NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F079216

Metagenome / Metatranscriptome Family F079216

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F079216
Family Type Metagenome / Metatranscriptome
Number of Sequences 116
Average Sequence Length 51 residues
Representative Sequence MTVCKKCGHGMILHGCVDGVGYCSEGNGDWCNCTEKGKTYEEEIAELK
Number of Associated Samples 92
Number of Associated Scaffolds 116

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Unclassified
% of genes with valid RBS motifs 62.61 %
% of genes near scaffold ends (potentially truncated) 18.97 %
% of genes from short scaffolds (< 2000 bps) 75.86 %
Associated GOLD sequencing projects 81
AlphaFold2 3D model prediction Yes
3D model pTM-score0.41

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Unclassified (52.586 % of family members)
NCBI Taxonomy ID N/A
Taxonomy N/A

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine
(32.759 % of family members)
Environment Ontology (ENVO) Unclassified
(81.897 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(71.552 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 14.47%    β-sheet: 14.47%    Coil/Unstructured: 71.05%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.41
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 116 Family Scaffolds
PF14947HTH_45 12.93
PF00493MCM 4.31
PF01555N6_N4_Mtase 3.45
PF01037AsnC_trans_reg 2.59
PF00092VWA 2.59
PF03237Terminase_6N 2.59
PF03819MazG 1.72
PF05869Dam 1.72
PF06114Peptidase_M78 1.72
PF01521Fe-S_biosyn 0.86
PF00145DNA_methylase 0.86
PF00549Ligase_CoA 0.86
PF01844HNH 0.86

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 116 Family Scaffolds
COG1241DNA replicative helicase MCM subunit Mcm2, Cdc46/Mcm familyReplication, recombination and repair [L] 4.31
COG0863DNA modification methylaseReplication, recombination and repair [L] 3.45
COG1041tRNA G10 N-methylase Trm11Translation, ribosomal structure and biogenesis [J] 3.45
COG2189Adenine specific DNA methylase ModReplication, recombination and repair [L] 3.45
COG0045Succinyl-CoA synthetase, beta subunitEnergy production and conversion [C] 0.86
COG0074Succinyl-CoA synthetase, alpha subunitEnergy production and conversion [C] 0.86
COG0270DNA-cytosine methylaseReplication, recombination and repair [L] 0.86
COG0316Fe-S cluster assembly iron-binding protein IscAPosttranslational modification, protein turnover, chaperones [O] 0.86
COG4841Uncharacterized conserved protein YneR, related to HesB/YadR/YfhF familyFunction unknown [S] 0.86

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
UnclassifiedrootN/A52.59 %
All OrganismsrootAll Organisms47.41 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2008193001|2008209580Not Available1259Open in IMG/M
3300000115|DelMOSum2011_c10007402All Organisms → cellular organisms → Bacteria6132Open in IMG/M
3300000115|DelMOSum2011_c10160184Not Available659Open in IMG/M
3300000137|LP_F_10_SI03_10DRAFT_c1014594All Organisms → Viruses → Predicted Viral1466Open in IMG/M
3300000148|SI47jul10_100mDRAFT_c1050249Not Available543Open in IMG/M
3300000158|SI54feb11_100mDRAFT_c1002860All Organisms → Viruses → Predicted Viral4921Open in IMG/M
3300000199|SI39nov09_10mDRAFT_c1003343Not Available1705Open in IMG/M
3300000250|LPfeb09P261000mDRAFT_1052804Not Available549Open in IMG/M
3300000257|LP_F_10_SI03_100DRAFT_1069473Not Available530Open in IMG/M
3300001450|JGI24006J15134_10121015Not Available903Open in IMG/M
3300003478|JGI26238J51125_1001836All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium7248Open in IMG/M
3300003478|JGI26238J51125_1052220Not Available835Open in IMG/M
3300003500|JGI26242J51144_1004233Not Available3388Open in IMG/M
3300003500|JGI26242J51144_1020667All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1230Open in IMG/M
3300003500|JGI26242J51144_1028796Not Available986Open in IMG/M
3300003583|JGI26253J51717_1035746All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1005Open in IMG/M
3300003620|JGI26273J51734_10006239Not Available5472Open in IMG/M
3300003894|Ga0063241_1010496All Organisms → cellular organisms → Bacteria → FCB group → Candidatus Marinimicrobia → Candidatus Marinimicrobia bacterium5403Open in IMG/M
3300004280|Ga0066606_10131972Not Available929Open in IMG/M
3300005239|Ga0073579_1251098All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium792Open in IMG/M
3300005239|Ga0073579_1314563Not Available865Open in IMG/M
3300005239|Ga0073579_1428906Not Available866Open in IMG/M
3300005605|Ga0066850_10050187All Organisms → Viruses → Predicted Viral1649Open in IMG/M
3300005837|Ga0078893_11734029Not Available8452Open in IMG/M
3300005838|Ga0008649_10135948All Organisms → Viruses → Thaspiviridae → Nitmarvirus → Nitmarvirus NSV1989Open in IMG/M
3300005838|Ga0008649_10159123Not Available897Open in IMG/M
3300006164|Ga0075441_10204401All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium735Open in IMG/M
3300006752|Ga0098048_1049024All Organisms → Viruses → Predicted Viral1331Open in IMG/M
3300006793|Ga0098055_1015907All Organisms → Viruses → Predicted Viral3281Open in IMG/M
3300006793|Ga0098055_1077990Not Available1305Open in IMG/M
3300006921|Ga0098060_1027561Not Available1741Open in IMG/M
3300006924|Ga0098051_1032003All Organisms → Viruses → Predicted Viral1487Open in IMG/M
3300006925|Ga0098050_1034990All Organisms → Viruses → Predicted Viral1355Open in IMG/M
3300006929|Ga0098036_1147568Not Available719Open in IMG/M
3300009104|Ga0117902_1302956All Organisms → Viruses → Predicted Viral1479Open in IMG/M
3300009108|Ga0117920_1080935All Organisms → Viruses → Predicted Viral1379Open in IMG/M
3300009149|Ga0114918_10424856All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium721Open in IMG/M
3300009173|Ga0114996_10681671All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium755Open in IMG/M
3300009173|Ga0114996_10928515Not Available622Open in IMG/M
3300009409|Ga0114993_11139827Not Available551Open in IMG/M
3300009420|Ga0114994_10029250All Organisms → Viruses → Predicted Viral3850Open in IMG/M
3300009499|Ga0114930_10226793All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium932Open in IMG/M
3300009593|Ga0115011_10004013Not Available9985Open in IMG/M
3300009593|Ga0115011_10103461All Organisms → Viruses → environmental samples → uncultured marine virus2015Open in IMG/M
3300009705|Ga0115000_11013197Not Available506Open in IMG/M
3300009706|Ga0115002_10155080All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1816Open in IMG/M
3300009754|Ga0123364_1043889All Organisms → Viruses → environmental samples → uncultured marine virus1071Open in IMG/M
3300009756|Ga0123366_1182250Not Available991Open in IMG/M
3300009786|Ga0114999_10250708All Organisms → Viruses → Predicted Viral1445Open in IMG/M
3300010149|Ga0098049_1206673Not Available601Open in IMG/M
3300010153|Ga0098059_1005208All Organisms → Viruses → environmental samples → uncultured marine virus5765Open in IMG/M
3300010153|Ga0098059_1208925All Organisms → cellular organisms → Bacteria → FCB group → Candidatus Cloacimonetes → unclassified Candidatus Cloacimonetes → Candidatus Cloacimonetes bacterium759Open in IMG/M
3300010883|Ga0133547_10793482Not Available1861Open in IMG/M
3300017753|Ga0181407_1014785All Organisms → Viruses → Predicted Viral2196Open in IMG/M
3300017753|Ga0181407_1038616Not Available1270Open in IMG/M
3300017760|Ga0181408_1114291Not Available700Open in IMG/M
3300021185|Ga0206682_10078831All Organisms → Viruses → environmental samples → uncultured marine virus1690Open in IMG/M
3300021959|Ga0222716_10235070All Organisms → Viruses → Predicted Viral1140Open in IMG/M
(restricted) 3300022931|Ga0233433_10001521All Organisms → cellular organisms → Bacteria21896Open in IMG/M
(restricted) 3300022931|Ga0233433_10136100All Organisms → Viruses → Predicted Viral1147Open in IMG/M
(restricted) 3300022933|Ga0233427_10000299Not Available64573Open in IMG/M
(restricted) 3300022933|Ga0233427_10286901Not Available694Open in IMG/M
(restricted) 3300023112|Ga0233411_10113815All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium871Open in IMG/M
(restricted) 3300023210|Ga0233412_10016303Not Available2946Open in IMG/M
(restricted) 3300024259|Ga0233437_1107049Not Available1379Open in IMG/M
(restricted) 3300024324|Ga0233443_1014622All Organisms → Viruses → Predicted Viral3967Open in IMG/M
3300024344|Ga0209992_10121600All Organisms → Viruses → Predicted Viral1154Open in IMG/M
(restricted) 3300024520|Ga0255047_10489189Not Available619Open in IMG/M
3300025085|Ga0208792_1028956All Organisms → cellular organisms → Bacteria → FCB group → Candidatus Cloacimonetes → unclassified Candidatus Cloacimonetes → Candidatus Cloacimonetes bacterium1108Open in IMG/M
3300025099|Ga0208669_1000626All Organisms → cellular organisms → Bacteria13831Open in IMG/M
3300025099|Ga0208669_1021277All Organisms → Viruses → Predicted Viral1664Open in IMG/M
3300025108|Ga0208793_1117576Not Available729Open in IMG/M
3300025151|Ga0209645_1001096All Organisms → cellular organisms → Bacteria13745Open in IMG/M
3300025547|Ga0209556_1076902Not Available763Open in IMG/M
3300025592|Ga0209658_1051089Not Available1108Open in IMG/M
3300025656|Ga0209054_1113571Not Available746Open in IMG/M
3300025663|Ga0209775_1014118Not Available2618Open in IMG/M
3300025663|Ga0209775_1042012Not Available1406Open in IMG/M
3300025665|Ga0209360_1132630Not Available702Open in IMG/M
3300025672|Ga0209663_1152222Not Available665Open in IMG/M
3300025672|Ga0209663_1223595All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium511Open in IMG/M
3300025681|Ga0209263_1102503Not Available864Open in IMG/M
3300025870|Ga0209666_1196232All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium871Open in IMG/M
3300027048|Ga0208962_1040104Not Available670Open in IMG/M
3300027233|Ga0208678_1095415Not Available562Open in IMG/M
3300027245|Ga0208445_1034356Not Available529Open in IMG/M
3300027779|Ga0209709_10113528All Organisms → Viruses → Predicted Viral1392Open in IMG/M
3300027801|Ga0209091_10030119All Organisms → Viruses → Predicted Viral3333Open in IMG/M
3300027827|Ga0209035_10154332All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1145Open in IMG/M
3300027838|Ga0209089_10042646All Organisms → Viruses → Predicted Viral2977Open in IMG/M
3300027839|Ga0209403_10515650Not Available601Open in IMG/M
3300027847|Ga0209402_10120065All Organisms → Viruses → Predicted Viral1792Open in IMG/M
(restricted) 3300027861|Ga0233415_10101950All Organisms → Viruses → Predicted Viral1264Open in IMG/M
3300027906|Ga0209404_10002940Not Available10229Open in IMG/M
3300027906|Ga0209404_10126631Not Available1534Open in IMG/M
(restricted) 3300028045|Ga0233414_10199364All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium898Open in IMG/M
3300028198|Ga0257121_1209893Not Available617Open in IMG/M
3300028436|Ga0256397_1000127All Organisms → Viruses → environmental samples → uncultured marine virus5364Open in IMG/M
3300031140|Ga0308024_1104986Not Available690Open in IMG/M
3300031140|Ga0308024_1153810Not Available533Open in IMG/M
3300031140|Ga0308024_1158993Not Available520Open in IMG/M
3300031141|Ga0308021_10031328All Organisms → Viruses → environmental samples → uncultured marine virus2268Open in IMG/M
3300031141|Ga0308021_10043604All Organisms → Viruses → Predicted Viral1881Open in IMG/M
3300031141|Ga0308021_10053777Not Available1668Open in IMG/M
3300031167|Ga0308023_1094504Not Available550Open in IMG/M
3300031510|Ga0308010_1153670Not Available857Open in IMG/M
3300031510|Ga0308010_1162059Not Available829Open in IMG/M
3300031565|Ga0307379_10606597All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1002Open in IMG/M
3300031598|Ga0308019_10004744Not Available7250Open in IMG/M
3300031612|Ga0308009_10019542All Organisms → Viruses → Predicted Viral2692Open in IMG/M
3300031625|Ga0302135_10302924Not Available649Open in IMG/M
3300031689|Ga0308017_1027055All Organisms → Viruses → Predicted Viral1268Open in IMG/M
3300031721|Ga0308013_10354137Not Available505Open in IMG/M
3300031774|Ga0315331_10697932All Organisms → cellular organisms → Bacteria → FCB group → Candidatus Cloacimonetes → unclassified Candidatus Cloacimonetes → Candidatus Cloacimonetes bacterium717Open in IMG/M
3300033742|Ga0314858_016209Not Available1585Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine32.76%
MarineEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine18.10%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine12.07%
SeawaterEnvironmental → Aquatic → Marine → Inlet → Unclassified → Seawater9.48%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine3.45%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine2.59%
MarineEnvironmental → Aquatic → Marine → Oceanic → Photic Zone → Marine2.59%
SeawaterEnvironmental → Aquatic → Marine → Strait → Unclassified → Seawater2.59%
Deep SubsurfaceEnvironmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface1.72%
MarineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Marine1.72%
SeawaterEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater1.72%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine1.72%
MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine1.72%
MarineEnvironmental → Aquatic → Marine → Oceanic → Aphotic Zone → Marine0.86%
MarineEnvironmental → Aquatic → Marine → Inlet → Unclassified → Marine0.86%
Marine Surface WaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Marine Surface Water0.86%
MarineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Marine0.86%
Sea-Ice BrineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Sea-Ice Brine0.86%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water0.86%
SeawaterEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Seawater0.86%
Deep SubsurfaceEnvironmental → Aquatic → Marine → Volcanic → Unclassified → Deep Subsurface0.86%
SoilEnvironmental → Terrestrial → Soil → Clay → Unclassified → Soil0.86%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
2008193001Marine bacterioplankton communities from Palmer Station B, Arthur Harbor, Antarctica - WinterEnvironmentalOpen in IMG/M
3300000115Marine microbial communities from Delaware Coast, sample from Delaware MO Summer July 2011EnvironmentalOpen in IMG/M
3300000137Marine microbial communities from expanding oxygen minimum zones in Line P, North Pacific Ocean - sample F_10_SI03_10EnvironmentalOpen in IMG/M
3300000148Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - 47 07/07/10 100mEnvironmentalOpen in IMG/M
3300000158Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - 54 02/08/11 100mEnvironmentalOpen in IMG/M
3300000199Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - 39 11/10/09 10mEnvironmentalOpen in IMG/M
3300000250Marine microbial communities from expanding oxygen minimum zones in Line P, North Pacific Ocean - February 2009 P26 1000mEnvironmentalOpen in IMG/M
3300000257Marine microbial communities from expanding oxygen minimum zones in Line P, North Pacific Ocean - sample_F_10_SI03_100EnvironmentalOpen in IMG/M
3300001450Marine viral communities from the Pacific Ocean - LP-53EnvironmentalOpen in IMG/M
3300003478Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI037_S3LV_100m_DNAEnvironmentalOpen in IMG/M
3300003500Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI037_S4LV_100m_DNAEnvironmentalOpen in IMG/M
3300003583Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI073_LV_100m_DNAEnvironmentalOpen in IMG/M
3300003620Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI037_S3LV_125m_DNAEnvironmentalOpen in IMG/M
3300003894Marine microbial communities from the northern Gulf of Mexico hypoxic zone - Cultivation independent assessmentEnvironmentalOpen in IMG/M
3300004280Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI075_LV_DNA_100mEnvironmentalOpen in IMG/M
3300005239Environmental Genome Shotgun Sequencing: Ocean Microbial Populations from the Gulf of MaineEnvironmentalOpen in IMG/M
3300005605Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201406SV67EnvironmentalOpen in IMG/M
3300005837Exploring phylogenetic diversity in Port Hacking ocean in Sydney, Australia - Port Hacking PH4 TJ4-TJ18EnvironmentalOpen in IMG/M
3300005838Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI037_S2LV_130m_DNAEnvironmentalOpen in IMG/M
3300006164Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG002-DNAEnvironmentalOpen in IMG/M
3300006752Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaGEnvironmentalOpen in IMG/M
3300006793Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaGEnvironmentalOpen in IMG/M
3300006921Marine viral communities from the Subarctic Pacific Ocean - 21_ETSP_OMZ_AT15319 metaGEnvironmentalOpen in IMG/M
3300006924Marine viral communities from the Subarctic Pacific Ocean - 14B_ETSP_OMZ_AT15311_CsCl metaGEnvironmentalOpen in IMG/M
3300006925Marine viral communities from the Subarctic Pacific Ocean - 14_ETSP_OMZ_AT15311 metaGEnvironmentalOpen in IMG/M
3300006929Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaGEnvironmentalOpen in IMG/M
3300009104Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 143m, 2.7-0.2umEnvironmentalOpen in IMG/M
3300009108Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, May cruise - 234m, 2.7-0.2um, replicate aEnvironmentalOpen in IMG/M
3300009149Deep subsurface microbial communities from Baltic Sea to uncover new lineages of life (NeLLi) - Landsort_02402 metaGEnvironmentalOpen in IMG/M
3300009173Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_134EnvironmentalOpen in IMG/M
3300009409Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_150EnvironmentalOpen in IMG/M
3300009420Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_152EnvironmentalOpen in IMG/M
3300009499Deep subsurface microbial communities from Anholt, Denmark to uncover new lineages of life (NeLLi) - Anholt_01485 metaGEnvironmentalOpen in IMG/M
3300009593Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT8 MetagenomeEnvironmentalOpen in IMG/M
3300009705Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_128EnvironmentalOpen in IMG/M
3300009706Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_86EnvironmentalOpen in IMG/M
3300009754Marine microbial and viral communities from Louisana Shelf, Gulf of Mexico - GoM_2015_C6C_198_18m (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009756Marine microbial and viral communities from Louisana Shelf, Gulf of Mexico - GoM_2015_C6C_202_18m (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009786Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_126EnvironmentalOpen in IMG/M
3300010149Marine viral communities from the Subarctic Pacific Ocean - 13B_ETSP_OMZ_AT15268_CsCl metaGEnvironmentalOpen in IMG/M
3300010153Marine viral communities from the Subarctic Pacific Ocean - 20_ETSP_OMZ_AT15318 metaGEnvironmentalOpen in IMG/M
3300010883western Arctic Ocean co-assemblyEnvironmentalOpen in IMG/M
3300017753Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 30 SPOT_SRF_2012-01-26EnvironmentalOpen in IMG/M
3300017760Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 31 SPOT_SRF_2012-02-16EnvironmentalOpen in IMG/M
3300021185Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 40m 12015EnvironmentalOpen in IMG/M
3300021959Estuarine water microbial communities from San Francisco Bay, California, United States - C33_13DEnvironmentalOpen in IMG/M
3300022931 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_122_August2016_100_MGEnvironmentalOpen in IMG/M
3300022933 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_118_April2016_100_MGEnvironmentalOpen in IMG/M
3300023112 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_2_MGEnvironmentalOpen in IMG/M
3300023210 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_4_MGEnvironmentalOpen in IMG/M
3300024259 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_122_August2016_200_MGEnvironmentalOpen in IMG/M
3300024324 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_123_September2016_200_MGEnvironmentalOpen in IMG/M
3300024344Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 2SBTROV12_ACTIVE470 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300024520 (restricted)Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_1EnvironmentalOpen in IMG/M
3300025085Marine viral communities from the Subarctic Pacific Ocean - 14_ETSP_OMZ_AT15311 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025099Marine viral communities from the Subarctic Pacific Ocean - 21_ETSP_OMZ_AT15319 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025108Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025151Marine viral communities from the Pacific Ocean - ETNP_6_30 (SPAdes)EnvironmentalOpen in IMG/M
3300025547Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI037_S3LV_150m_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025592Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI037_S4LV_150m_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025656Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI075_LV_DNA_200m (SPAdes)EnvironmentalOpen in IMG/M
3300025663Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI072_LV_135m_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025665Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI037_S3LV_130m_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025672Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - Saanich Inlet SI073_LV_135m_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025681Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI075_LV_DNA_100m (SPAdes)EnvironmentalOpen in IMG/M
3300025870Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI037_S3LV_125m_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300027048Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - C0912_C43A7_80 (SPAdes)EnvironmentalOpen in IMG/M
3300027233Estuarine microbial communities from the Columbia River estuary - metaG 1550B-02 (SPAdes)EnvironmentalOpen in IMG/M
3300027245Estuarine microbial communities from the Columbia River estuary - metaG 1556B-3 (SPAdes)EnvironmentalOpen in IMG/M
3300027779Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_136 (SPAdes)EnvironmentalOpen in IMG/M
3300027801Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_128 (SPAdes)EnvironmentalOpen in IMG/M
3300027827Marine microbial communities from the Southern Atlantic Ocean, analyzing organic carbon cycling - AAIW_A/KNORR_S2/LV (SPAdes)EnvironmentalOpen in IMG/M
3300027838Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_150 (SPAdes)EnvironmentalOpen in IMG/M
3300027839Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_86 (SPAdes)EnvironmentalOpen in IMG/M
3300027847Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_126 (SPAdes)EnvironmentalOpen in IMG/M
3300027861 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_12_MGEnvironmentalOpen in IMG/M
3300027906Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT8 Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300028045 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_10_MGEnvironmentalOpen in IMG/M
3300028198Marine microbial communities from Saanich Inlet, British Columbia, Canada - SI106_100EnvironmentalOpen in IMG/M
3300028436Seawater viral communities from deep brine pools at the bottom of the Mediterranean Sea - Kryos LI F3EnvironmentalOpen in IMG/M
3300031140Marine microbial communities from water near the shore, Antarctic Ocean - #420EnvironmentalOpen in IMG/M
3300031141Marine microbial communities from water near the shore, Antarctic Ocean - #351EnvironmentalOpen in IMG/M
3300031167Marine microbial communities from water near the shore, Antarctic Ocean - #418EnvironmentalOpen in IMG/M
3300031510Marine microbial communities from water near the shore, Antarctic Ocean - #129EnvironmentalOpen in IMG/M
3300031565Soil microbial communities from Risofladan, Vaasa, Finland - UN-2EnvironmentalOpen in IMG/M
3300031598Marine microbial communities from water near the shore, Antarctic Ocean - #284EnvironmentalOpen in IMG/M
3300031612Marine microbial communities from water near the shore, Antarctic Ocean - #127EnvironmentalOpen in IMG/M
3300031625Marine microbial communities from Western Arctic Ocean, Canada - CBN3_surfaceEnvironmentalOpen in IMG/M
3300031689Marine microbial communities from water near the shore, Antarctic Ocean - #280EnvironmentalOpen in IMG/M
3300031721Marine microbial communities from water near the shore, Antarctic Ocean - #181EnvironmentalOpen in IMG/M
3300031774Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 60m 34915EnvironmentalOpen in IMG/M
3300033742Sea-ice brine viral communities from Beaufort Sea near Barrow, Alaska, United States - 2018 seawaterEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
20082122882008193001MarineMNKLVCKKCSHGMLLHGSVDGVGYCMEGNGVWCDCTVKGKTYEEEVELLKHEMFDL
DelMOSum2011_10007402113300000115MarineMKLVCDKCGHGMVLHGCVDNKGYCSEGNGDWCECTEKGKTYEEEISELQHERIMS*
DelMOSum2011_1016018443300000115MarineMSKTVCSKCDHGMILHGCVDGVGYCSEGNGDWCECTVKGKTYEEE
LP_F_10_SI03_10DRAFT_101459433300000137MarineMTVCDKCGHGMLLHGCVGNKGYCSEGNGNWCECTEKGKTYEEEISDLQHERIMS*
SI47jul10_100mDRAFT_105024933300000148MarineMDVCKKCNHGMMLHGCVDGIGYCMEGNGDWCDCTVKGLTYEEEIKLLKTERIK*
SI54feb11_100mDRAFT_100286063300000158MarineMLLHGCVDGVGYCSEGNGDWCECTEKGKTYEEEIYELRYERSLSTMSEK*
SI39nov09_10mDRAFT_100334373300000199MarineMYDVCDECGHGMLLHGCVDDIGYCSEGNGDWCDCTTKGLTYDEEIELLN*
LPfeb09P261000mDRAFT_105280433300000250MarineMDVCKKCNHGMMLHGCVDGIGYCMEGNGDWCDCTVKGLTYEEEIK
LP_F_10_SI03_100DRAFT_106947313300000257MarineMTVCDKCGHGMLLHGCVGNKGYCSEGNGNWCECTEKGKTYEEEISDLQ
JGI24006J15134_1012101513300001450MarineMSFEVCKKCDHGMGMHGCVENVGYCMDGNGDWCDCTEKGLTYEQELKLLR*
JGI26238J51125_100183613300003478MarineMTVYTVCKVCDHGMLLHGCVDGVGYCMEGNGDWCDCTEKGKTYEEEIAELK*
JGI26238J51125_105222043300003478MarineMSVCDVCGHGMILHGCVNGVGYCSEGNGDWCDCTIQGKSYDEEIESL*
JGI26242J51144_100423353300003500MarineMLPLSSKENEMSYSTCKKCGHGMGMHGCVEGIGYCMDGNGDWCNCTEKGLTYDEEVALLR
JGI26242J51144_102066723300003500MarineMSYSTCKCDHGMGMHGCVEGIGYCMDGNGDWCNCTEKGLTYDEEVALLR*
JGI26242J51144_102879613300003500MarineMICKKCGHGMILHGCVNDVGYCMEGNGDWCNCDVKGLTYEEELKALD*
JGI26253J51717_103574613300003583MarineMSYSTCKKCDHGMGMHGCVEGIGYCMDGNGDWCNCTEKGLTYDEEVALLR*
JGI26273J51734_1000623943300003620MarineMLPLSSKENEMSYSTCKKCDHGMGMHGCVEGIGYCMDGNGDWCDCTEKGLTYDEEVALLR
Ga0063241_101049673300003894MarineMSKTVCSKCDHGMMLHGCVDSVGYCMEGNGDWCECTVKGKTYEEEIESIKHDN*
Ga0066606_1013197213300004280MarineMDFKVCKKCDHGMGMHGCVEGIGYCMDGNGDWCNCTEKGLTYDEEVALLR*
Ga0073579_125109813300005239MarineMSYSVCKKCDHGMGMHGCVEGRGYCMEGNGDWCDCTEKGLTYDEEVALLR*
Ga0073579_131456323300005239MarineLFPLSSKENEMSFEVCKKCDHGMGMHGCVENVGYCMDGNGDWCDCTEKGLTYEQELKLLR
Ga0073579_142890633300005239MarineMSKTVCSKCDHGMILHGCVDGVGYCSEGNGDWCECTVKGKTYEEEIESIKHDS*
Ga0066850_1005018733300005605MarineMTVCDKCGHGMLLHGCVDNKGYCSEGNGDWCECTEKGKTYEEEISDLQHERIMS*
Ga0078893_11734029213300005837Marine Surface WaterMKLVCDKCDHGMLLHGCVDGKGYCMEGNGDWCECTEKGKTYEEELSDIQHERIMS*
Ga0008649_1013594833300005838MarineMICKKCGHGMILHGCVNDVGYCMEGNGDWCNCDVKGLTYDEEIKALD*
Ga0008649_1015912323300005838MarineMICKKCGHGMILHGCVEGIGYCSEGNGDWCNCDVKGLTYDEEIKALD*
Ga0075441_1020440123300006164MarineMDFKVCKKCDHGMGMHGCVEGRGYCMDGNGDWCDCTEKGLTYDEEVALLR*
Ga0098048_104902423300006752MarineMSKTVCSKCDHGMILHGCVDGVGYCMEGNGDWCECTVKGKTYEEEIESIKHDS*
Ga0098055_101590733300006793MarineMKLVCDKCDHGMLLHGCVDGKGYCMEGNGNWCQCTEKGKTYEEEIYDIQHERIMS*
Ga0098055_107799033300006793MarineMTVCNKCGHGMILHGCVDGVGYCSEGNGNWCDCTEKGKTYEEEIAELKQ*
Ga0098060_102756133300006921MarineMTVCNKCGHGMILHGCVDGVGYCMEGNGDWCKCTEKGKTYEEEIAELK*
Ga0098051_103200343300006924MarineMKLVCDKCGHGMLLHGCVDGKGYCMEGNGDWCECTEKGKTYEEELSDIQHERIMS*
Ga0098050_103499043300006925MarineMKLVCDKCGHGMLLHGCVDGKGYCMEGNGNWCQCTEKGKTYEEEIYDIQHERIMS*
Ga0098036_114756833300006929MarineMTVCDKCGHGMLLHGCVGNKGYCSEGNGDWCECTEKGKTYEEEISDLQHERIMS*
Ga0117902_130295633300009104MarineMSTCSKCGHGMILHGCVDGVGYCMEGNGDRCDCTEKGKTYEEEISSIEHERTMS*
Ga0117920_108093553300009108MarineMTVCDNCGHGIILHGCVDGKGYCMEGNGDWCECTEKGKTYEEEILELQHERIMS*
Ga0114918_1042485613300009149Deep SubsurfaceVFSLSPKENEMSYSTCKKCDHGMGMHSCVEGIGYCMEGNGDWCNCTEKGLTYDEELKLLK
Ga0114996_1068167133300009173MarineSYLTCKKCDHGMGMHGCVEGIGYCMEGNGDWCNCTEKGLTYEQELKLLK*
Ga0114996_1092851523300009173MarineMSVCDVCGHGMMLHGCVNGVGYGSEGNGDWCDCTIQGKSYDEEIESL*
Ga0114993_1113982733300009409MarineMSVCDVCGHGMMLHGCVNGVGYCSEGNGDWCDCTIQGKSYDEEIESL*
Ga0114994_1002925063300009420MarineMDMVCKKCDHGMIMHGCVDGIGYCMEGNGVWCDCKEKGKTYEEELINNNYV*
Ga0114930_1022679313300009499Deep SubsurfaceMSFEVCKKCDHGMGMHGCVENVGYCMDGNGDWCDCTEKGLTYEQELKLLK*
Ga0115011_10004013143300009593MarineMTVCSKCDHGMILHGCVDGVGYCMEGNGDWCKCTVKGKTYEEEIESIKHDS*
Ga0115011_1010346123300009593MarineMSTCSKCGHGMILHGCVDGVGYCMEGNGDWCDCTEKGKTYEEEISSIEHERTMS*
Ga0115000_1101319723300009705MarineMNTVCKKCDHGMIMHGCVDGVGYCMEGQGDWCKCKEKGKTYEEELRDLKI*
Ga0115002_1015508033300009706MarineMSYLTCKKCDHGMGMHGCVEGIGYCMEGNGDWCNCTEKGLTYDEEVALLK*
Ga0123364_104388913300009754MarineMSTCNKCGHGMILHGCVDGVGYCMEGNGDWCDCTEKGKTYEE
Ga0123366_118225013300009756MarineMSACKKCGHGIILHGCVDNVGYCMEGNGDWCQCTEKGKTYEEEIDDIRNEM*
Ga0114999_1025070823300009786MarineMSYLTCKKCDHGMGMHGCVEGIGYCMEGNGDWCNCTEKGLTYEQELKLLK*
Ga0098049_120667313300010149MarineMTVCNKCGHGMILHGCVDGVGYCSEGNGNWCDCTEKGKTYEEEIAELK*
Ga0098059_1005208113300010153MarineMICKKCGHGMILHGCVEGIGYCSEGNGEWCNCDVKGLTYEEEIKALD*
Ga0098059_120892523300010153MarineMTVCNKCGHGMILHGCVDNIGYCMEGNGNWCDCTEKGKTYEEDITELK*
Ga0133547_1079348223300010883MarineMSFEVCKKCDHGMGMHGCVDNVGYCMDGNGDWCDCTEKGLTYEQELKLLR*
Ga0181407_101478523300017753SeawaterMTVCNKCGHGMILHGCVDGVGYCMEGNGDWCECTEKGKTYEEELSDIQYERFMS
Ga0181407_103861623300017753SeawaterMICKKCGHGMILHGCVEGIGYCSEGNGDWCNCDVKGLTYEEELKALD
Ga0181408_111429123300017760SeawaterMTVCNKCGHAMILHGCVDGVGYCMEGNGDWCECTEKGKTYEEELSDIQYERFMS
Ga0206682_1007883113300021185SeawaterMTVCSKCGHGMILHGCVDGVGYCMEGNGDWCECTVKGKTYEEEIESIKHDS
Ga0222716_1023507023300021959Estuarine WaterMICKKCGHGMILHGCVEGIGYCSEGNGDWCNCDVKGLTYDEEIKALD
(restricted) Ga0233433_1000152123300022931SeawaterMTVCKKCGHGMILHGCVDGVGYCSEGNGDWCNCTEKGKTYEEEIAELK
(restricted) Ga0233433_1013610023300022931SeawaterMSKTTNICLKCNHGMLLHGCINNIGYCSEGNGDWCNCTVKGLTYEQEIELLK
(restricted) Ga0233427_10000299533300022933SeawaterMTVCDKCGHGMLLHGCVGNKGYCSEGNGNWCECTEKGKTYEEEISDLQHERIMS
(restricted) Ga0233427_1028690123300022933SeawaterMDVCKKCNHGMMLHGCVDGIGYCMEGNGDWCDCTVKGLTYEEEIKLLKTERIK
(restricted) Ga0233411_1011381523300023112SeawaterMSYSTCKKCGHGMGMHGCVEGIGYCMDGNGDWCNCTEKGLTYDEEVALLR
(restricted) Ga0233412_1001630343300023210SeawaterLSSKENEMSFEVCKKCDHGMGMHGCVENVGYCMDGNGDWCDCTEKGLTYEQELELLR
(restricted) Ga0233437_110704943300024259SeawaterMSVCDVCGHGMILHGCVNGVGYCSEGNGDWCDCTIQGKSYDEEIESL
(restricted) Ga0233443_101462223300024324SeawaterMYDICDECGHGMLLHGCVDDIGYCSEGNGDWCDCTTKGLTYDEEIELLN
Ga0209992_1012160023300024344Deep SubsurfaceMKLVCDKCDHGMLLHGCVDGKGYCMEGNGDWCECTEKGKTYEEELSDIQHERIMS
(restricted) Ga0255047_1048918913300024520SeawaterMICKKCGHGMILHGCVNDVGYCMEGNGDWCNCDVKGLTYEEELKALD
Ga0208792_102895613300025085MarineMTVCNKCGHGMILHGCVDGVGYCSEGNGNWCDCTEKGKTYEEEIAELKQ
Ga0208669_1000626193300025099MarineMTVCDKCGHGMLLHGCVDNKGYCSEGNGDWCECTEKGKTYEEEISDLQHERIMS
Ga0208669_102127713300025099MarineMTVCNKCGHGMILHGCVDGVGYCMEGNGDWCKCTEKGKTYEEEIAELK
Ga0208793_111757633300025108MarineMKLVCDKCDHGMLLHGCVDGKGYCMEGNGNWCQCTEKGKTYEEEIYDIQHERIMS
Ga0209645_1001096103300025151MarineMTVCDNCGHGIILHGCVDGKGYCMEGNGDWCECTEKGKTYEEEILELQHERIMS
Ga0209556_107690223300025547MarineMTVYTVCKVCDHGMLLHGCVDGVGYCMEGNGDWCDCTEKGKTYEEEIAELK
Ga0209658_105108913300025592MarineMDVCKKCNHGMMLHGCVDGIGYCMEGNGDWCDCTVKGLTYEEEIKFLKT
Ga0209054_111357133300025656MarineMSYSTCKKCDHGMGMHGCVEGIGYCMDGNGDWCNCTEKGLTYDEEVALLR
Ga0209775_101411863300025663MarineMSYSTCKKCDHGMGMHGCVEGIGYCMDGNGDWCNCTEKGLTYD
Ga0209775_104201243300025663MarineFPLSSKENEMSYSTCKKCDHGMGMHGCVEGIGYCMDGNGDWCDCTEKGLTYDEEVALLR
Ga0209360_113263023300025665MarineMICKKCGHGMILHGCVEGIGYCSEGNGDWCNCDVKGLTYDEEIKAL
Ga0209663_115222233300025672MarineMLPLSSKENEMSYSTCKKCDHGMGMHGCVEGIGYCMDGNGDWCNCTEKGLTYDEEVALLR
Ga0209663_122359513300025672MarineKKCGHGMGMHGCVEGIGYCMDGNGDWCNCTEKGLTYDEEVALLR
Ga0209263_110250313300025681MarineMDFKVCKKCDHGMGMHGCVEGIGYCMDGNGDWCNCTEKGLTYDEEVALLR
Ga0209666_119623223300025870MarineMSFEVCKKCDHGMGMHGCVENVGYCMDGNGDWCDCTEKGLTYEQELELLR
Ga0208962_104010413300027048MarineMICKKCGHGMILHGCVNNVGYCSEGNGEWCNCDVKGLTYEEEIKALD
Ga0208678_109541513300027233EstuarineKKCSHGMIMHGCVDGVGYCMEGNGVWCDCTVKGKTYEEEVELLKHEM
Ga0208445_103435623300027245EstuarineMNKLVCKKCSHGMIMHGCVDGVGYCMEGNGVWCDCTVKGKTYEEEVELLKHEM
Ga0209709_1011352833300027779MarineMDMVCKKCDHGMIMHGCVDGIGYCMEGNGVWCDCKEKGKTYEEELINNNYV
Ga0209091_1003011913300027801MarineKHSRKFWIRIIMDMVCKKCDHGMIMHGCVDGIGYCMEGNGVWCDCKEKGKTYEEELINNNYV
Ga0209035_1015433233300027827MarineMSFEVCKKCDHGMGMHGCVENVGYCMDGNGDWCNCTEKGLTYEEELKLLR
Ga0209089_1004264653300027838MarineMFSLSPKENEMSYLTCKKCDHGMGMHGCVEGIGYCMEGNGDWCNCTEKGLTYDEEVKLLK
Ga0209403_1051565013300027839MarineMSYLTCKKCDHGMGMHGCVEGIGYCMEGNGDWCNCTEKGLTYDEEVALLK
Ga0209402_1012006533300027847MarineMSYLTCKKCDHGMGMHGCVEGIGYCMEGNGDWCNCTEKGLTYEQELKLLK
(restricted) Ga0233415_1010195013300027861SeawaterMSRSWNLIMGKTVCSKCDHGMIMHGCVDSVGYCMEGQGDWCKCTVKGLTYEQELE
Ga0209404_10002940143300027906MarineMTVCSKCDHGMILHGCVDGVGYCMEGNGDWCKCTVKGKTYEEEIESIKHDS
Ga0209404_1012663113300027906MarineMSTCSKCGHGMILHGCVDGVGYCMEGNGDWCDCTEKGKTYEEEISSIEHERTMS
(restricted) Ga0233414_1019936433300028045SeawaterSKENEMSYSTCKKCDHGMGMHGCVEGIGYCMDGNGDWCNCTEKGLTYDEEVALLR
Ga0257121_120989323300028198MarineMICKKCGHGMILHGCVNNVGYCMEGNGDWCNCDVKGLTYDEE
Ga0256397_100012753300028436SeawaterMYDVCTKCDHGMILHGSVDGVGYCMEGNGNWCECTVEGLTYEQEIESLK
Ga0308024_110498613300031140MarineMNTVCKKCDHGMIMHGCVDGIGYCMEGQGNWCKCKEKGKTYEEELSEL
Ga0308024_115381023300031140MarineMTKTVCSRCNHGMIMHGCVDGVGYCMEGQGDWCKCTVKGKTYEQEIEMLKNE
Ga0308024_115899323300031140MarineFPLSPKENEMITLCKKCNHGMLMHGSVDDVGYCMDGNGEWCDCTEQGLTYDEEIELLR
Ga0308021_1003132843300031141MarineMNKLVCKKCSHGMLLHGCVDGVGYCMEGNGVWCDCTVKGKTYEEEVELLKHEM
Ga0308021_1004360433300031141MarineMNTVCKKCDHGMIMHGCVDGIGYCMEGQGNWCKCKEKGKTYEEELSELKR
Ga0308021_1005377733300031141MarineMFPLSPKENEMITLCKKCNHGMLMHGSVDDVGYCMDGNGEWCDCTEQGLTYDEEIELLR
Ga0308023_109450423300031167MarineMTVCNKCGHGMIMHGCVDGVGYCMEGQGDWCKCTVKGKTYEQEIEMLKNEGI
Ga0308010_115367023300031510MarineMNTVCKKCDHGMIMHGCVDGIGYCMEGQGNWCKCKEKGKTYEEELSELKRXLDYVTSV
Ga0308010_116205923300031510MarineMTFEVCKECSHGMLLHGNEHGEGYCSEGNGDWCDCKVKGLSYD
Ga0307379_1060659723300031565SoilVFSLSPKENEMSYSTCKKCDHGMGMHGCVEGIGYCMEGNGDWCNCTEKGLTYDEELKLLK
Ga0308019_1000474493300031598MarineMFSLSPKENEMITLCKKCNHGMLMHGSVDDVGYCMDGNGEWCNCTEQGLTYDEEVELLR
Ga0308019_1001392323300031598MarineMNKLVCKKCSHGMLLHGCVDGVGYCMEGNGVWCDCTVKGQDL
Ga0308009_1001954273300031612MarineMTVCNKCGHGMIMHGCVDGVGYCMEGQGDWCKCTVKGKTYEQEIEMLKNEGII
Ga0302135_1030292433300031625MarineMARMTCNKCGHGMIMHGCVGSIGYCMDGNGEWCNCTVKGLTYDQEVELLQ
Ga0308017_102705513300031689MarineMKGNTVCTKCGHGMIMHGCVDSVGYCMEGQGDWCMCTVKGLTYEEELESNA
Ga0308013_1035413723300031721MarineLLMTKTVCSKCDHGMIMHGCVDGVGYCMEGQGDWCKCTVKGKTYEQEIEMLKNE
Ga0315331_1069793213300031774SeawaterMTVCNKCGHGMILHGCVDGVGYCMEGNGDWCECTEKGKTYEEELSDIQY
Ga0314858_016209_530_6823300033742Sea-Ice BrineMSYSTCKKCDHGMGMHGCVEGRGYCMEGNGDWCDCTEKGLTYDEEVALLR

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.