NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F079530

Metagenome / Metatranscriptome Family F079530

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F079530
Family Type Metagenome / Metatranscriptome
Number of Sequences 115
Average Sequence Length 84 residues
Representative Sequence LVSHGIDVPTGLAAAKAIDRRFDPIMSIRALQFYGDGTLNRVPAAMQRDLTCWAQGVDLAKLPTLHPRRGLSPGGLER
Number of Associated Samples 106
Number of Associated Scaffolds 115

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 11.40 %
% of genes near scaffold ends (potentially truncated) 78.26 %
% of genes from short scaffolds (< 2000 bps) 86.09 %
Associated GOLD sequencing projects 101
AlphaFold2 3D model prediction Yes
3D model pTM-score0.46

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (99.130 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland
(12.174 % of family members)
Environment Ontology (ENVO) Unclassified
(34.783 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(42.609 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 34.91%    β-sheet: 0.00%    Coil/Unstructured: 65.09%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.46
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 115 Family Scaffolds
PF08843AbiEii 6.09
PF04434SWIM 4.35
PF13561adh_short_C2 1.74
PF11843DUF3363 0.87
PF00196GerE 0.87
PF08751TrwC 0.87
PF13439Glyco_transf_4 0.87
PF01522Polysacc_deac_1 0.87
PF13744HTH_37 0.87
PF12543DUF3738 0.87
PF00239Resolvase 0.87
PF15723MqsR_toxin 0.87
PF05935Arylsulfotrans 0.87
PF16859TetR_C_11 0.87
PF13424TPR_12 0.87
PF02518HATPase_c 0.87
PF02687FtsX 0.87
PF00032Cytochrom_B_C 0.87
PF07730HisKA_3 0.87
PF00171Aldedh 0.87

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 115 Family Scaffolds
COG2253Predicted nucleotidyltransferase component of viral defense systemDefense mechanisms [V] 6.09
COG4279Uncharacterized protein, contains SWIM-type Zn finger domainFunction unknown [S] 4.35
COG4715Uncharacterized protein, contains SWIM-type Zn finger domainFunction unknown [S] 4.35
COG5431Predicted nucleic acid-binding protein, contains SWIM-type Zn-finger domainGeneral function prediction only [R] 4.35
COG2452Predicted site-specific integrase-resolvaseMobilome: prophages, transposons [X] 0.87
COG3850Signal transduction histidine kinase NarQ, nitrate/nitrite-specificSignal transduction mechanisms [T] 0.87
COG3851Signal transduction histidine kinase UhpB, glucose-6-phosphate specificSignal transduction mechanisms [T] 0.87
COG4230Delta 1-pyrroline-5-carboxylate dehydrogenaseAmino acid transport and metabolism [E] 0.87
COG4564Signal transduction histidine kinaseSignal transduction mechanisms [T] 0.87
COG4585Signal transduction histidine kinase ComPSignal transduction mechanisms [T] 0.87
COG0014Gamma-glutamyl phosphate reductaseAmino acid transport and metabolism [E] 0.87
COG0726Peptidoglycan/xylan/chitin deacetylase, PgdA/NodB/CDA1 familyCell wall/membrane/envelope biogenesis [M] 0.87
COG1012Acyl-CoA reductase or other NAD-dependent aldehyde dehydrogenaseLipid transport and metabolism [I] 0.87
COG1290Cytochrome b subunit of the bc complexEnergy production and conversion [C] 0.87
COG1961Site-specific DNA recombinase SpoIVCA/DNA invertase PinEReplication, recombination and repair [L] 0.87

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms99.13 %
UnclassifiedrootN/A0.87 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2001200001|2001270817All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1373Open in IMG/M
3300005176|Ga0066679_10628533All Organisms → cellular organisms → Bacteria700Open in IMG/M
3300005332|Ga0066388_102149578All Organisms → cellular organisms → Bacteria → Proteobacteria1006Open in IMG/M
3300005338|Ga0068868_100146172All Organisms → cellular organisms → Bacteria1944Open in IMG/M
3300005365|Ga0070688_100866485All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria710Open in IMG/M
3300005367|Ga0070667_100628867All Organisms → cellular organisms → Bacteria990Open in IMG/M
3300005435|Ga0070714_102006448All Organisms → cellular organisms → Bacteria564Open in IMG/M
3300005446|Ga0066686_11092031All Organisms → cellular organisms → Bacteria513Open in IMG/M
3300005447|Ga0066689_10189462All Organisms → cellular organisms → Bacteria1243Open in IMG/M
3300005534|Ga0070735_10216714All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1167Open in IMG/M
3300005591|Ga0070761_10012708All Organisms → cellular organisms → Bacteria4724Open in IMG/M
3300005764|Ga0066903_104247675All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria766Open in IMG/M
3300006102|Ga0075015_100318739All Organisms → cellular organisms → Bacteria860Open in IMG/M
3300006162|Ga0075030_101138127All Organisms → cellular organisms → Bacteria613Open in IMG/M
3300009137|Ga0066709_100667437All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1490Open in IMG/M
3300009510|Ga0116230_10472392All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium966Open in IMG/M
3300009519|Ga0116108_1095010All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium905Open in IMG/M
3300009523|Ga0116221_1319670All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium672Open in IMG/M
3300009552|Ga0116138_1149888All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium644Open in IMG/M
3300009628|Ga0116125_1028958All Organisms → cellular organisms → Bacteria1381Open in IMG/M
3300009628|Ga0116125_1111511All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium737Open in IMG/M
3300009630|Ga0116114_1008085All Organisms → cellular organisms → Bacteria3519Open in IMG/M
3300009635|Ga0116117_1020212All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1675Open in IMG/M
3300009635|Ga0116117_1220136All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium506Open in IMG/M
3300009641|Ga0116120_1151336All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium747Open in IMG/M
3300009644|Ga0116121_1126495All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium804Open in IMG/M
3300009645|Ga0116106_1224106All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium598Open in IMG/M
3300009759|Ga0116101_1003163All Organisms → cellular organisms → Bacteria → Acidobacteria2551Open in IMG/M
3300010048|Ga0126373_11516593All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria735Open in IMG/M
3300010376|Ga0126381_102009628All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium833Open in IMG/M
3300010376|Ga0126381_104796113All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium520Open in IMG/M
3300011120|Ga0150983_11090032All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium735Open in IMG/M
3300011120|Ga0150983_15750284All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium562Open in IMG/M
3300013297|Ga0157378_10334498All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1475Open in IMG/M
3300014159|Ga0181530_10046598All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2879Open in IMG/M
3300014167|Ga0181528_10258881All Organisms → cellular organisms → Bacteria940Open in IMG/M
3300014169|Ga0181531_10242743All Organisms → cellular organisms → Bacteria1098Open in IMG/M
3300014199|Ga0181535_10717042All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium569Open in IMG/M
3300014200|Ga0181526_10612507All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium688Open in IMG/M
3300014489|Ga0182018_10001587All Organisms → cellular organisms → Bacteria25430Open in IMG/M
3300014499|Ga0182012_10706461All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium643Open in IMG/M
3300014838|Ga0182030_11349942All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium598Open in IMG/M
3300014968|Ga0157379_11037230All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium783Open in IMG/M
3300015241|Ga0137418_10745748All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium743Open in IMG/M
3300016357|Ga0182032_10677769All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium864Open in IMG/M
3300016445|Ga0182038_11630350All Organisms → cellular organisms → Bacteria581Open in IMG/M
3300016701|Ga0181509_1244213All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium588Open in IMG/M
3300017925|Ga0187856_1002230All Organisms → cellular organisms → Bacteria14482Open in IMG/M
3300017935|Ga0187848_10004245All Organisms → cellular organisms → Bacteria10058Open in IMG/M
3300017940|Ga0187853_10182287All Organisms → cellular organisms → Bacteria991Open in IMG/M
3300017972|Ga0187781_11341820All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium528Open in IMG/M
3300018007|Ga0187805_10275293All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium773Open in IMG/M
3300018016|Ga0187880_1040767All Organisms → cellular organisms → Bacteria2544Open in IMG/M
3300018023|Ga0187889_10152632All Organisms → cellular organisms → Bacteria1093Open in IMG/M
3300018026|Ga0187857_10202056All Organisms → cellular organisms → Bacteria927Open in IMG/M
3300018034|Ga0187863_10868958All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium512Open in IMG/M
3300018037|Ga0187883_10508881All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium621Open in IMG/M
3300018043|Ga0187887_10239843All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1075Open in IMG/M
3300018043|Ga0187887_10463688All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium747Open in IMG/M
3300018043|Ga0187887_10834891All Organisms → cellular organisms → Bacteria545Open in IMG/M
3300018057|Ga0187858_10099169All Organisms → cellular organisms → Bacteria1991Open in IMG/M
3300018057|Ga0187858_10194405All Organisms → cellular organisms → Bacteria1327Open in IMG/M
3300018062|Ga0187784_10177728All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1739Open in IMG/M
3300020021|Ga0193726_1098077All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1330Open in IMG/M
3300021170|Ga0210400_10046367All Organisms → cellular organisms → Bacteria → Proteobacteria3381Open in IMG/M
3300021433|Ga0210391_11467992All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium523Open in IMG/M
3300021474|Ga0210390_10885337All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium735Open in IMG/M
3300021478|Ga0210402_10003814All Organisms → cellular organisms → Bacteria → Acidobacteria13976Open in IMG/M
3300021560|Ga0126371_11227398All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium885Open in IMG/M
3300022721|Ga0242666_1149247All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium572Open in IMG/M
3300024271|Ga0224564_1130966All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium516Open in IMG/M
3300025961|Ga0207712_11116659All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium702Open in IMG/M
3300025986|Ga0207658_10598735All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium990Open in IMG/M
3300026332|Ga0209803_1347169All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium514Open in IMG/M
3300027745|Ga0209908_10061999All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium853Open in IMG/M
3300027807|Ga0209208_10369156All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium707Open in IMG/M
3300027853|Ga0209274_10020441All Organisms → cellular organisms → Bacteria3020Open in IMG/M
3300027867|Ga0209167_10398613All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium750Open in IMG/M
3300027898|Ga0209067_10694795All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium589Open in IMG/M
3300027905|Ga0209415_10205529All Organisms → cellular organisms → Bacteria → Proteobacteria1851Open in IMG/M
3300027905|Ga0209415_10929305All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium588Open in IMG/M
3300027911|Ga0209698_11165862All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium569Open in IMG/M
3300028574|Ga0302153_10175148All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium735Open in IMG/M
3300028780|Ga0302225_10152674All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1119Open in IMG/M
3300028860|Ga0302199_1075404All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1121Open in IMG/M
3300028882|Ga0302154_10292357All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium802Open in IMG/M
3300029882|Ga0311368_10928629All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium580Open in IMG/M
3300029907|Ga0311329_11022788All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium511Open in IMG/M
3300029945|Ga0311330_10991429All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium621Open in IMG/M
3300029990|Ga0311336_10890363All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium770Open in IMG/M
3300030007|Ga0311338_12052415All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium506Open in IMG/M
3300030506|Ga0302194_10086881All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1420Open in IMG/M
3300031231|Ga0170824_103143656All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium569Open in IMG/M
3300031233|Ga0302307_10713032All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium503Open in IMG/M
3300031234|Ga0302325_10296807All Organisms → cellular organisms → Bacteria2628Open in IMG/M
3300031236|Ga0302324_102314055All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium662Open in IMG/M
3300031525|Ga0302326_11570012All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium877Open in IMG/M
3300031744|Ga0306918_10848256All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium713Open in IMG/M
3300031788|Ga0302319_10348764All Organisms → cellular organisms → Bacteria1691Open in IMG/M
3300031890|Ga0306925_10679223All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1080Open in IMG/M
3300031902|Ga0302322_102477733All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium639Open in IMG/M
3300032052|Ga0318506_10260777All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium768Open in IMG/M
3300032076|Ga0306924_11359395All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium760Open in IMG/M
3300032515|Ga0348332_10573950All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium692Open in IMG/M
3300032515|Ga0348332_12782921All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium739Open in IMG/M
3300032782|Ga0335082_10067148All Organisms → cellular organisms → Bacteria3643Open in IMG/M
3300032805|Ga0335078_10860765All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1095Open in IMG/M
3300032892|Ga0335081_12426483All Organisms → cellular organisms → Bacteria544Open in IMG/M
3300032893|Ga0335069_11332838All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium779Open in IMG/M
3300033289|Ga0310914_11722997All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium531Open in IMG/M
3300033755|Ga0371489_0004925All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia14687Open in IMG/M
3300033818|Ga0334804_000656All Organisms → cellular organisms → Bacteria20911Open in IMG/M
3300033982|Ga0371487_0216577All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium905Open in IMG/M
3300034125|Ga0370484_0104969All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium739Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland12.17%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland9.57%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil6.09%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa6.09%
BogEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Bog6.09%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog4.35%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil4.35%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds3.48%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil3.48%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil3.48%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil3.48%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil2.61%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland2.61%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.74%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil1.74%
BogEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Bog1.74%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil1.74%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil1.74%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil1.74%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen1.74%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil1.74%
Plant LitterEnvironmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter1.74%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere1.74%
Host-AssociatedHost-Associated → Plants → Peat Moss → Unclassified → Unclassified → Host-Associated1.74%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment0.87%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil0.87%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.87%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.87%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil0.87%
Untreated Peat SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil0.87%
Thawing PermafrostEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Thawing Permafrost0.87%
PalsaEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa0.87%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.87%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil0.87%
SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Soil0.87%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.87%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.87%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.87%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.87%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2001200001Soil microbial communities from Waseca County, Minnesota, USA - Sample 10150EnvironmentalOpen in IMG/M
3300005176Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128EnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005338Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2Host-AssociatedOpen in IMG/M
3300005365Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaGEnvironmentalOpen in IMG/M
3300005367Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaGHost-AssociatedOpen in IMG/M
3300005435Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaGEnvironmentalOpen in IMG/M
3300005446Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135EnvironmentalOpen in IMG/M
3300005447Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138EnvironmentalOpen in IMG/M
3300005534Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1EnvironmentalOpen in IMG/M
3300005591Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1EnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300006102Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013EnvironmentalOpen in IMG/M
3300006162Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012EnvironmentalOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009510Host-associated microbial communities from peat moss isolated from Minnesota, USA - S1T2_Fd - Sphagnum fallax MGHost-AssociatedOpen in IMG/M
3300009519Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_150EnvironmentalOpen in IMG/M
3300009523Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaGEnvironmentalOpen in IMG/M
3300009552Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_150EnvironmentalOpen in IMG/M
3300009628Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_10EnvironmentalOpen in IMG/M
3300009630Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_40EnvironmentalOpen in IMG/M
3300009635Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_10EnvironmentalOpen in IMG/M
3300009641Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_150EnvironmentalOpen in IMG/M
3300009644Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_10EnvironmentalOpen in IMG/M
3300009645Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_40EnvironmentalOpen in IMG/M
3300009759Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_10EnvironmentalOpen in IMG/M
3300010048Tropical forest soil microbial communities from Panama - MetaG Plot_11EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300011120Combined assembly of Microbial Forest Soil metaTEnvironmentalOpen in IMG/M
3300013297Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaGHost-AssociatedOpen in IMG/M
3300014159Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_60_metaGEnvironmentalOpen in IMG/M
3300014167Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_10_metaGEnvironmentalOpen in IMG/M
3300014169Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaGEnvironmentalOpen in IMG/M
3300014199Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_30_metaGEnvironmentalOpen in IMG/M
3300014200Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaGEnvironmentalOpen in IMG/M
3300014489Permafrost microbial communities from Stordalen Mire, Sweden - 812P2M metaGEnvironmentalOpen in IMG/M
3300014499Permafrost microbial communities from Stordalen Mire, Sweden - 612S2S metaGEnvironmentalOpen in IMG/M
3300014838Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300014968Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaGHost-AssociatedOpen in IMG/M
3300015241Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300016357Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000EnvironmentalOpen in IMG/M
3300016445Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108EnvironmentalOpen in IMG/M
3300016701Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_30_metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300017925Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_40EnvironmentalOpen in IMG/M
3300017935Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_40EnvironmentalOpen in IMG/M
3300017940Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_100EnvironmentalOpen in IMG/M
3300017972Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300018007Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5EnvironmentalOpen in IMG/M
3300018016Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_40EnvironmentalOpen in IMG/M
3300018023Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_100EnvironmentalOpen in IMG/M
3300018026Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_100EnvironmentalOpen in IMG/M
3300018034Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10EnvironmentalOpen in IMG/M
3300018037Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_10EnvironmentalOpen in IMG/M
3300018043Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_10EnvironmentalOpen in IMG/M
3300018057Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_150EnvironmentalOpen in IMG/M
3300018062Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018086Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MGEnvironmentalOpen in IMG/M
3300020021Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2c1EnvironmentalOpen in IMG/M
3300021170Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-MEnvironmentalOpen in IMG/M
3300021433Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-OEnvironmentalOpen in IMG/M
3300021474Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-OEnvironmentalOpen in IMG/M
3300021478Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-MEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300022721Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-4-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300024271Soil microbial communities from Bohemian Forest, Czech Republic ? CSU5EnvironmentalOpen in IMG/M
3300025961Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025986Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026332Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 (SPAdes)EnvironmentalOpen in IMG/M
3300027745Thawing permafrost microbial communities from the Arctic, studying carbon transformations - Permafrost 812P2MEnvironmentalOpen in IMG/M
3300027807Host-associated microbial communities from peat moss isolated from Minnesota, USA - S1T2_Fd - Sphagnum fallax MG (SPAdes)Host-AssociatedOpen in IMG/M
3300027853Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes)EnvironmentalOpen in IMG/M
3300027867Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027898Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 (SPAdes)EnvironmentalOpen in IMG/M
3300027905Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes)EnvironmentalOpen in IMG/M
3300027911Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes)EnvironmentalOpen in IMG/M
3300028574Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N2_2EnvironmentalOpen in IMG/M
3300028780Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_2EnvironmentalOpen in IMG/M
3300028860Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N2_3EnvironmentalOpen in IMG/M
3300028882Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N2_3EnvironmentalOpen in IMG/M
3300029882III_Palsa_E1 coassemblyEnvironmentalOpen in IMG/M
3300029907I_Bog_N1 coassemblyEnvironmentalOpen in IMG/M
3300029945I_Bog_N2 coassemblyEnvironmentalOpen in IMG/M
3300029990I_Fen_N2 coassemblyEnvironmentalOpen in IMG/M
3300030007I_Palsa_E1 coassemblyEnvironmentalOpen in IMG/M
3300030506Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N1_1EnvironmentalOpen in IMG/M
3300031231Coassembly Site 11 (all samples) - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031233Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E3_2EnvironmentalOpen in IMG/M
3300031234Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2EnvironmentalOpen in IMG/M
3300031236Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1EnvironmentalOpen in IMG/M
3300031525Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3EnvironmentalOpen in IMG/M
3300031744Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2)EnvironmentalOpen in IMG/M
3300031788Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_2EnvironmentalOpen in IMG/M
3300031890Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2)EnvironmentalOpen in IMG/M
3300031902Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_2EnvironmentalOpen in IMG/M
3300032052Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f19EnvironmentalOpen in IMG/M
3300032076Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2)EnvironmentalOpen in IMG/M
3300032515FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data)EnvironmentalOpen in IMG/M
3300032782Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1EnvironmentalOpen in IMG/M
3300032805Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2EnvironmentalOpen in IMG/M
3300032892Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5EnvironmentalOpen in IMG/M
3300032893Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1EnvironmentalOpen in IMG/M
3300033289Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108EnvironmentalOpen in IMG/M
3300033755Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB26FY SIP fractionEnvironmentalOpen in IMG/M
3300033818Peat soil microbial communities from Stordalen Mire, Sweden - 713 S-3-MEnvironmentalOpen in IMG/M
3300033982Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB22AY SIP fractionEnvironmentalOpen in IMG/M
3300034125Peat soil microbial communities from wetlands in Alaska, United States - Sheep_creek_tus_01_15EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
20013144992001200001SoilMKLRVIQVRGSWKDYVDVHALVLHGIDIRMALAAARAIDARFQPEISLRALQFYGDGTLVRVPGEIQRDLTRWAQSVDLAQLPHLASQRGPTPGELSL
Ga0066679_1062853313300005176SoilKDYVDIHTLVSHGVDVPTGLAAAKAIDRSFDPTTSIRALQFYGDGTLDRVPAAMQRDLSGWAQAVDLAKLPVLRPRRGLSPMELER*
Ga0066388_10214957813300005332Tropical Forest SoilAGMKMRVIQVRGSWKDYVDIHALVEHDISIPMALAAARAIDAQFIPATSIRALQFYGDGSLSRVPTRMQQDLSRWAQAVDLATLPTLSGRRGLTPEGLSR*
Ga0068868_10014617213300005338Miscanthus RhizosphereAIDAKFNPAISIQALHFFGDGTLSRVPIGMQQDLIRWAQIVDLTKLPTLKAWLGLAPEGLSR*
Ga0070688_10086648533300005365Switchgrass RhizosphereATHGVDVATGLASAKAIDRNFDPQISIRALQFYGDGTLDRVPAGMQRDLTHWAQVVDLKKLPGLQPKPGLSPGGLDR*
Ga0070667_10062886713300005367Switchgrass RhizosphereLVENGVDVPTGLAAAKAIDRKFEAATSIRALQFYGDGTLQRVPEAMRRDLTRWAQAVDLRELPVFNGRRGLCPGGLER*
Ga0070714_10200644823300005435Agricultural SoilAAAKAIDRNFDPTISIRALQFYGDGTLNRVSAGMQRDLTRWAKAVSPEKLPVLGHKRGLRPGGLER*
Ga0066686_1109203123300005446SoilRGSWKDYVDIHTLVSYGFDVPTGLAAAKAIDRSFDPAISIRALQFYGDGTLDRVPAAMQRDLSRWAQAVDLAKLPVLQPRRGLSPVGLER*
Ga0066689_1018946233300005447SoilMRVIQVRGSWKDYVDIHTLVSHGVDVPTGLAAAKAIDRSFDPTTSIRALQFYGDGTLDRVPAAMQRDLSGWAQAVDLAKLPVLQPRRGLSPMELER*
Ga0070735_1021671413300005534Surface SoilWKDYVDIHALLSHGIDVPTGLAAAKAIDREFDPITIIRALQFYGDGTLNRVPPAMQKDLTRSAQAVDLNKLPVLPARRGLSPGGMEQ*
Ga0070761_1001270813300005591SoilVIQVRGNWKDYVDIHALASHGIDVSTGLAAAKAIDKSFDPATSIRALQFYGDGTLDRVSLAMQQDLTRWARQVDLTKLPELHPRHGLTPGGMEL*
Ga0066903_10424767533300005764Tropical Forest SoilDIHAVVSYGIDVPTGLAAAKAIDRSFDVAISIRALQFYGDGTLDRVPVAIQRDLTRLAQKVDLAKLPTLRPRRGLTPEGLER*
Ga0075015_10031873913300006102WatershedsVSHGIDVPTGLAAAKAIDRKFDAATSIRALQFCGDGTLNRVPAAMQRDLTRWARVVNLAKLPIFQPRKGLSPGGLES*
Ga0075030_10113812723300006162WatershedsMRVIQVRGSWKDYVDIHTLVSHGIDVPTGLAAAKAIDRKFDAATSIRALQFYGDGTLNRVPAAMQRDLTRWARVVNLAKLPIFQPRKGLSPGGLES*
Ga0066709_10066743733300009137Grasslands SoilVIQVRGSWKDYVDIHTLVSYGFDVPTGLAAAKAIDRSFDPTISIRALQFYGDGTLDRVPAAMQRDLSRWAQAVDLAKLPVLQPRRGLSPVGLER*
Ga0116230_1047239233300009510Host-AssociatedVDLHVLALNGIDVVTGLSAARAIDPGFDPAVSVRALQYYGDGRLDRVPAAMQKDLSRWAQAVDLTKSPVFEARAGFTREEQI*
Ga0116108_109501033300009519PeatlandAGMKMRVIQVRGSWKDYADIHALVSHGIDVPTGLAAAKAIDRSFDPITSLRALQFYGDGTLDRVPAAMQRDLTRWAQAVDLGQLPSLHPRCGLTPGGLER*
Ga0116221_131967023300009523Peatlands SoilVDIHALVSNGIDLPTPLGRAKAIDRRFDPATSIRALQFYGDGTLDRVPAAMQRDLTRWAQEVDLTHLASLQPRRGLSPEGLER*
Ga0116138_114988823300009552PeatlandPTGLAAAKAIDRSFDPVTSLRALQFYGDGTLDRVPAAMQRDLTRWAQTVDLGQLPSLHPRRGLIPGGLER*
Ga0116125_102895823300009628PeatlandMKMRVIQVRGSWKDYVDIHALASNGIDLATGLAAARAIDANFDPATSIRALQFYGDGTLNRVPESMRRDLTRWAQQIDVRKLPVLRSKPGLSPGGMER*
Ga0116125_111151113300009628PeatlandMKMRVIQVRGSWKDYMDIHALATNGVDLPTGLAAAKAIDKTFDPVTSIRALQYYGDGTLDRVPTGVQQDLIRWVRAVELGKLPVLRSQRGLSPGGMER*
Ga0116114_100808523300009630PeatlandMKMRVIQVRGSWKDYADIHALVSHGIDVPTGLAAAKAIDRSFDPITSLRALQFYGDGTLDRVPAAMQRDLTRWAQAVDLGQLPSLHPRCGLTPGGLER*
Ga0116117_102021243300009635PeatlandVIQVRGSWKDYVDIHALASNGIDLATGLAAARAIDANFDPATSIRALQFYGDGTLNRVPESMRRDLTRWAQQIDVRKLPVLRSKPGLSPGGMER*
Ga0116117_122013623300009635PeatlandDLPTGLAAAKAIDKTFDPVTSIRALQYYGDGTLDRVPTGVQQDLIRWVRAVELGKLPVLRSQRGLSPGGMER*
Ga0116120_115133633300009641PeatlandVPTGLAAAKAIDRSFDPITSLRALQFYGDGTLDRVPAAMQRDLTRWAQAVDLGQLPSLHPRCGLTPGGLER*
Ga0116121_112649513300009644PeatlandTGLAAAQAIDPSFDPITSIRALQFYGDGTLNRVPVAMQRDLTRWAQAVDLGELPALHPQRGLSPGGLER*
Ga0116106_122410613300009645PeatlandGVDVPTGLAAAQAIDPSFDPITSIRALQFYGDGTLNRVPVAMQRDLTRWAQAVDLGELPALHPHRGLNPGGLER*
Ga0116101_100316313300009759PeatlandLAAANAIDKRFDPAISIRALQYYGDGTLDRVPIAMQRDLTGWARVVDLGKLPTLHSRRGLSPEGLER*
Ga0126373_1151659323300010048Tropical Forest SoilNWKDYVDIHALVTRGVDVPTGLAAAKAIDRSFDPIMSVRALQFYGDGTLNRVPAAMQKDLTRWARAVDLSNLPILHPRRGLIPGSLER*
Ga0126381_10200962813300010376Tropical Forest SoilYVDIHTLATCGIDVPTGLAAAKAIDRSFDPMTSVRALQFYGDGTLSRVPTGTQKDLTRWAQAVDLVKLPTLRAAV*
Ga0126381_10479611313300010376Tropical Forest SoilAESTHPLAWRAARAIDRSFDPITSVRALQFYGDGTLNRVPTSMQKDLTRLERAVDLSSLPVLHLRRGLSPGGLGR*
Ga0150983_1109003213300011120Forest SoilAHGIDLPTALAAAKAIDKRFDPATSIRALQYYGDGTLDRVPATMQRDLTGWARAVDLGKLPTLCAQRGLSPAGLER*
Ga0150983_1575028423300011120Forest SoilIDIPTGLAAAQAIDTKFDPAISIRALQFFGDGTLNRVPIGMQQDLTRWAQAVDLMKLPTLTARLGLAPEGLSR*
Ga0157378_1033449813300013297Miscanthus RhizosphereMKMRVIQARGSWKDYVDIHALVSHGVDVSLGLAAAKAIDRRFNPLTSVRALQFFGDGTLDRVPAAMQRDLTRWAQAVNLDNLPVLDSRPSLSPGEVGS*
Ga0181530_1004659843300014159BogVTRGIDVATGLAAAKAIDRRFDPITSIRALQFYGDGTLNRVPVAMRNDLTQWAQAVDLSNLPLLHPRRGLSPGGLER*
Ga0181528_1025888133300014167BogDYVDIHALASNGIDLATGLAAARAIDANFDPATSIRALQFYGDGTLNRVSESIRRDLTRWAQEIDLRKLPVLRPKPGLRPGGMER*
Ga0181531_1024274333300014169BogGIDVPTGLAAAKAIDRSFDPATSIRALQFFGDGTLNRVPVPMQTDLTGWAKAVNLSKLPTFHSRPNLSPGGLER*
Ga0181535_1071704213300014199BogMKMRVIQVRGSWKDYMDIHALATSGVDLPTGLAAAKAIDKSFDPVTSIRALQYYGDGTLDRVPTGVQQDLIRWVRAVDLGKLPVLHSHRGLSPGGMER*
Ga0181526_1061250723300014200BogLAGMKMRVIQVRGSWKDYMDIHALATSGVDLPTGLAAAKAIDKSFDPVTSIRALQYYGDGTLDRVPTGVQQDLIRWVRAVDLGKLPVLHSHRGLSPGGMER*
Ga0182018_10001587223300014489PalsaVTYGVDVRTGLAAAKAIDRSFDPITSIRALQFYGDGTLNRVPPAMQKDLTRWAQAVDLTKLPLLHPQGGLSPGGPER*
Ga0182012_1070646123300014499BogAAARAIDRTFDPLISLRALQFYGDGTLDQVPPAMQRDLTRWAQAAEPAKLPALSSRRGLSPGGRER*
Ga0182030_1134994213300014838BogMKMRVIQVRGSWKDYVDIHALASHGIDLATGLAAARAIDRSFDPTTSIRALQFYGDGTLYRVAESMRRDLTRWAQQVDLGKLPALRPQRGLSPEGMAL*
Ga0157379_1103723013300014968Switchgrass RhizosphereMRVIQARGSWKDYVDIHALVSHGVDVSLGLAAAKAIDRRFNLLTSVRALQFFGDGTLDRVPAAMQRDLTRWAQAVNLDNLPVLDSRPSLSPGEVGS*
Ga0137418_1074574813300015241Vadose Zone SoilSWKDYVDIHTLVSHGVDVPTGLAAAKAIDRSFDLTTSIRALQFYGDGTLDRVPAAMQRDLSRWAQAVELGKLPVLQSRRGLSPVGLER*
Ga0182032_1067776923300016357SoilMRVIQVRGSWKDYVDIHTLASHGVDVPTGLAAAKAIDRNFDPVTSIRALQFYGDGTLHRVPAAKQKDLTRWAQAVDLTKLPTLGPRRGLSPGGLER
Ga0182038_1163035013300016445SoilMKMRVIQVRANWKDYVDIHALVSYGIDAPTGLAAAKAIDRSFDVAISIRALQFYGDGTLDRVPAAIQRDLTRLAQKVDLAKLPTLRPRRGLTPGGLER
Ga0181509_124421313300016701PeatlandTLAANGVDIATGLAAASAIDGKFEPATSIRALQFYGDGNLDRVPAAMQQDLTRWAQQVDLAKLSTLPSRRGLAPEGRSR
Ga0187856_100223093300017925PeatlandMKMRVIQVRATWKDYVDIHTLVSHGVDVATSLAAAKAIDRSFDPAISVRALQFFGDGTLNRVPAPMQRDLIRWAQAIDLEKLPKLHPKPGLSLGGFER
Ga0187848_1000424513300017935PeatlandHGIDVPTGLAAAKAIDRSFDPVTSLRALQFYGDGTLDRVPAAIQRDLTRWAQAVDLGQLPSLRPQRGLTPGGLER
Ga0187853_1018228713300017940PeatlandHGIDVPTGLAAAKAIDRSFDPVTSLRALQFYGDGTLDRVPAAIQRDLTRWAQAVDLGQLPSLRPRRGLTPGGLER
Ga0187781_1134182023300017972Tropical PeatlandHGIDLQTALAAAKAIDPSFEPATSVRALQFYGDGTLDRVPADIQRDLTRWAQAVELARLPILQPRRGLSPQGLER
Ga0187805_1027529313300018007Freshwater SedimentVIQVRGSWKDYVDIHALVSHGIDVVTGLAAGKAIDRSFDPITSIRALQFYGDGTLSRVPAAIQKDLTRWAQAVDLAKLPVLRSRRGLSPGGLER
Ga0187880_104076723300018016PeatlandMKMRVIQVRGSWKDYADIHALVSHGIDVPTGLAAAKAIDRSFDPITSLRALQFYGDGTLDRVPAAMQRDLTRWAQAVDLGQLPSLHPRCGLTPGGLER
Ga0187889_1015263213300018023PeatlandIHALVSHGIDVPTGLAAAKAIDRSFDPVTSLRALQFYGDGTLDRVPAAIQRDLTRWAQAVDLGQLPSLRPQRGLTPGGLER
Ga0187857_1020205623300018026PeatlandMKMRVIQVRGSWKDYADIHALVSHGIDVPTGLAAAKAIDRSFDPVTSLRALQFYGDGTLDRVPAAMQRDLTRWAQAVDLGQLPSLHPRCGLTPGGLER
Ga0187863_1086895823300018034PeatlandVSHGIDVPTGLAAAKAIDRSFDPATSIRALQFFGDGTLNRVPVPMQTDLTGWAKAVNLSKLPTFHSRPNLSPGGLER
Ga0187883_1050888123300018037PeatlandGSWKDYVDIHTLVSHGIDVPTGLAAAKAIDRSFDPITSLRALQFYGDGTLNRVPPTMQRDLARWAQTVDLTKLPVFHPKRGLSPGGPEG
Ga0187887_1023984313300018043PeatlandPTGLAAAQAIDPSFDPITSIRALQFYGDGTLNRVPVAMQRDLTRWAQAVDLCELPALHPQRGLSPGGLER
Ga0187887_1046368813300018043PeatlandVTRGIDVSTSLAAAKAIDRQFDPLTSIRALQFYGDGTLHRVPAAMQKDLTRWAQAVDLARLPLLHPRR
Ga0187887_1083489113300018043PeatlandSHGIDLPIGLAAATAIDRSFDPAISIRALQFYGDGTLDRVPESMRRDLTRWARQVDLAKLPALKPKRGLSPGGMEL
Ga0187858_1009916913300018057PeatlandVPTGLAAAKAIDRSFDPVTSLRALQFYGDGTLDRVPAAMQRDLTRWAQTVDLGQLPSLHPRRGLIPGGLER
Ga0187858_1019440543300018057PeatlandAAAKAIDRQFDPLTSIRALQFYGDGTLQRVPAAMQKDLTRWAQTVDLAKLPLLHPRRGLSPEGQER
Ga0187784_1017772813300018062Tropical PeatlandKDYVDIHTLVSRGIEVPTGLAAAKAIDRNFDPVTSIRALQFYGDGTLNRVPAAMQKDLTRWAQAVDLTKLPTLGSRRGLSPGGLER
Ga0187769_1089593813300018086Tropical PeatlandMKMRVIQVRGSWKDYADIHTLVSHGIDVPSGRAAAQAIDRNFDPATSIRALQFYGDGTLHRVPAAMQRDLTRRAEAVDLKK
Ga0193726_109807723300020021SoilMKMRVIQVRGNWKDYVDIHALVSNGIDLATGLGAARAIDKNFDPATSIRALQFYGDGTLDRLPEGMRRDLTRWAQQVDPGKLPALWILIWPT
Ga0210400_1004636743300021170SoilMKMRVIQVRGSWKDYVDIHTLVSHGVDVPTGLAAAKAIDRNFDPSISIRALQFYGDGTLDRVPAGMQRDLTRWGQAVEVGKLPGLHAKRGLSRGGMER
Ga0210391_1146799213300021433SoilLPCGLAGMKMRVIQVRGSWKDYVDIHALVSNGVDLPKGLAAAKAIDRNFDPITSVRALQFYRDGTLDRVPIAMRRDLTRWAQAVELARLPSLRSQRGLSPGGSER
Ga0210390_1088533723300021474SoilMKMRVIQMRATWKDYVDIHTLVSHGIDLATGLAAAKAIDRNFDPAISVRALQFYGDGTLDRVPIQMQHDLTRWGQAIDLGKVPTLHAKPGLSPGG
Ga0210402_10003814113300021478SoilMKMRVIQVRGSWKDYVDIHTLVSHGIDVPTGLAAAKAIDRKFDPATSIRALQFYGDGTLSRVPAAMQSDLTRWAQMVNLAKLPVLQSRHGLSPGGLET
Ga0126371_1122739813300021560Tropical Forest SoilLASHGVDVPTGLAAAKAIDRNFDPVTSIRALQFYGDGTLHRVPAAKQKDLTRWAQAVDLTKLPTLGPRRGLSPGGLER
Ga0242666_114924713300022721SoilTALAAAQAIDISFDPAISIRALQFYGDGTLDRVPLAVRQDLTRWAQAVDLGKLPKLRPRRGLSAGGMEL
Ga0224564_113096613300024271SoilRGSWKDYVDIHTLVSRGGIDVPTGLAAAKAIDRSFDPITSIRALQYYGDGTLSRIPAAMQRDLTRWAQAVDLGKLPALHPRGGLSPGGLER
Ga0207712_1111665913300025961Switchgrass RhizosphereHALASHGIDIPTGLAAAQAIDSKFNPAISIRALQFFGDGTLSRVPIGMQQDLTRWAQAVDLMKLPTLTARLGLAPEGLSR
Ga0207658_1059873513300025986Switchgrass RhizosphereIHTLVENGVDVPTGLAAAKAIDRKFEAATSIRALQFYGDGTLQRVPEAMRRDLTRWAQAVDLRELPVFNGRRGLCPGGLER
Ga0209803_134716923300026332SoilMRVIQVRGSWKDYVDIHTLVSHGVDVPTGLAAAKAIDRSFDPTTSIRALQFYGDGTLDRVPAAMQRDLSGWAQAVDLAKLPVLQPRRGLSPMELER
Ga0209908_1006199913300027745Thawing PermafrostGDSLVTYGVDVRTGLAAAKAIDRSFDPITSIRALQFYGDGTLNRVPPAMQKDLTRWAQAVDLTKLPLLHPQGGLSPGGPER
Ga0209208_1036915623300027807Host-AssociatedVDLHVLALNGIDVVTGLSAARAIDPGFDPAVSVRALQYYGDGRLDRVPAAMQKDLSRWAQAVDLTKSPVFEARAGFTREEQI
Ga0209274_1002044143300027853SoilIHALASHGIDVSTGLAAAKAIDKSFDPATSIRALQFYGDGTLDRVSLAMQQDLTRWARQVDLTKLPELHPRHGLTPGGMEL
Ga0209167_1039861313300027867Surface SoilVSHGVDVPTGLAAAKAIDRTFDPTTSIRALQFYGDGTLDRVPAAMQLDLSRWARAVDLAKLPVLQPRRGLSPLGLER
Ga0209067_1069479523300027898WatershedsMKMRVIQVRGSWKDYVDIHTLVSHGIDVPTGLAAAKAIDRKFDPATSIRALQFYGDGTLNRVPAAMQRDLTHWARMVDLAKLPVFQPRKGLNREI
Ga0209415_1020552913300027905Peatlands SoilIDVSTGLAAAKAIDRQFDPLTSIRALQFYGDGTLHRVPAAMQKGLTRWAQAVDPARLPLLHPRCGLSPQGQER
Ga0209415_1092930523300027905Peatlands SoilIHTLVSHGVDVPTGLAAAQAIDPSFDPITSVRALLFYGDGTLNRVPAAMQRDLTRWAQAVDLGKLPALHPLRGLNPGGLER
Ga0209698_1116586223300027911WatershedsGSWKDYVDIHTLVSHGIDVPTGLAAAKAIDRKFDPATSIRVLQFYGDGTLNRVPTAVQRDLTHWARMVDLAKLPVFEPRKGLNPGGLES
Ga0302153_1017514813300028574BogGVDVPTGLAAAQAIDPSFDPITSIRALQFYGDGTLNRVPVAMQRDLTRWAQAVDLCELPALHPQRGLSPGGLER
Ga0302225_1015267413300028780PalsaIHALASHGIDLSTALAAAKAIDKSFDPATSIRALQFYGDGTLDRVPLAMQQDLTRWALQVDLNKLPELRPRHGLSPGGMER
Ga0302199_107540423300028860BogVPTGLAAAQAIDPSFDPITSIRALQFYGDGTLNRVPVAMQRDLTRWAQAVDLCELPALHPQRGLSPGGLER
Ga0302154_1029235723300028882BogLVTHGVDVPTGLAAAQAIDPSFDPITSIRALQFYGDGTLNRVPVAMQRDLTRWAQAVDLCELPALHPQRGLSPGGLER
Ga0311368_1092862923300029882PalsaALASHGIDLSTALAAAKAIDKSFDPATSIRALQFYGDGTLDRVPLAMQQDLTRWALQVDLNKLPELRPRHGLSPGGMER
Ga0311329_1102278823300029907BogALAAHGIDLPTALAAANAIDKRFDPAISIRALQYYGDGTLDRVPIAMQRDLTGWARVVDLGKLPTLHSRRGLSPEGLER
Ga0311330_1099142913300029945BogNGVDLSMGLAAATAIDKGFDPATSIRALQFYGDGTLNRVPDGMKRDLTRWAQQVNPGKLPKLRAKRGLSPGVAAP
Ga0311336_1089036313300029990FenVPTGLAAAKAIDRSFDPVTSIRALQFYGDGTLNRVPAAMQQDLTRWAQRVDLARLPTLHPRRGLSPGGLER
Ga0311338_1205241513300030007PalsaDVPTGLAAARAIDARFAPELSIRALQFFGDGTLSRVPATIQQDLTQWARGADPANLPTLRARGGLSPGGLDR
Ga0302194_1008688123300030506BogGLAAAQAIDPSFDPITSIRALQFYGDGTLNRVPVAMQRDLTRWAQAVDLCELPALHPQRGLSPGGLER
Ga0170824_10314365623300031231Forest SoilVDIHTLVSHGVDVPSGLAAAKAIDRNFDPVTSIRALQFYGDGTLHRVPAAMQRDLTRWATAVDLNKLPVLGSRRGLIPGGLER
Ga0302307_1071303223300031233PalsaIQVRGSWKDYVDIHALVSSGIDLQTGLAAAKAIDKNFDPITSIRALQFYGDGTLDRVPSAMRLDLTGWAKGVDLARLPVLHPRQGLSPGGLER
Ga0302325_1029680733300031234PalsaVRGSWKDYVDIHALVSNGVDLPTGLAAAKAIDRSFDPITSVRALQFYGDGTLDRVPIAMRRDLTRWAQAVDLARLPSLRSHRGLSPGGSER
Ga0302324_10231405513300031236PalsaSRWKDYVDSHTLVSHGIDVLAGLAAAKAIYRSFYPATSIRALQFFGYGTLNRVAVSMQTDLTGWAKAVNLAKLPTFHSRRNLSPEGLER
Ga0302326_1157001223300031525PalsaMKMRVIQMRGSWKDYVDIHALVMNGVRIAAALAAARAIDRKFEPATSVRALQFYGDGTLARVPANVQYDLTRWAREVDLNFLPVLRGRPGLSPRELAR
Ga0306918_1084825623300031744SoilLATHGIDVPTGLAAAKAIDRSFDPTTSVRALQFYGDGTLSRVPAAMQKDLCRWAQAVDLSEVRTLHPRHGLDPGGLER
Ga0302319_1034876443300031788BogQVRGSWKDYVDIHALASNGVDLSMGLAAATAIDKGFDPATSIRALQFYGDGTLNRVPDGMKRDLTRWAQQVNPGKLPKLRAKRGLSPGVAAP
Ga0306925_1067922323300031890SoilVDIHTLATHGIDVPTGLAAAKAIDQSFETTTSVRALQFYGDGTLSRVPAAMQKDLCRWAQAVDLSEVRTLHPRHGLDPGGLER
Ga0302322_10247773313300031902FenVRGSWKDYVDIHTLVSHGIDVPTGLAAAKAIDRSFDSVTSVRALQFYGDGTLNRVPAALQRDLTRWAQAVDLANLPTLHPRRGLSPGGRER
Ga0318506_1026077723300032052SoilWKDYVDIHALVSYGIDAPTGLAAAKAIDRSFDVAISIRALQFYGDGTLDRVPVAIQRDLTRLAQKVDLAKLPTLHPRRGLIPEGLER
Ga0306924_1135939523300032076SoilVDIHTLATHGIDVPTGLAAAKAIDQSFETTTSVRALQFYGDGTLSRVPAAMQKDLCRWAQAVDLSKLRTLHPRRGLDPGGLER
Ga0348332_1057395013300032515Plant LitterMKMRVIQVRGSWKEYVDIHTLVSRGGIDMPTGLAAAKAIDRSFDPITSIRALQYYGDGTLSRVPAGMQRDLTRWAQAVDLGKLPALHPLGGLSLGGLER
Ga0348332_1278292123300032515Plant LitterDIHTLVSRGGIDVPTGLAAAKAIDRSFDPITSIRALQYYGDGTLSRIPAAMQRDLTRWAQAVDLGKLPALHPRGGLSPGGLER
Ga0335082_1006714853300032782SoilMKMRVIQVRGSWKDYVDIHALVSSGIDVPAGLAAAKAIDREFDPVTSVRALQFYGDGTLNRVPAAVQRDLTRWAQAVDISRLPALRPRRGLSPGGMEP
Ga0335078_1086076533300032805SoilVPTGLAAAQAIDPNFDPITSVRALQFYGDGTLNRVPVAMQQDLTRWAQAVDLGELPALHPHRGLSPGGIER
Ga0335081_1242648323300032892SoilIQMRASWKDYVDIHTLVSHGIDVAAGLAAAKAIDKSFEPGISIRALQFYGDGTLSRVPSAMQHDLTRWAQIVDLKKLPTMHPKRHLSPGGLER
Ga0335069_1133283823300032893SoilQVRGSWKDYVDLHTLAVHGVDVATGLAAAKGIDRNFDPGISIRALQFYGDGTLDRVPAGMQRDLTRWAQAVNLGKLPILRPKRGLSLGGQER
Ga0310914_1172299723300033289SoilIDVPTGLAAAKAIDRSFDPTTSVRALQFYGDGTLSRVPAAMQKDLCRWAQAVDLSKLRTLHPRRGLDPGGLER
Ga0371489_0004925_2_2713300033755Peat SoilGSWKDYVDLHTLAANGVDIATGLAAASAIDSKFEPATSIRALQFYGDGNLDRVPAAMQQDLTRWAQQVDLAKLSTLPSRRGLAPEGRSR
Ga0334804_000656_4115_43183300033818SoilLAAAKAIDRSFDPITSIRALQFYGDGTLNRVPPAMQKDLTRWAQAVDLTKLPLLHPQGGLSPGGPER
Ga0371487_0216577_225_5213300033982Peat SoilMKMRVIQVRGSWKDYVDIHTLVTHGIDVSTGLAAAKAIDRNFDPITSIRALQFYGDGTLSRVPVAMQKDLTRWAQSVDLGKLPVLRPRRELSPGGLER
Ga0370484_0104969_1_2373300034125Untreated Peat SoilLVSHGIDVPTGLAAAKAIDRRFDPIMSIRALQFYGDGTLNRVPAAMQRDLTCWAQGVDLAKLPTLHPRRGLSPGGLER

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.