALLLLFVIILALAMN

Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome Family F078544

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences