Basic Information | |
---|---|
Family ID | F080287 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 115 |
Average Sequence Length | 46 residues |
Representative Sequence | DAVNVLNKPQWGNPNMDINGTTFGRITTATGNRMVTLNARIDF |
Number of Associated Samples | 90 |
Number of Associated Scaffolds | 115 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 2.80 % |
% of genes near scaffold ends (potentially truncated) | 90.43 % |
% of genes from short scaffolds (< 2000 bps) | 86.96 % |
Associated GOLD sequencing projects | 83 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.20 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (91.304 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere (15.652 % of family members) |
Environment Ontology (ENVO) | Unclassified (25.217 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (52.174 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 0.00% Coil/Unstructured: 100.00% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.20 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 115 Family Scaffolds |
---|---|---|
PF00753 | Lactamase_B | 6.09 |
PF13620 | CarboxypepD_reg | 4.35 |
PF02518 | HATPase_c | 3.48 |
PF08669 | GCV_T_C | 1.74 |
PF01011 | PQQ | 1.74 |
PF12704 | MacB_PCD | 1.74 |
PF10518 | TAT_signal | 1.74 |
PF13191 | AAA_16 | 0.87 |
PF07729 | FCD | 0.87 |
PF05635 | 23S_rRNA_IVP | 0.87 |
PF13432 | TPR_16 | 0.87 |
PF04299 | FMN_bind_2 | 0.87 |
PF03969 | AFG1_ATPase | 0.87 |
PF00034 | Cytochrom_C | 0.87 |
PF16811 | TAtT | 0.87 |
PF05598 | DUF772 | 0.87 |
PF00578 | AhpC-TSA | 0.87 |
PF12796 | Ank_2 | 0.87 |
PF03712 | Cu2_monoox_C | 0.87 |
PF02566 | OsmC | 0.87 |
PF03473 | MOSC | 0.87 |
PF14559 | TPR_19 | 0.87 |
PF00109 | ketoacyl-synt | 0.87 |
PF03328 | HpcH_HpaI | 0.87 |
PF03713 | DUF305 | 0.87 |
PF13899 | Thioredoxin_7 | 0.87 |
PF14534 | DUF4440 | 0.87 |
PF10282 | Lactonase | 0.87 |
PF05198 | IF3_N | 0.87 |
PF13366 | PDDEXK_3 | 0.87 |
PF13442 | Cytochrome_CBB3 | 0.87 |
PF07593 | UnbV_ASPIC | 0.87 |
PF03683 | UPF0175 | 0.87 |
PF01068 | DNA_ligase_A_M | 0.87 |
PF01425 | Amidase | 0.87 |
PF12034 | DUF3520 | 0.87 |
PF05685 | Uma2 | 0.87 |
COG ID | Name | Functional Category | % Frequency in 115 Family Scaffolds |
---|---|---|---|
COG0154 | Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidase | Translation, ribosomal structure and biogenesis [J] | 0.87 |
COG0290 | Translation initiation factor IF-3 | Translation, ribosomal structure and biogenesis [J] | 0.87 |
COG0469 | Pyruvate kinase | Carbohydrate transport and metabolism [G] | 0.87 |
COG1423 | ATP-dependent RNA circularization protein, DNA/RNA ligase (PAB1020) family | Replication, recombination and repair [L] | 0.87 |
COG1485 | Cell division protein ZapE (Z ring-associated ATPase), AFG1 superfamily | Cell cycle control, cell division, chromosome partitioning [D] | 0.87 |
COG1764 | Organic hydroperoxide reductase OsmC/OhrA | Defense mechanisms [V] | 0.87 |
COG1765 | Uncharacterized OsmC-related protein | General function prediction only [R] | 0.87 |
COG1793 | ATP-dependent DNA ligase | Replication, recombination and repair [L] | 0.87 |
COG1802 | DNA-binding transcriptional regulator, GntR family | Transcription [K] | 0.87 |
COG2186 | DNA-binding transcriptional regulator, FadR family | Transcription [K] | 0.87 |
COG2301 | Citrate lyase beta subunit | Carbohydrate transport and metabolism [G] | 0.87 |
COG2886 | Predicted antitoxin, contains HTH domain | General function prediction only [R] | 0.87 |
COG3544 | Uncharacterized conserved protein, DUF305 family | Function unknown [S] | 0.87 |
COG3836 | 2-keto-3-deoxy-L-rhamnonate aldolase RhmA | Carbohydrate transport and metabolism [G] | 0.87 |
COG4636 | Endonuclease, Uma2 family (restriction endonuclease fold) | General function prediction only [R] | 0.87 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 91.30 % |
Unclassified | root | N/A | 8.70 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000559|F14TC_109530751 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 816 | Open in IMG/M |
3300000789|JGI1027J11758_12913506 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Chitinophaga → Chitinophaga pinensis | 2198 | Open in IMG/M |
3300003267|soilL1_10085952 | All Organisms → cellular organisms → Bacteria | 1359 | Open in IMG/M |
3300003321|soilH1_10213176 | All Organisms → cellular organisms → Bacteria | 1744 | Open in IMG/M |
3300004139|Ga0058897_11147909 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2620 | Open in IMG/M |
3300004463|Ga0063356_100720660 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1376 | Open in IMG/M |
3300004463|Ga0063356_100926255 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1234 | Open in IMG/M |
3300004633|Ga0066395_10553750 | All Organisms → cellular organisms → Bacteria | 669 | Open in IMG/M |
3300005338|Ga0068868_100348553 | All Organisms → cellular organisms → Bacteria | 1268 | Open in IMG/M |
3300005338|Ga0068868_100775598 | All Organisms → cellular organisms → Bacteria | 863 | Open in IMG/M |
3300005445|Ga0070708_101976533 | All Organisms → cellular organisms → Bacteria | 540 | Open in IMG/M |
3300005544|Ga0070686_100544112 | All Organisms → cellular organisms → Bacteria | 907 | Open in IMG/M |
3300005556|Ga0066707_10431262 | All Organisms → cellular organisms → Bacteria | 856 | Open in IMG/M |
3300005563|Ga0068855_100841856 | All Organisms → cellular organisms → Bacteria | 972 | Open in IMG/M |
3300005577|Ga0068857_100696687 | All Organisms → cellular organisms → Bacteria | 965 | Open in IMG/M |
3300005607|Ga0070740_10228510 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 767 | Open in IMG/M |
3300005719|Ga0068861_101915290 | All Organisms → cellular organisms → Bacteria | 590 | Open in IMG/M |
3300005764|Ga0066903_101298220 | All Organisms → cellular organisms → Bacteria | 1359 | Open in IMG/M |
3300005764|Ga0066903_102643367 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 973 | Open in IMG/M |
3300005764|Ga0066903_103772373 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 815 | Open in IMG/M |
3300005764|Ga0066903_105660007 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 657 | Open in IMG/M |
3300005764|Ga0066903_107937280 | All Organisms → cellular organisms → Bacteria | 545 | Open in IMG/M |
3300005841|Ga0068863_100652787 | All Organisms → cellular organisms → Bacteria | 1043 | Open in IMG/M |
3300006034|Ga0066656_10142914 | All Organisms → cellular organisms → Bacteria | 1490 | Open in IMG/M |
3300006049|Ga0075417_10286367 | All Organisms → cellular organisms → Bacteria | 797 | Open in IMG/M |
3300006175|Ga0070712_102048508 | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
3300006806|Ga0079220_10258283 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1048 | Open in IMG/M |
3300006844|Ga0075428_100178619 | All Organisms → cellular organisms → Bacteria | 2298 | Open in IMG/M |
3300006852|Ga0075433_11670217 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 549 | Open in IMG/M |
3300006852|Ga0075433_11719158 | All Organisms → cellular organisms → Bacteria | 540 | Open in IMG/M |
3300006871|Ga0075434_102221499 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 552 | Open in IMG/M |
3300006904|Ga0075424_101956416 | All Organisms → cellular organisms → Bacteria | 619 | Open in IMG/M |
3300006954|Ga0079219_10157946 | All Organisms → cellular organisms → Bacteria | 1222 | Open in IMG/M |
3300009012|Ga0066710_101676564 | All Organisms → cellular organisms → Bacteria | 969 | Open in IMG/M |
3300009090|Ga0099827_10302247 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_12_FULL_66_10 | 1354 | Open in IMG/M |
3300009093|Ga0105240_10430674 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1480 | Open in IMG/M |
3300009093|Ga0105240_10758436 | All Organisms → cellular organisms → Bacteria | 1054 | Open in IMG/M |
3300009094|Ga0111539_12740114 | All Organisms → cellular organisms → Bacteria | 571 | Open in IMG/M |
3300009100|Ga0075418_12235205 | All Organisms → cellular organisms → Bacteria | 597 | Open in IMG/M |
3300009162|Ga0075423_13046761 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
3300009176|Ga0105242_11783516 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 653 | Open in IMG/M |
3300009551|Ga0105238_10995462 | All Organisms → cellular organisms → Bacteria | 859 | Open in IMG/M |
3300010043|Ga0126380_10272748 | All Organisms → cellular organisms → Bacteria | 1186 | Open in IMG/M |
3300010043|Ga0126380_10729307 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 801 | Open in IMG/M |
3300010301|Ga0134070_10412864 | All Organisms → cellular organisms → Bacteria | 534 | Open in IMG/M |
3300010304|Ga0134088_10008322 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4389 | Open in IMG/M |
3300010304|Ga0134088_10369264 | All Organisms → cellular organisms → Bacteria | 697 | Open in IMG/M |
3300010358|Ga0126370_10191505 | All Organisms → cellular organisms → Bacteria | 1536 | Open in IMG/M |
3300010359|Ga0126376_13007638 | All Organisms → cellular organisms → Bacteria | 521 | Open in IMG/M |
3300010360|Ga0126372_10921546 | All Organisms → cellular organisms → Bacteria | 878 | Open in IMG/M |
3300010360|Ga0126372_11275801 | All Organisms → cellular organisms → Bacteria | 762 | Open in IMG/M |
3300010361|Ga0126378_10493315 | All Organisms → cellular organisms → Bacteria | 1340 | Open in IMG/M |
3300010361|Ga0126378_10824614 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1036 | Open in IMG/M |
3300010361|Ga0126378_11019066 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 931 | Open in IMG/M |
3300010361|Ga0126378_13381781 | Not Available | 507 | Open in IMG/M |
3300010362|Ga0126377_13065724 | All Organisms → cellular organisms → Bacteria | 539 | Open in IMG/M |
3300010366|Ga0126379_13000000 | All Organisms → cellular organisms → Bacteria | 565 | Open in IMG/M |
3300010398|Ga0126383_10191840 | All Organisms → cellular organisms → Bacteria | 1953 | Open in IMG/M |
3300010398|Ga0126383_12141513 | All Organisms → cellular organisms → Bacteria | 646 | Open in IMG/M |
3300010403|Ga0134123_12011212 | All Organisms → cellular organisms → Bacteria | 636 | Open in IMG/M |
3300010403|Ga0134123_12551372 | All Organisms → cellular organisms → Bacteria | 578 | Open in IMG/M |
3300012212|Ga0150985_117445719 | All Organisms → cellular organisms → Bacteria | 1067 | Open in IMG/M |
3300012212|Ga0150985_119656740 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1013 | Open in IMG/M |
3300012469|Ga0150984_119258902 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 526 | Open in IMG/M |
3300012683|Ga0137398_10816014 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 652 | Open in IMG/M |
3300012944|Ga0137410_10079987 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2388 | Open in IMG/M |
3300012971|Ga0126369_10489163 | All Organisms → cellular organisms → Bacteria | 1286 | Open in IMG/M |
3300012972|Ga0134077_10550878 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 516 | Open in IMG/M |
3300013306|Ga0163162_13147609 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 530 | Open in IMG/M |
3300013308|Ga0157375_10186092 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Caulobacterales → Caulobacteraceae | 2230 | Open in IMG/M |
3300014969|Ga0157376_11702045 | All Organisms → cellular organisms → Bacteria | 666 | Open in IMG/M |
3300015201|Ga0173478_10740016 | All Organisms → cellular organisms → Bacteria | 531 | Open in IMG/M |
3300015373|Ga0132257_101733567 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 801 | Open in IMG/M |
3300015374|Ga0132255_100931011 | All Organisms → cellular organisms → Bacteria | 1301 | Open in IMG/M |
3300015374|Ga0132255_101721327 | All Organisms → cellular organisms → Bacteria | 951 | Open in IMG/M |
3300016319|Ga0182033_12174937 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 506 | Open in IMG/M |
3300018431|Ga0066655_11281623 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 524 | Open in IMG/M |
3300018433|Ga0066667_11424174 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 609 | Open in IMG/M |
3300021404|Ga0210389_11020022 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 641 | Open in IMG/M |
3300021475|Ga0210392_10803992 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 702 | Open in IMG/M |
3300025165|Ga0209108_10493282 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 589 | Open in IMG/M |
3300025324|Ga0209640_10503881 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 987 | Open in IMG/M |
3300025901|Ga0207688_10668293 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 656 | Open in IMG/M |
3300025908|Ga0207643_11004506 | All Organisms → cellular organisms → Bacteria | 540 | Open in IMG/M |
3300025916|Ga0207663_10405188 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1044 | Open in IMG/M |
3300025923|Ga0207681_10920179 | All Organisms → cellular organisms → Bacteria | 733 | Open in IMG/M |
3300025923|Ga0207681_11690636 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 529 | Open in IMG/M |
3300025924|Ga0207694_11132497 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 662 | Open in IMG/M |
3300025930|Ga0207701_10947134 | All Organisms → cellular organisms → Bacteria | 719 | Open in IMG/M |
3300025933|Ga0207706_10094772 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2626 | Open in IMG/M |
3300025944|Ga0207661_10555963 | All Organisms → cellular organisms → Bacteria | 1051 | Open in IMG/M |
3300025949|Ga0207667_11418194 | All Organisms → cellular organisms → Bacteria | 668 | Open in IMG/M |
3300025960|Ga0207651_12087360 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 509 | Open in IMG/M |
3300026023|Ga0207677_10212533 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1546 | Open in IMG/M |
3300026075|Ga0207708_10174056 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1706 | Open in IMG/M |
3300026075|Ga0207708_10758013 | All Organisms → cellular organisms → Bacteria | 833 | Open in IMG/M |
3300026326|Ga0209801_1116715 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_12_FULL_66_10 | 1146 | Open in IMG/M |
3300027706|Ga0209581_1147470 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 768 | Open in IMG/M |
3300027748|Ga0209689_1133291 | All Organisms → cellular organisms → Bacteria | 1230 | Open in IMG/M |
3300027873|Ga0209814_10372665 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 626 | Open in IMG/M |
3300027873|Ga0209814_10469506 | All Organisms → cellular organisms → Bacteria | 556 | Open in IMG/M |
3300027882|Ga0209590_10176502 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_12_FULL_66_10 | 1340 | Open in IMG/M |
3300027907|Ga0207428_10885899 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 631 | Open in IMG/M |
3300031231|Ga0170824_116511245 | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
3300031720|Ga0307469_11558396 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 634 | Open in IMG/M |
3300031965|Ga0326597_10835878 | Not Available | 950 | Open in IMG/M |
3300032001|Ga0306922_10693141 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1073 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 15.65% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 13.91% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 5.22% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 4.35% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.35% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 3.48% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 3.48% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 3.48% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 3.48% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.61% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 2.61% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 2.61% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 2.61% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.74% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.74% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.74% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.74% |
Sugarcane Root And Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil | 1.74% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.74% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.74% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 1.74% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.74% |
Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 1.74% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.74% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.87% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere | 0.87% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.87% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.87% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.87% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.87% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.87% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.87% |
Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 0.87% |
Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 0.87% |
Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.87% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.87% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.87% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.87% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.87% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000559 | Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemly | Environmental | Open in IMG/M |
3300000789 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300003267 | Sugarcane bulk soil Sample L1 | Environmental | Open in IMG/M |
3300003321 | Sugarcane bulk soil Sample H1 | Environmental | Open in IMG/M |
3300004139 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF230 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Environmental | Open in IMG/M |
3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
3300005607 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen15_06102014_R2 | Environmental | Open in IMG/M |
3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
3300006049 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 | Host-Associated | Open in IMG/M |
3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
3300009793 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_30_40 | Environmental | Open in IMG/M |
3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
3300010301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09082015 | Environmental | Open in IMG/M |
3300010304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015 | Environmental | Open in IMG/M |
3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
3300012972 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
3300015201 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S014-104B-1 (version 2) | Environmental | Open in IMG/M |
3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
3300025165 | Soil microbial communities from Rifle, Colorado, USA - sediment 10ft 1 | Environmental | Open in IMG/M |
3300025324 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 10_1 (SPAdes) | Environmental | Open in IMG/M |
3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) | Host-Associated | Open in IMG/M |
3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025930 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Environmental | Open in IMG/M |
3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) | Environmental | Open in IMG/M |
3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 (SPAdes) | Environmental | Open in IMG/M |
3300027706 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen15_06102014_R2 (SPAdes) | Environmental | Open in IMG/M |
3300027748 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 (SPAdes) | Environmental | Open in IMG/M |
3300027873 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes) | Host-Associated | Open in IMG/M |
3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
3300031965 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT100D185 | Environmental | Open in IMG/M |
3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
F14TC_1095307512 | 3300000559 | Soil | GEAKSFKMRADVVNIWNTPQWGNPNSDINSSSFGRITTATGARSFIVNARVSF* |
JGI1027J11758_129135063 | 3300000789 | Soil | LNKPQWGTPNTNINGTTFGRITSVVGNVQRLVTLNARIDF* |
soilL1_100859521 | 3300003267 | Sugarcane Root And Bulk Soil | MRADVVNILNTPQWANPNMDINSGSFGRITSATGTRTVTLNARIDF* |
soilH1_102131761 | 3300003321 | Sugarcane Root And Bulk Soil | RADAVNVLNRAQWGNPSTNLNGTTFGRITSVVGNIQRVVTLNARIDF* |
Ga0058897_111479091 | 3300004139 | Forest Soil | GFLNKPIWGNPVTDINSATFGRITNASGARTVTLNARVDF* |
Ga0063356_1007206602 | 3300004463 | Arabidopsis Thaliana Rhizosphere | ADAINILNKPQWGLPSTNINSTTFGRITTATGSRTVLVNARVDF* |
Ga0063356_1009262551 | 3300004463 | Arabidopsis Thaliana Rhizosphere | TIRGDVVNILNSPQWGNPNTDINSSSFGRITSATGTRTVTMNARIEF* |
Ga0066395_105537502 | 3300004633 | Tropical Forest Soil | FTLRVDAVNILNITQWGNPNVQVNGATFGRITTVVGANNPQRTVTLNARFDF* |
Ga0068868_1003485532 | 3300005338 | Miscanthus Rhizosphere | LLNKPQWGNPTTDINSASFGRINSATGNRTVTFNARIDF* |
Ga0068868_1007755982 | 3300005338 | Miscanthus Rhizosphere | ADAVNVLNKPIWGNPNTDINSNSFGRITTAVGSRTVTISGRVDF* |
Ga0070708_1019765332 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | TIFTMRADAINLLNKPQWGLPDTNINSGTFGRITTATGSRTILLNARVDF* |
Ga0070686_1005441122 | 3300005544 | Switchgrass Rhizosphere | SIRADAVNFLNTPVWGNPTTNINSTNFGKITTAGGARTITLSARIDF* |
Ga0066707_104312621 | 3300005556 | Soil | DAINVLNRPNWGAPSTNVNSASFGRITTATGNRTITFNARLDF* |
Ga0068855_1008418561 | 3300005563 | Corn Rhizosphere | RTKMTVRADIINLLNKPQWGNPTTDINSASFGRINSATGNRTVTFNLRIDF* |
Ga0068857_1006966871 | 3300005577 | Corn Rhizosphere | KTFTLRADVVNVLNKPQWNNPNTNINGATFGRITTVVGNAQRLVTFNARIDF* |
Ga0070740_102285102 | 3300005607 | Surface Soil | KPQWGNPNTNINSTSFGRITTATGSRTVVVNGRFDF* |
Ga0068861_1019152901 | 3300005719 | Switchgrass Rhizosphere | DAINMLNKAQWGPPDTNINSGTFGRITTATGSRTILLNARVDF* |
Ga0066903_1012982201 | 3300005764 | Tropical Forest Soil | DAVNVLNKPQWGNPNMDINGTTFGRITTATGNRMVTLNARLDF* |
Ga0066903_1026433672 | 3300005764 | Tropical Forest Soil | IKENVRFTMRVDAINALNRPQWGNPNTDYNSAAFGRITDATGARTITFNSRIDF* |
Ga0066903_1037723731 | 3300005764 | Tropical Forest Soil | DAVNFLNKPMWADPVTDINSTTFGRITSAGGARMVTLNARVDF* |
Ga0066903_1056600072 | 3300005764 | Tropical Forest Soil | DAVNVLNKPQWGNPNMDINGTTFGRITTATGNRMVTLNARIDF* |
Ga0066903_1079372801 | 3300005764 | Tropical Forest Soil | AVNVLNRPMWDIPNTDINSANFGRITTATGTRTIVINARVDF* |
Ga0068863_1006527873 | 3300005841 | Switchgrass Rhizosphere | IRADAVNFLNTPVWGNPTTNINSTNFGKITTAGGARTITISARIDF* |
Ga0066656_101429141 | 3300006034 | Soil | KSFTIRADAVNVLNRPVWGNPNTDINSNGFGRITTATGSRTITVGARVDF* |
Ga0075417_102863671 | 3300006049 | Populus Rhizosphere | NPSVNVNGSTFGRITTVVGNAPFQRQVTLTARIDF* |
Ga0075417_102974613 | 3300006049 | Populus Rhizosphere | VQVTEGIRFTIRADAINILNKPQWGAPITDINNPDFGLITQATGSRTITINARIDF* |
Ga0070712_1020485082 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | ADAVNVLNKPQWGNPNTSINGTTFGRITAAGGARTVTLNARIDF* |
Ga0079220_102582832 | 3300006806 | Agricultural Soil | VFRFRETKTFTVRADAINLLNKPQWGLPNTSINSTSFGQITTATGTRTITFNARIDF* |
Ga0075428_1001786191 | 3300006844 | Populus Rhizosphere | NKPQWGNPNTNINGTTFGRITSVVGNAQRLVTLNARIDF* |
Ga0075433_114704562 | 3300006852 | Populus Rhizosphere | PVWDNPNTDINSTTFGRITQHPTTTTGARTITINVRIDF* |
Ga0075433_116702171 | 3300006852 | Populus Rhizosphere | IRADAVNALNRPIWGNPNTNINSANFGRITTATGARTITISARLDF* |
Ga0075433_117191581 | 3300006852 | Populus Rhizosphere | MIRADAVNVLNHTVWGPPNPDINSASFGRITTATGARRIT |
Ga0075434_1022214992 | 3300006871 | Populus Rhizosphere | MALTKKVRISEGKTFSLRADAANVLNKPIWGNPNTNINSTSFGRITTATGART |
Ga0075424_1019564161 | 3300006904 | Populus Rhizosphere | LNKPQWGNPTLDINSLNFGRITTAAGSRTFTVNARVNF* |
Ga0079219_101579461 | 3300006954 | Agricultural Soil | TITERTKVTLRADVINLLNKPQWGNPVTDINSASFGRINSATGNRTVTFNLRIDF* |
Ga0075435_1014870012 | 3300007076 | Populus Rhizosphere | DNPNTDINSTSFGRITQHPLNTTGARTITINARIDF* |
Ga0066710_1016765641 | 3300009012 | Grasslands Soil | ESKTFTLRADVVNVLNRPQWGDPNTNINGSTFGRITTVVGNAQRLVTLNARIDF |
Ga0099827_103022472 | 3300009090 | Vadose Zone Soil | SEKTIFTLRADAINVLNKPQWGLPNTNINSAMFGRITTAMGSRMILLNGRVDF* |
Ga0105240_104306743 | 3300009093 | Corn Rhizosphere | ADVINLLNIPQSGNPTTDINSASFGRINSATGNRTVTFNLRIDF* |
Ga0105240_107584362 | 3300009093 | Corn Rhizosphere | KPQWGNPTTDINSASFGRINTATGNRTITLNVRVDF* |
Ga0111539_127401141 | 3300009094 | Populus Rhizosphere | TSFTLRADAVNVLNKPQWGNPNMNINSASFGRITTATGARQITINLRLDF* |
Ga0075418_108345621 | 3300009100 | Populus Rhizosphere | WDDPETDINSANFGRITDVRNGTTRTITINARIDF* |
Ga0075418_122352051 | 3300009100 | Populus Rhizosphere | QKRVQVREGTSFTLRADAVNVLNKPQWGNPNMNINSASFGRITTATGARQITINLRLDF* |
Ga0111538_120212262 | 3300009156 | Populus Rhizosphere | WDNPNTDINSASFGRITQHPTNTTGARTITINARIDF* |
Ga0075423_120665942 | 3300009162 | Populus Rhizosphere | PGRLGLDMALMKRVQVTEGIRFTIRADAINILNKPQWGAPITDINNPDFGLITQATGSRTITINARIDF* |
Ga0075423_130467612 | 3300009162 | Populus Rhizosphere | MAESRTIEIRADAVNALNRPVWGNPNLNINSANFGRITTATGARSITINLRVDF* |
Ga0105242_117835162 | 3300009176 | Miscanthus Rhizosphere | ADVINLMNKPQWGNPVTDINSASFGRINTATGNRTVTFNVRLDF* |
Ga0105238_109954621 | 3300009551 | Corn Rhizosphere | TVRADIINLLNKPQWGNPTTDINSASFGRINSATGNRTVTFNARIDF* |
Ga0105077_1154022 | 3300009793 | Groundwater Sand | LNRPIWDNPNTDINSASFGRITGHPANTGARTITINARIDF* |
Ga0126380_102727481 | 3300010043 | Tropical Forest Soil | AVNVLNRPVWDNPNTDINSASFGRITQHPMNPTITGARTITINARIDF* |
Ga0126380_107293071 | 3300010043 | Tropical Forest Soil | SEGKTFTLRADAVNVLNKPQWGNPNMDINGTTFGRITTATGNRMVTLNARIDF* |
Ga0126382_110342982 | 3300010047 | Tropical Forest Soil | DSPTAANMDINSNSFGRITTATGSRTITINARIDF* |
Ga0134070_104128641 | 3300010301 | Grasslands Soil | NRPIWGNPNMNINSATFGRITTATGNRTITFNARIDF* |
Ga0134088_100083226 | 3300010304 | Grasslands Soil | GENKLFTLRTDAINVLNRPIWGNPNMNINSATFGRITTALGNRTITFNARVDF* |
Ga0134088_103692642 | 3300010304 | Grasslands Soil | LNHPVWGDPNTDINSSLFGRITTATGSRTITLNARIDF* |
Ga0126370_101915053 | 3300010358 | Tropical Forest Soil | QISVFNKPQWGLPNTYINLATFGRITTATGARTVTLNARVDF* |
Ga0126376_130076381 | 3300010359 | Tropical Forest Soil | FTLRADAVNVLNKAQFGNPNVDINNVNFGRITTSSGNRMITFNARIDF* |
Ga0126372_109215461 | 3300010360 | Tropical Forest Soil | LGIDAANVLNKPQWGNPSVNVNGSTFGRITTVVGNAPFQRQVTLTARIDF* |
Ga0126372_112758011 | 3300010360 | Tropical Forest Soil | PQWGNPNVYINGSTFGRITTVVGDQQRLVTLNARIDF* |
Ga0126378_104933152 | 3300010361 | Tropical Forest Soil | LNKPQWGNPSVNVNGSTFGRITTVVGNAPFQRQVILTARIDF* |
Ga0126378_108246143 | 3300010361 | Tropical Forest Soil | PIFGNPNTNINSTSFGRITGLSTIGYPSRLVVLQGRLYF* |
Ga0126378_110190662 | 3300010361 | Tropical Forest Soil | TIRADAVNVLNRPIWDIPNTDINADNFGRITTATGTRTIVINARVDF* |
Ga0126378_133817812 | 3300010361 | Tropical Forest Soil | VLNKPQWGNPNMDINGTTFGRITTATGNRMVTLNARIDF* |
Ga0126377_130657241 | 3300010362 | Tropical Forest Soil | KPQWGNPSVNVNGATFGRITTVVGNVQRLVTLNARIDF* |
Ga0126379_130000001 | 3300010366 | Tropical Forest Soil | NRTQWGNPSTNINGTTFGRITSATGARTVTLNARIDF* |
Ga0126383_101918401 | 3300010398 | Tropical Forest Soil | KTQWGNPSANVNGTTFGNITSVIGNVGRLVTLNARIDF* |
Ga0126383_121415131 | 3300010398 | Tropical Forest Soil | AIRADAVNILNKPIWGNPSTNFNGANFGRITTAGGSRTVTLEGRIDF* |
Ga0134123_120112122 | 3300010403 | Terrestrial Soil | LQKRVQVREGTSFTLRADAVNVLNKPQWGSPNMNINSASFGRITTATGARQITINLRLDF |
Ga0134123_125513722 | 3300010403 | Terrestrial Soil | EGKTFAIRADAVNILNRPVWGNPSTNFNGANFGRITTAGGNRTVTLEARIDF* |
Ga0150985_1174457193 | 3300012212 | Avena Fatua Rhizosphere | RADIINVLNKPQWGNPVTDINSASFGRINAATGNRTVTFNARIDF* |
Ga0150985_1196567403 | 3300012212 | Avena Fatua Rhizosphere | LNKPQWGLPNTNINSTTFGRITTATGSRTILMNARVDF* |
Ga0150984_1192589021 | 3300012469 | Avena Fatua Rhizosphere | ADAINILNKPQWGLPNTNINSTTFGRITAATGSRAVLLGARVDF* |
Ga0137398_108160142 | 3300012683 | Vadose Zone Soil | IGEGKSFTIRADAINALNRPVWGNPNTNINSTLFGRITSATGNRTITFSSRLDF* |
Ga0137410_100799872 | 3300012944 | Vadose Zone Soil | AINVLNKPQWGLPNTNINSAMFGRITTATGSRMILLNGRVDF* |
Ga0126369_104891633 | 3300012971 | Tropical Forest Soil | RTRLAARTTFTIRADAVNVLNRPMWDIPNTDINSDTFGRITTATGTRTIVINARVDF* |
Ga0134077_105508782 | 3300012972 | Grasslands Soil | FTIRADAVNVLNRPIWDNPTAANMDINSPSFGRITTAGGARTITLNARIDF* |
Ga0163162_131476092 | 3300013306 | Switchgrass Rhizosphere | TERTKMTVRADVINLLNKPQWGNPTTDINSASFGRINSATGNRTVTFNARIDF* |
Ga0157375_101860923 | 3300013308 | Miscanthus Rhizosphere | RADVINLLNKPQWGNPTTDINSASFGRINSATGNRTVTFNARIDF* |
Ga0157376_117020451 | 3300014969 | Miscanthus Rhizosphere | TITERTKLTLRADIINLLNKPQWGNPTTDINSTSFGRINSATGNRTVTFNLRLDF* |
Ga0173478_107400162 | 3300015201 | Soil | VNVLNKPQWNNPNTNINGATFGRITSVVGNQQRLVTFNARIDF* |
Ga0132257_1017335672 | 3300015373 | Arabidopsis Rhizosphere | ADAVNVLNRPIWDNPNTDINSATFGRITSATGTRTITMNARIDF* |
Ga0132255_1009310112 | 3300015374 | Arabidopsis Rhizosphere | FTLRADAINILNKPQWGLPDTNINSTSFGRITTATGSRTILINARVDF* |
Ga0132255_1017213271 | 3300015374 | Arabidopsis Rhizosphere | MTQFSNPNVNVNGATFGRITTVVGGNNPQRQVTLNARFDF* |
Ga0182033_121749372 | 3300016319 | Soil | NKPQWGNPNTNINSTSFGRITTATGSRTVVLNGRLDF |
Ga0066655_112816231 | 3300018431 | Grasslands Soil | RADVVNVLNKPQWGNPNTNINGSTFGRITTVVGNAQRLVTLNARIDF |
Ga0066667_114241741 | 3300018433 | Grasslands Soil | FTLRADAINMLNKPQWGLPNTNINSSTFGRITTAMGSRTVVLNARVDF |
Ga0210389_110200221 | 3300021404 | Soil | FNMAATKSVKISEGKTFTLRADAVNVLNKPQWGAPTASFNGTSFGRITSALGNRTVTLDARIDF |
Ga0210392_108039921 | 3300021475 | Soil | RADAVNVLNRTQWGNPSTNVNGTTFGRITSVVGNVGRLVTLNARIEF |
Ga0209108_104932822 | 3300025165 | Soil | LNTPQWGNPNTSIDSASFGRITSAGGTRSVTLSARFDF |
Ga0209640_105038811 | 3300025324 | Soil | DLLNKPQWGNPNTDINSQNFGRITQSAGNRTITLTARFDF |
Ga0207688_106682931 | 3300025901 | Corn, Switchgrass And Miscanthus Rhizosphere | EGLSFTLRADAVNVLNKPQWGAPNMNINSSSFGRITTATGARTITINARVDF |
Ga0207643_110045062 | 3300025908 | Miscanthus Rhizosphere | KPQWGNPSTNFNGANFGRITTAIGSRTVTLEARIDF |
Ga0207663_104051881 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | LLNKPQWGNPTTDINSASFGRINSASGNRTVTFNLRIDF |
Ga0207681_109201792 | 3300025923 | Switchgrass Rhizosphere | VLNTPVWGNPNTDINSNAFGRITTATGARTITLSGRIDF |
Ga0207681_116906362 | 3300025923 | Switchgrass Rhizosphere | ARSFTIRADAVNVLNTPVWGNPNTDINSNSFGRITTATGARTVTVSARIDF |
Ga0207694_111324972 | 3300025924 | Corn Rhizosphere | LLNKPQWGNPVTDINSASFGRISAASGNRTVTFNARIDF |
Ga0207701_109471341 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | RGDAVNVLNKPQWGAPNMNINSASFGRITTATGARTITINARIDF |
Ga0207706_100947721 | 3300025933 | Corn Rhizosphere | RADIINLLNKPQWGNPTTDINSASFGRINSATGNRTVTFNARIDF |
Ga0207661_105559632 | 3300025944 | Corn Rhizosphere | TVRADIINLLNKPQWGNPTTDINSASFGRINSATGNRTVTFNARIDF |
Ga0207667_114181941 | 3300025949 | Corn Rhizosphere | KTKVTLRADVINLLNKPQWGNPTTDINSASFGRINSATGNRTVTFNLRIDF |
Ga0207651_120873601 | 3300025960 | Switchgrass Rhizosphere | NAAAGKAFTLTERMKMTMRFDIINLLNKPQWGNPTTDINSASFGRINSATGNRTVTFNARIDF |
Ga0207677_102125333 | 3300026023 | Miscanthus Rhizosphere | MTMRFDIINLLNKPQWGNPTTDINSASFGRINSATGNRTVTFNARIDF |
Ga0207708_101740562 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | LCEQRFVEIRADAINALNRPVWGNPSTNINSANFGRITAASGARTITFSARVDF |
Ga0207708_107580131 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | IRADAVNALNRPMWGTPNTNINSANFGRITTATGARTITFSARLDF |
Ga0209801_11167152 | 3300026326 | Soil | RISEKTIFTLRADAINVLNKPQWGLPNTNINSAMFGRITTAMGSRMILLNGRVDF |
Ga0209581_11474702 | 3300027706 | Surface Soil | KPQWGNPNTNINSTSFGRITTATGSRTVVVNGRFDF |
Ga0209689_11332912 | 3300027748 | Soil | RADAINLLNTPQWDIPNTDINSPSFGRITKERVPGSRTILLNARVDF |
Ga0209814_103726651 | 3300027873 | Populus Rhizosphere | NILNITQWSNPNVNVNGATFGRITTVVGANNPQRTVTLNARFDF |
Ga0209814_104695061 | 3300027873 | Populus Rhizosphere | ADAINILNKPQWGAPITDINNPDFGLITQATGSRTITINARIDF |
Ga0209590_101765021 | 3300027882 | Vadose Zone Soil | SFTLRGDAVNVLNKPQWGLPNTNINSAMFGRITTAMGSRMILLNGRVDF |
Ga0207428_108858991 | 3300027907 | Populus Rhizosphere | PVWGNPNTDINSNAFGRITTATGARTITLSGRIDF |
Ga0170824_1165112451 | 3300031231 | Forest Soil | LNSPQWGYSLQAGGPVTDINNPNFGLITAAGGARTITINARIDF |
Ga0307469_115583962 | 3300031720 | Hardwood Forest Soil | TKLTFRADVINLLNKPQWGNPTTDINSASFGRINTATGNRTVTLNARIDF |
Ga0326597_108358781 | 3300031965 | Soil | NMLNNPQFGNPNTNMYSNNFGRITGAGGARQFTLNARIDF |
Ga0306922_106931411 | 3300032001 | Soil | KPQWGLPVTNINSATFGRITTATGNRTVTFNARLDF |
⦗Top⦘ |