NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F079157

Metagenome / Metatranscriptome Family F079157

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F079157
Family Type Metagenome / Metatranscriptome
Number of Sequences 116
Average Sequence Length 39 residues
Representative Sequence MLRADLLKPDLVSEVVLLGSGALLFVSLLLIVVTALTRA
Number of Associated Samples 101
Number of Associated Scaffolds 116

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 83.33 %
% of genes near scaffold ends (potentially truncated) 18.97 %
% of genes from short scaffolds (< 2000 bps) 68.97 %
Associated GOLD sequencing projects 94
AlphaFold2 3D model prediction Yes
3D model pTM-score0.51

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (80.172 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(14.655 % of family members)
Environment Ontology (ENVO) Unclassified
(26.724 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(50.000 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 50.75%    β-sheet: 0.00%    Coil/Unstructured: 49.25%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.51
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 116 Family Scaffolds
PF13545HTH_Crp_2 7.76
PF00027cNMP_binding 5.17
PF00196GerE 2.59
PF11154DUF2934 2.59
PF04366Ysc84 2.59
PF02607B12-binding_2 1.72
PF12779WXXGXW 1.72
PF13088BNR_2 0.86
PF00092VWA 0.86
PF00383dCMP_cyt_deam_1 0.86
PF01627Hpt 0.86
PF07610DUF1573 0.86
PF00011HSP20 0.86
PF03544TonB_C 0.86
PF13466STAS_2 0.86
PF09335SNARE_assoc 0.86
PF01479S4 0.86
PF11964SpoIIAA-like 0.86
PF00075RNase_H 0.86
PF13751DDE_Tnp_1_6 0.86
PF00691OmpA 0.86
PF08240ADH_N 0.86
PF07730HisKA_3 0.86
PF14310Fn3-like 0.86

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 116 Family Scaffolds
COG2930Lipid-binding SYLF domain, Ysc84/FYVE familyLipid transport and metabolism [I] 2.59
COG0071Small heat shock protein IbpA, HSP20 familyPosttranslational modification, protein turnover, chaperones [O] 0.86
COG0398Uncharacterized membrane protein YdjX, related to fungal oxalate transporter, TVP38/TMEM64 familyFunction unknown [S] 0.86
COG0586Membrane integrity protein DedA, putative transporter, DedA/Tvp38 familyCell wall/membrane/envelope biogenesis [M] 0.86
COG0810Periplasmic protein TonB, links inner and outer membranesCell wall/membrane/envelope biogenesis [M] 0.86
COG1238Uncharacterized membrane protein YqaA, VTT domainFunction unknown [S] 0.86
COG3850Signal transduction histidine kinase NarQ, nitrate/nitrite-specificSignal transduction mechanisms [T] 0.86
COG3851Signal transduction histidine kinase UhpB, glucose-6-phosphate specificSignal transduction mechanisms [T] 0.86
COG4564Signal transduction histidine kinaseSignal transduction mechanisms [T] 0.86
COG4585Signal transduction histidine kinase ComPSignal transduction mechanisms [T] 0.86

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms80.17 %
UnclassifiedrootN/A19.83 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000567|JGI12270J11330_10007768All Organisms → cellular organisms → Bacteria7379Open in IMG/M
3300000789|JGI1027J11758_13000068All Organisms → cellular organisms → Bacteria → Acidobacteria876Open in IMG/M
3300000955|JGI1027J12803_105269753All Organisms → cellular organisms → Bacteria2529Open in IMG/M
3300002917|JGI25616J43925_10018250All Organisms → cellular organisms → Bacteria3110Open in IMG/M
3300004092|Ga0062389_102138790All Organisms → cellular organisms → Bacteria → Acidobacteria734Open in IMG/M
3300004102|Ga0058888_1433764All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium840Open in IMG/M
3300004104|Ga0058891_1001135All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1024Open in IMG/M
3300004104|Ga0058891_1390027All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium648Open in IMG/M
3300004104|Ga0058891_1500940All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium1219Open in IMG/M
3300004120|Ga0058901_1339249Not Available509Open in IMG/M
3300004137|Ga0058883_1454703All Organisms → cellular organisms → Bacteria → Acidobacteria570Open in IMG/M
3300004631|Ga0058899_10737178Not Available874Open in IMG/M
3300005181|Ga0066678_11021498All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium535Open in IMG/M
3300005338|Ga0068868_100055040All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium3138Open in IMG/M
3300005354|Ga0070675_100658028All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium952Open in IMG/M
3300005441|Ga0070700_101353287All Organisms → cellular organisms → Bacteria → Acidobacteria600Open in IMG/M
3300005445|Ga0070708_100502589All Organisms → cellular organisms → Bacteria → Acidobacteria1144Open in IMG/M
3300005445|Ga0070708_100605520All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1033Open in IMG/M
3300005447|Ga0066689_10968325All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium524Open in IMG/M
3300005467|Ga0070706_100136388Not Available2291Open in IMG/M
3300005468|Ga0070707_100011196All Organisms → cellular organisms → Bacteria8360Open in IMG/M
3300005536|Ga0070697_100298944All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1383Open in IMG/M
3300005536|Ga0070697_100396647All Organisms → cellular organisms → Bacteria1197Open in IMG/M
3300005541|Ga0070733_10038188All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2995Open in IMG/M
3300005542|Ga0070732_10004718All Organisms → cellular organisms → Bacteria7378Open in IMG/M
3300005555|Ga0066692_10438554All Organisms → cellular organisms → Bacteria831Open in IMG/M
3300005576|Ga0066708_10511234All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium774Open in IMG/M
3300005598|Ga0066706_10833545All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium724Open in IMG/M
3300005602|Ga0070762_10020950All Organisms → cellular organisms → Bacteria3413Open in IMG/M
3300005841|Ga0068863_100274824All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1631Open in IMG/M
3300006028|Ga0070717_10031639All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium4258Open in IMG/M
3300006028|Ga0070717_10984786All Organisms → cellular organisms → Bacteria → Acidobacteria768Open in IMG/M
3300006172|Ga0075018_10527145All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium619Open in IMG/M
3300006358|Ga0068871_100655657All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium958Open in IMG/M
3300006800|Ga0066660_10159214All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1682Open in IMG/M
3300009012|Ga0066710_100099696All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae3880Open in IMG/M
3300009551|Ga0105238_12463301All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium556Open in IMG/M
3300010373|Ga0134128_12979036Not Available521Open in IMG/M
3300011120|Ga0150983_10327167Not Available522Open in IMG/M
3300011120|Ga0150983_12002057All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium904Open in IMG/M
3300011120|Ga0150983_12042672All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium698Open in IMG/M
3300011120|Ga0150983_12445177Not Available695Open in IMG/M
3300011120|Ga0150983_13989070Not Available1316Open in IMG/M
3300011269|Ga0137392_10650608Not Available874Open in IMG/M
3300012207|Ga0137381_10010459All Organisms → cellular organisms → Bacteria → Acidobacteria7077Open in IMG/M
3300012207|Ga0137381_10082134All Organisms → cellular organisms → Bacteria → Acidobacteria2709Open in IMG/M
3300012357|Ga0137384_10144548All Organisms → cellular organisms → Bacteria → Acidobacteria1991Open in IMG/M
3300012918|Ga0137396_10172121All Organisms → cellular organisms → Bacteria1584Open in IMG/M
3300012929|Ga0137404_10170889All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1823Open in IMG/M
3300012930|Ga0137407_10103986All Organisms → cellular organisms → Bacteria → Acidobacteria2440Open in IMG/M
3300012955|Ga0164298_10414351All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium875Open in IMG/M
3300012960|Ga0164301_11327441All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium584Open in IMG/M
3300013296|Ga0157374_12806997All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium515Open in IMG/M
3300014491|Ga0182014_10004754All Organisms → cellular organisms → Bacteria15393Open in IMG/M
3300016698|Ga0181503_1324364Not Available541Open in IMG/M
3300016705|Ga0181507_1202649All Organisms → cellular organisms → Bacteria → Acidobacteria602Open in IMG/M
3300017929|Ga0187849_1324187All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium572Open in IMG/M
3300017940|Ga0187853_10422661All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium588Open in IMG/M
3300018061|Ga0184619_10158155All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1035Open in IMG/M
3300018482|Ga0066669_10224838All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Acidobacteriales bacterium 13_1_40CM_3_55_51461Open in IMG/M
3300019865|Ga0193748_1007667All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium941Open in IMG/M
3300019879|Ga0193723_1162186All Organisms → cellular organisms → Bacteria590Open in IMG/M
3300019885|Ga0193747_1051451All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1023Open in IMG/M
3300019887|Ga0193729_1105543All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1066Open in IMG/M
3300020022|Ga0193733_1090896All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium854Open in IMG/M
3300020579|Ga0210407_11388769Not Available521Open in IMG/M
3300020580|Ga0210403_10006813All Organisms → cellular organisms → Bacteria → Acidobacteria9553Open in IMG/M
3300020581|Ga0210399_11170330Not Available612Open in IMG/M
3300020583|Ga0210401_10079452All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium3087Open in IMG/M
3300021046|Ga0215015_10477440All Organisms → cellular organisms → Bacteria → Acidobacteria801Open in IMG/M
3300021168|Ga0210406_10001348All Organisms → cellular organisms → Bacteria30117Open in IMG/M
3300021170|Ga0210400_10001335All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae24620Open in IMG/M
3300021171|Ga0210405_10002794All Organisms → cellular organisms → Bacteria17739Open in IMG/M
3300021171|Ga0210405_10029244All Organisms → cellular organisms → Bacteria4421Open in IMG/M
3300021344|Ga0193719_10128838All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1098Open in IMG/M
3300021401|Ga0210393_11316465Not Available579Open in IMG/M
3300021405|Ga0210387_11854386Not Available507Open in IMG/M
3300021432|Ga0210384_10310886All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1419Open in IMG/M
3300021432|Ga0210384_10388302All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1257Open in IMG/M
3300021477|Ga0210398_10005262All Organisms → cellular organisms → Bacteria → Acidobacteria12042Open in IMG/M
3300021478|Ga0210402_10387788All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1297Open in IMG/M
3300021478|Ga0210402_11857432Not Available528Open in IMG/M
3300021479|Ga0210410_10066825Not Available3147Open in IMG/M
3300023101|Ga0224557_1281962All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Occallatibacter → Occallatibacter savannae535Open in IMG/M
3300023544|Ga0247542_100666All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1006Open in IMG/M
3300025315|Ga0207697_10385665All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium622Open in IMG/M
3300025901|Ga0207688_10126788All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1493Open in IMG/M
3300025904|Ga0207647_10006262All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium8668Open in IMG/M
3300025910|Ga0207684_10299511Not Available1386Open in IMG/M
3300025914|Ga0207671_10688565All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium813Open in IMG/M
3300025927|Ga0207687_10130773Not Available1892Open in IMG/M
3300025930|Ga0207701_10010838All Organisms → cellular organisms → Bacteria → Acidobacteria8976Open in IMG/M
3300025938|Ga0207704_10200836All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1459Open in IMG/M
3300026023|Ga0207677_10215079All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1538Open in IMG/M
3300026075|Ga0207708_10106450All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2175Open in IMG/M
3300026088|Ga0207641_10014334All Organisms → cellular organisms → Bacteria → Acidobacteria6496Open in IMG/M
3300026304|Ga0209240_1026823All Organisms → cellular organisms → Bacteria2204Open in IMG/M
3300027842|Ga0209580_10004784All Organisms → cellular organisms → Bacteria5768Open in IMG/M
3300027854|Ga0209517_10007371All Organisms → cellular organisms → Bacteria13210Open in IMG/M
3300028792|Ga0307504_10369908Not Available557Open in IMG/M
3300030775|Ga0074021_1588240All Organisms → cellular organisms → Bacteria → Acidobacteria593Open in IMG/M
3300031708|Ga0310686_109486334All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae6577Open in IMG/M
3300031708|Ga0310686_118115191All Organisms → cellular organisms → Bacteria → Acidobacteria2691Open in IMG/M
3300031720|Ga0307469_10099035All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2040Open in IMG/M
3300031740|Ga0307468_100058803All Organisms → cellular organisms → Bacteria → Acidobacteria2061Open in IMG/M
3300031754|Ga0307475_10163770All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1771Open in IMG/M
3300031820|Ga0307473_10228475All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Acidobacteriales bacterium 13_1_40CM_3_55_51125Open in IMG/M
3300032180|Ga0307471_100370942All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Acidobacteriales bacterium 13_1_40CM_3_55_51549Open in IMG/M
3300032180|Ga0307471_101085049All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium967Open in IMG/M
3300032205|Ga0307472_102580006All Organisms → cellular organisms → Bacteria518Open in IMG/M
3300032805|Ga0335078_12604818Not Available518Open in IMG/M
3300033158|Ga0335077_10492397All Organisms → cellular organisms → Bacteria → Acidobacteria1298Open in IMG/M
3300033433|Ga0326726_12270652Not Available527Open in IMG/M
3300034090|Ga0326723_0412698Not Available614Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil14.66%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil11.21%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil10.34%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere9.48%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil6.90%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil6.03%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil6.03%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland3.45%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil3.45%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil3.45%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere2.59%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil1.72%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil1.72%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil1.72%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.72%
Corn, Switchgrass And Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere1.72%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.72%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil0.86%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.86%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds0.86%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.86%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere0.86%
BogEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Bog0.86%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil0.86%
SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Soil0.86%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.86%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere0.86%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.86%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.86%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.86%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.86%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000567Peat soil microbial communities from Weissenstadt, Germany - SII-2010EnvironmentalOpen in IMG/M
3300000789Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300000955Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300002917Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_100cmEnvironmentalOpen in IMG/M
3300004092Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3EnvironmentalOpen in IMG/M
3300004102Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF212 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004104Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF218 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004120Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF238 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004137Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF202 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004631Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF234 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300005181Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127EnvironmentalOpen in IMG/M
3300005338Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2Host-AssociatedOpen in IMG/M
3300005354Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaGHost-AssociatedOpen in IMG/M
3300005441Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaGEnvironmentalOpen in IMG/M
3300005445Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaGEnvironmentalOpen in IMG/M
3300005447Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138EnvironmentalOpen in IMG/M
3300005467Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaGEnvironmentalOpen in IMG/M
3300005468Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaGEnvironmentalOpen in IMG/M
3300005532Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen14_06102014_R1EnvironmentalOpen in IMG/M
3300005536Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaGEnvironmentalOpen in IMG/M
3300005541Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1EnvironmentalOpen in IMG/M
3300005542Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1EnvironmentalOpen in IMG/M
3300005555Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141EnvironmentalOpen in IMG/M
3300005576Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157EnvironmentalOpen in IMG/M
3300005598Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155EnvironmentalOpen in IMG/M
3300005602Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2EnvironmentalOpen in IMG/M
3300005841Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2Host-AssociatedOpen in IMG/M
3300006028Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaGEnvironmentalOpen in IMG/M
3300006172Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014EnvironmentalOpen in IMG/M
3300006358Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2Host-AssociatedOpen in IMG/M
3300006800Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109EnvironmentalOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009551Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaGHost-AssociatedOpen in IMG/M
3300010373Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4EnvironmentalOpen in IMG/M
3300011120Combined assembly of Microbial Forest Soil metaTEnvironmentalOpen in IMG/M
3300011269Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaGEnvironmentalOpen in IMG/M
3300012207Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaGEnvironmentalOpen in IMG/M
3300012357Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaGEnvironmentalOpen in IMG/M
3300012918Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaGEnvironmentalOpen in IMG/M
3300012929Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012930Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012955Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MGEnvironmentalOpen in IMG/M
3300012960Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MGEnvironmentalOpen in IMG/M
3300013296Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaGHost-AssociatedOpen in IMG/M
3300014491Permafrost microbial communities from Stordalen Mire, Sweden - 612S2D metaGEnvironmentalOpen in IMG/M
3300016698Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_30_metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016705Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300017929Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_100EnvironmentalOpen in IMG/M
3300017940Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_100EnvironmentalOpen in IMG/M
3300018061Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1EnvironmentalOpen in IMG/M
3300018482Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118EnvironmentalOpen in IMG/M
3300019865Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1s1EnvironmentalOpen in IMG/M
3300019879Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m2EnvironmentalOpen in IMG/M
3300019885Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1m2EnvironmentalOpen in IMG/M
3300019887Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c2EnvironmentalOpen in IMG/M
3300020022Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1s2EnvironmentalOpen in IMG/M
3300020579Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-MEnvironmentalOpen in IMG/M
3300020580Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-MEnvironmentalOpen in IMG/M
3300020581Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-MEnvironmentalOpen in IMG/M
3300020583Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-MEnvironmentalOpen in IMG/M
3300021046Soil microbial communities from Shale Hills CZO, Pennsylvania, United States - 90cm depthEnvironmentalOpen in IMG/M
3300021168Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-MEnvironmentalOpen in IMG/M
3300021170Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-MEnvironmentalOpen in IMG/M
3300021171Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-MEnvironmentalOpen in IMG/M
3300021344Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2EnvironmentalOpen in IMG/M
3300021401Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-OEnvironmentalOpen in IMG/M
3300021405Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-OEnvironmentalOpen in IMG/M
3300021432Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-MEnvironmentalOpen in IMG/M
3300021477Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-OEnvironmentalOpen in IMG/M
3300021478Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-MEnvironmentalOpen in IMG/M
3300021479Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-MEnvironmentalOpen in IMG/M
3300023101Peat soil microbial communities from Stordalen Mire, Sweden - 717 S3 10-14EnvironmentalOpen in IMG/M
3300023544Metatranscriptome of soil microbial communities from Bohemian Forest, Czech Republic ? CSU4 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300025315Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes)Host-AssociatedOpen in IMG/M
3300025901Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes)Host-AssociatedOpen in IMG/M
3300025904Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025910Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025914Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025927Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025930Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes)EnvironmentalOpen in IMG/M
3300025938Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025986Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026023Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026075Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026088Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026304Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_80cm (SPAdes)EnvironmentalOpen in IMG/M
3300027842Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027854Peat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes)EnvironmentalOpen in IMG/M
3300028792Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 19_SEnvironmentalOpen in IMG/M
3300030775Metatranscriptome of forest soil microbial communities from Dalarna County, Sweden - Site 2 - LB 9 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031708FICUS49499 Metagenome Czech Republic combined assemblyEnvironmentalOpen in IMG/M
3300031720Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515EnvironmentalOpen in IMG/M
3300031740Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05EnvironmentalOpen in IMG/M
3300031754Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515EnvironmentalOpen in IMG/M
3300031820Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300032805Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2EnvironmentalOpen in IMG/M
3300033158Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1EnvironmentalOpen in IMG/M
3300033433Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MNEnvironmentalOpen in IMG/M
3300034090Peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF00NEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI12270J11330_1000776893300000567Peatlands SoilMQRADLLKPDILSEIVLLGSGVLIFVLLLLVVLTALTRA*
JGI1027J11758_1300006823300000789SoilMHRADLLKADLLSEIVLLGTGALIXXALXLVXXTALTRP*
JGI1027J12803_10526975313300000955SoilMHRADLLKADLLSEIVLLGTGALIFFALLLVTMTALTRP*
JGI25616J43925_1001825023300002917Grasslands SoilMLQADLLKPDVLSETVLLGSGALLFVSLLLIVVTALTQA*
Ga0062389_10213879013300004092Bog Forest SoilMLRADLLKPDLLSELVLLCSGAVLLGSLLLIIVTALTQA*
Ga0058888_143376423300004102Forest SoilMLRADLLKPDLLSKAVLLGSCAFLFGSLLLVVVTAFRRA*
Ga0058891_100113513300004104Forest SoilMLRADLLKPDLLSKAVLLGSGALLFGSLLLVVVTAFKRA*
Ga0058891_139002723300004104Forest SoilMLRADLLKPDLLSELVLLGTAVLIFVSLVLIVATALNRP*
Ga0058891_150094023300004104Forest SoilMLRADLLKPDLLSEIVLLGSGALLFGSLLLIVVIVLTQA*
Ga0058901_133924923300004120Forest SoilMQRADLLKSDLVSELVLLGGGVLILVSLILIVATALTRV*
Ga0058883_145470313300004137Forest SoilMLRADLLKPDLLSKAVLLGSGALLFGSLLLVVVTAFRRA*
Ga0058899_1073717813300004631Forest SoilMLRADLLKADLLSEIVLLGSGVAILISLLLIVATVLNHA*
Ga0066678_1102149823300005181SoilEMLRTDLLKPDLVSELVLLGSGTLLFVSLLMIVVTALTRA*
Ga0068868_10005504023300005338Miscanthus RhizosphereMHRADLLKPDLLSEIVLLGAGALIFAALLLVTVTALARS*
Ga0070675_10065802833300005354Miscanthus RhizosphereMHRADLLKPDLLSEIVLLGAGALIFAALLFVTVTALARS*
Ga0070700_10135328713300005441Corn, Switchgrass And Miscanthus RhizosphereMHRADLLKPDLLSEILLLGTGALILVSVLLVTVTALARP*
Ga0070708_10050258923300005445Corn, Switchgrass And Miscanthus RhizosphereMLRADLLKPDLVSELVLLGSGALLLLSLLLFVVTAVARA*
Ga0070708_10060552023300005445Corn, Switchgrass And Miscanthus RhizosphereMLRADILKPDLVSEVVLLGSGALLVVSLLLIVVTALARA*
Ga0066689_1096832523300005447SoilMLRTDLLKPDLVSELVLLGSGTLLFVSLLMIVVTALTRA*
Ga0070706_10013638833300005467Corn, Switchgrass And Miscanthus RhizosphereMLQADLLKPDVLSETVLLGSGALLFVSLLLIVVTALTRA*
Ga0070707_10001119663300005468Corn, Switchgrass And Miscanthus RhizosphereMLRADLLKPDLVSELVLLGSAALLLLSLLLVILTAAARA*
Ga0070739_1002934533300005532Surface SoilMRSKDLLCPDLLSELVLLGFGMLILASLLLFLVTALTRP*
Ga0070697_10029894413300005536Corn, Switchgrass And Miscanthus RhizosphereMLRTDLLKPDLVSELVLLGSATLLLVSLLLIVVTAFTRA*
Ga0070697_10039664723300005536Corn, Switchgrass And Miscanthus RhizosphereMLRADLLKPDLVSEVVLLGSGALLFVSLLLIVVTALTRA*
Ga0070733_1003818843300005541Surface SoilMLRADLLKADLLSEIVLLGSGVLIVVSLVLVVVAALTRA*
Ga0070732_1000471853300005542Surface SoilMLREDLLKPDLLSEIVLISSAALLVISLLMIVVTALARA*
Ga0066692_1043855423300005555SoilMLRADLLKPDLVSELVLLVSGALLFASLMLVIVTALTRA*
Ga0066708_1051123413300005576SoilMLRADLLKPDLVSELVLLGSGTLLFFLVLVVVTAVARA*
Ga0066706_1083354533300005598SoilADILKPDLVSEVVLLGSGALLAVSLLLIVATALARA*
Ga0070762_1002095053300005602SoilMQRADLLKSDLLSELVLLGGGVLILVSLILIVATALTRV*
Ga0068863_10027482433300005841Switchgrass RhizosphereMHRADLLKPDLLSEIVLVGTGVLIFVALLLVTVTGLMRP*
Ga0070717_1003163943300006028Corn, Switchgrass And Miscanthus RhizosphereMLRADLLKPDLLSKAVLLGSGALLFGSLLLIVLTAFARA*
Ga0070717_1098478623300006028Corn, Switchgrass And Miscanthus RhizosphereMLRADLLKPDLLSKAVLLGTGALLFGSLLLIVITVLTRA*
Ga0075018_1052714513300006172WatershedsLMNPDLFSEIVLLGSGALLFVSLLLIVVNALTRA*
Ga0068871_10065565723300006358Miscanthus RhizosphereMHRADLLKPDLLSEIVLLGAGALIFVALLLVTVTALARS*
Ga0066660_1015921433300006800SoilMLRTDLLKPDPVSELVLLGSGTLLFVSLLMIVVTALTRA*
Ga0066710_10009969663300009012Grasslands SoilMLRADLLKPDLVSELVLLGSGALLFASLMLVIVTALTRA
Ga0105238_1246330113300009551Corn RhizosphereRRRAMHRADLLKPDLLSEIVLLGAGALIFAALLFVTVTALARS*
Ga0134128_1297903613300010373Terrestrial SoilMHRADLLKPDLLSEIVLLGAGALIFAALLFVTVTAL
Ga0150983_1032716713300011120Forest SoilMLRADILKPDLLSEIVLLGSGVLLFSSLLLVVVAAFTQA*
Ga0150983_1200205723300011120Forest SoilMLRPDLLKPDLLSKAVLLGSGALLFGSLLLVVLTAFRRV*
Ga0150983_1204267213300011120Forest SoilEGRSEMLRADLLKPDLLSEIVLLGSGALLFSSLLLIVVIVLAQA*
Ga0150983_1244517723300011120Forest SoilMLRAEILKPDLLSEIVLLGSGVLLFSSLLLVVVTALTQA*
Ga0150983_1398907023300011120Forest SoilMLHADLLKPDLLSEIVLLGSGALLFGSLLLIVVTVLTQA*
Ga0137392_1065060833300011269Vadose Zone SoilMLQADLLKPDVLSETVLLGSGALLFVSLLLIVVTAL
Ga0137381_1001045923300012207Vadose Zone SoilMVRADLLKPDLVSELVLLGSAALLLLSLLLVILTAAARA*
Ga0137381_1008213413300012207Vadose Zone SoilMLRADLLKPDLVSELVLLGSGALLFASLMLVIVTALTRA*
Ga0137384_1014454833300012357Vadose Zone SoilMVRADLLKTDLVSELVLLGSAALLLLSLLLVILTAAARA*
Ga0137396_1017212123300012918Vadose Zone SoilMHREDLLSPDLLSEIVLLGSGTLLLISVWLLVVIAFTRT*
Ga0137404_1017088933300012929Vadose Zone SoilMLRADLLKPDLVSELVLLGSGALLFFLVLVVVTAVARA*
Ga0137407_1010398633300012930Vadose Zone SoilMLRADLLKPDLVSELVLLGSAALLFAFIVAGLLTAAARA*
Ga0164298_1041435123300012955SoilTEMQRTDLLKPDLVSELVLLGCGALLVVSLLLVVIAALAPR*
Ga0164301_1132744123300012960SoilMLRTDLLKPDLVSELVLLGSGTLLFVSLLLIVVTALARP*
Ga0157374_1280699723300013296Miscanthus RhizosphereAMHRADLLKPDLLSEIVLLGAGALIFVALLFVTVTALARS*
Ga0182014_10004754183300014491BogMLRAEILKPDLLSEIVLLGSGVLLFSSLLLVVVTVLTQA*
Ga0181503_132436413300016698PeatlandVLRADLLQPDLFSKIVLMGSGALFLGSLFMVVMTALARA
Ga0181507_120264923300016705PeatlandVLRADLLKPDLFGKIVLMGSGALFLGSLFMVVMTALARA
Ga0187849_132418723300017929PeatlandCRSEKLRADLLKSRLLSKAVLLGSGPLLFGSLLLIVVTALIQA
Ga0187853_1042266113300017940PeatlandKLRADLLKSRLLSKAVLLGSGPLLFGSLLLIVVTALIQA
Ga0184619_1015815513300018061Groundwater SedimentMLRTDLLKPDLVSELVLLGSGTLLFVSLLMIVVTALTRA
Ga0066669_1022483823300018482Grasslands SoilMLRADLLKPDLVSELVLLGSGTLLFFLVLVVVTAVARA
Ga0193748_100766723300019865SoilMLRTDLLKPDLVSELVLLGSGTLLFVSVLLIVVTALARP
Ga0193723_116218623300019879SoilMLRADILKPDLVSEVVLLGSGALLVVSLLLIVLTALARA
Ga0193747_105145123300019885SoilMLRADILKPDLVSEVVLLGSGALLAISLLLIVVTALARA
Ga0193729_110554313300019887SoilMLRADLLKPDLLSEIVLLGSGALLFSSLLLIVVTVLTQT
Ga0193733_109089613300020022SoilRRRSEMLRTDLLKPDLVSELVLLGSGTLLFVSLLMIVVTALTRA
Ga0210407_1138876923300020579SoilMLRADLLKPDLLSKAVLLGSGALLFGSLLLVVVTAFKRA
Ga0210403_10006813123300020580SoilMLRADLLKPDLLSEIVLLGSGALLFGSLLLIVVIVLTQA
Ga0210399_1117033023300020581SoilMLRADLLKPDLLSEIVLLGSGALLFGSLLLLVVIVLTQA
Ga0210401_1007945243300020583SoilMLRADLLKADLLSEIVLLGSGVLIVVSLVLVVVAALTRA
Ga0215015_1047744023300021046SoilMLRADLLKPDLLSEIVLLGTGALLFGSLLLIVLTALTRA
Ga0210406_10001348333300021168SoilMLRADLLKPDLLSELVLLGTAVLIFVSLVLIVATALNRP
Ga0210400_10001335133300021170SoilMLRADLLKPGLLSKAVLLGSGALLFGSLLLVVVTAFKRA
Ga0210405_10002794123300021171SoilMLRADLLKRDLLSEIVLLGSGALLFGSLLLIVVTVLTQA
Ga0210405_1002924453300021171SoilMQRADLLKSDLLSELVLLGGGVLILVSLILIVATALTRV
Ga0193719_1012883833300021344SoilMLRADILKPDLVSEVVLLGSGALLVVSLLLIVLTALTRA
Ga0210393_1131646513300021401SoilMLRADLLKADLLSEIVLLGSGVAILISLLLIVATVLN
Ga0210387_1185438623300021405SoilMLRADLLKPDLLSELVLLGTAVLIFVSLVLILATALNRA
Ga0210384_1031088633300021432SoilMLRADLLKPDLLSEIVLLGSGALLFSSLLLIVVIVLAQA
Ga0210384_1038830223300021432SoilMLRADLLKPDLLSKAVLLGSGALLFGSLLLVVVTALRRA
Ga0210398_1000526233300021477SoilMLRADLLKADLLSEIVLLGSALAILMSLFLIVATVLNHA
Ga0210402_1038778813300021478SoilMLRADLLKRDLLSETVLVGSLILLVISLTLIVAVALTST
Ga0210402_1185743213300021478SoilPTRRTEMLRADLLKPDLLSELVLLGTAVLIFVSLVLILATALNRA
Ga0210410_1006682563300021479SoilMLRADILKPDLLSEIVLLGSGVLLFSSLLLVVVAAFTQA
Ga0224557_128196213300023101SoilLRAEILKPDLLSEIVLLGSGVLLFSSLLLVVVTVLTQA
Ga0247542_10066623300023544SoilMLRADLLKPDRLSKVVLLGSGALLFGSLLLIVATALTRA
Ga0207697_1038566523300025315Corn, Switchgrass And Miscanthus RhizosphereRADLLKPDLLSEILLLGTGALILVSVLLVTVTALARP
Ga0207688_1012678833300025901Corn, Switchgrass And Miscanthus RhizosphereMHRADLLKPDLLSEIVLLGAGALIFVALLFVTVTALARS
Ga0207647_1000626263300025904Corn RhizosphereMHRADLLKPDLLSEIVLLGAGALIFAALLFVTVTALARS
Ga0207684_1029951113300025910Corn, Switchgrass And Miscanthus RhizosphereMLQADLLKPDVLSETVLLGSGALLFVSLLLIVVTALTRA
Ga0207671_1068856533300025914Corn RhizosphereSEWEAHMHRADLLKPDLLSEILLLGTGALILVSVLLVTVTALARP
Ga0207687_1013077323300025927Miscanthus RhizosphereMHRADLLKPDLLSEIVLLGAGALIFVALLLVTVTALARS
Ga0207701_10010838143300025930Corn, Switchgrass And Miscanthus RhizosphereMHRADLLKPDLLSEILLLGTGALILVSVLLVTVTALARP
Ga0207704_1020083643300025938Miscanthus RhizosphereMHRADLLKPDLLSEIVLLGTGSLIFVALLLVTVAALMRP
Ga0207658_1172483213300025986Switchgrass RhizosphereVDPSMRRAMHRADLLKPDLLSEIVLLGAGALIFAALLFVTVTALARS
Ga0207677_1021507933300026023Miscanthus RhizosphereMHRADLLKPDLLSEIVLLGAGALIFAALLLVTVTALARS
Ga0207708_1010645013300026075Corn, Switchgrass And Miscanthus RhizosphereRADLLKPDLLSEIVLLGAGALIFAALLFVTVTALARS
Ga0207641_10014334103300026088Switchgrass RhizosphereMHRADLLKPDLLSEIVLVGTGVLIFVALLLVTVTGLMRP
Ga0209240_102682333300026304Grasslands SoilMLQADLLKPDVLSETVLLGSGALLFVSLLLIVVTALTQA
Ga0209580_1000478473300027842Surface SoilMVSPEWESKMLREDLLKPDLLSEIVLISSAALLVISLLMIVVTALARA
Ga0209517_10007371163300027854Peatlands SoilMQRADLLKPDILSEIVLLGSGVLIFVLLLLVVLTALTRA
Ga0307504_1036990813300028792SoilMLRLREDLLKPDLLSEVLLLVSGVVLFIPLLLVVVA
Ga0074021_158824023300030775SoilMLCADLLKPDLFSEIVLPGSGALLLGLLLLVVMTALARA
Ga0310686_10948633423300031708SoilMLRADLLKPDLLSEIVLLGSGALLLGSLLLVVMSALARA
Ga0310686_11811519113300031708SoilMLRADLLKPDLLSEIVLLGSGALLFGSLLLIVVSVLTRA
Ga0307469_1009903533300031720Hardwood Forest SoilMLRADLLKPDLLSKAVLLGTGAVIFGSLLLIVITVLTRA
Ga0307468_10005880323300031740Hardwood Forest SoilMLRADLLKPDLVSELVLLGSGALLLLSLLLFVVTAVERA
Ga0307475_1016377023300031754Hardwood Forest SoilMLRADLLKPDLLSKAVLLDTGALLFGSLLLIVITVLTRA
Ga0307473_1022847513300031820Hardwood Forest SoilVLRADLLKPDLVSELVLLGSGALLFFLLLVVVTAVAR
Ga0307471_10037094223300032180Hardwood Forest SoilMLRADLLKPDLVSELVLLGSGALLFFLLLVVVTAVARA
Ga0307471_10108504933300032180Hardwood Forest SoilADILKPDLVSEVVLLGSGALLVVSLLLIVVTALARA
Ga0307472_10258000613300032205Hardwood Forest SoilMLRADILKPDLVSEVILLGSGALLAVSLLLVVVTALARA
Ga0335078_1260481813300032805SoilMLRSELLKPDLLSEIVLLVTGALIFAFLLLIALTALTRA
Ga0335077_1049239713300033158SoilMLRADLLKPDLLSKIVLLGSGALIFFSLLLVVVTALTRA
Ga0326726_1227065213300033433Peat SoilSAMHRADLLKPDLLSEILLLGSGMLLFGCLLLIVVTALMRI
Ga0326723_0412698_108_2273300034090Peat SoilMHRADLLKPDLLSEIVLLGTGALVFVSLLVVAVTALARI

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.