NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F080331

Metagenome Family F080331

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F080331
Family Type Metagenome
Number of Sequences 115
Average Sequence Length 39 residues
Representative Sequence YARAANLFDKQYQDALGYPALGRDFRLGLKYRFAGRN
Number of Associated Samples 100
Number of Associated Scaffolds 115

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 99.13 %
% of genes from short scaffolds (< 2000 bps) 92.17 %
Associated GOLD sequencing projects 96
AlphaFold2 3D model prediction Yes
3D model pTM-score0.23

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (97.391 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil
(27.826 % of family members)
Environment Ontology (ENVO) Unclassified
(31.304 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(45.217 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 50.77%    β-sheet: 0.00%    Coil/Unstructured: 49.23%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.23
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 115 Family Scaffolds
PF01902Diphthami_syn_2 88.70
PF00593TonB_dep_Rec 5.22
PF02934GatB_N 3.48
PF02569Pantoate_ligase 0.87
PF13699DUF4157 0.87

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 115 Family Scaffolds
COG2102Diphthamide synthase (EF-2-diphthine--ammonia ligase)Translation, ribosomal structure and biogenesis [J] 88.70
COG0064Asp-tRNAAsn/Glu-tRNAGln amidotransferase B subunitTranslation, ribosomal structure and biogenesis [J] 3.48
COG2511Archaeal Glu-tRNAGln amidotransferase subunit E, contains GAD domainTranslation, ribosomal structure and biogenesis [J] 3.48
COG0414Panthothenate synthetaseCoenzyme transport and metabolism [H] 0.87

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms97.39 %
UnclassifiedrootN/A2.61 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300002914|JGI25617J43924_10186410All Organisms → cellular organisms → Bacteria691Open in IMG/M
3300005187|Ga0066675_10134710All Organisms → cellular organisms → Bacteria1678Open in IMG/M
3300005542|Ga0070732_10437983All Organisms → cellular organisms → Bacteria → Proteobacteria790Open in IMG/M
3300005557|Ga0066704_10163482All Organisms → cellular organisms → Bacteria1497Open in IMG/M
3300005586|Ga0066691_10862655All Organisms → cellular organisms → Bacteria533Open in IMG/M
3300005591|Ga0070761_10331138All Organisms → cellular organisms → Bacteria920Open in IMG/M
3300005843|Ga0068860_102849602All Organisms → cellular organisms → Bacteria501Open in IMG/M
3300005921|Ga0070766_10070259All Organisms → cellular organisms → Bacteria2015Open in IMG/M
3300006175|Ga0070712_100094855All Organisms → cellular organisms → Bacteria2194Open in IMG/M
3300006175|Ga0070712_100190164All Organisms → cellular organisms → Bacteria1606Open in IMG/M
3300006800|Ga0066660_11309513All Organisms → cellular organisms → Bacteria567Open in IMG/M
3300006804|Ga0079221_10177957All Organisms → cellular organisms → Bacteria1143Open in IMG/M
3300006806|Ga0079220_10009436All Organisms → cellular organisms → Bacteria3721Open in IMG/M
3300006854|Ga0075425_100242288All Organisms → cellular organisms → Bacteria2075Open in IMG/M
3300007258|Ga0099793_10307116All Organisms → cellular organisms → Bacteria → Acidobacteria771Open in IMG/M
3300009038|Ga0099829_11086949All Organisms → cellular organisms → Bacteria → Acidobacteria663Open in IMG/M
3300009038|Ga0099829_11337535All Organisms → cellular organisms → Bacteria → Acidobacteria592Open in IMG/M
3300009089|Ga0099828_10289028All Organisms → cellular organisms → Bacteria1474Open in IMG/M
3300009090|Ga0099827_10900531All Organisms → cellular organisms → Bacteria → Acidobacteria766Open in IMG/M
3300010303|Ga0134082_10107007All Organisms → cellular organisms → Bacteria1110Open in IMG/M
3300010322|Ga0134084_10136535All Organisms → cellular organisms → Bacteria814Open in IMG/M
3300010358|Ga0126370_10472062All Organisms → cellular organisms → Bacteria → Acidobacteria1052Open in IMG/M
3300010358|Ga0126370_11253760All Organisms → cellular organisms → Bacteria → Acidobacteria692Open in IMG/M
3300010359|Ga0126376_12327318All Organisms → cellular organisms → Bacteria → Acidobacteria582Open in IMG/M
3300010366|Ga0126379_13325438All Organisms → cellular organisms → Bacteria → Acidobacteria538Open in IMG/M
3300010376|Ga0126381_102441697All Organisms → cellular organisms → Bacteria → Acidobacteria749Open in IMG/M
3300010376|Ga0126381_104633995All Organisms → cellular organisms → Bacteria → Acidobacteria530Open in IMG/M
3300010379|Ga0136449_101505646All Organisms → cellular organisms → Bacteria1030Open in IMG/M
3300010396|Ga0134126_10934945All Organisms → cellular organisms → Bacteria → Acidobacteria974Open in IMG/M
3300012096|Ga0137389_10370660All Organisms → cellular organisms → Bacteria1220Open in IMG/M
3300012096|Ga0137389_10971447All Organisms → cellular organisms → Bacteria → Acidobacteria728Open in IMG/M
3300012189|Ga0137388_10646186All Organisms → cellular organisms → Bacteria → Acidobacteria983Open in IMG/M
3300012189|Ga0137388_11065682All Organisms → cellular organisms → Bacteria → Acidobacteria744Open in IMG/M
3300012202|Ga0137363_11375613All Organisms → cellular organisms → Bacteria → Acidobacteria595Open in IMG/M
3300012203|Ga0137399_10095519All Organisms → cellular organisms → Bacteria2288Open in IMG/M
3300012206|Ga0137380_11181146All Organisms → cellular organisms → Bacteria → Acidobacteria650Open in IMG/M
3300012210|Ga0137378_11195051All Organisms → cellular organisms → Bacteria → Acidobacteria676Open in IMG/M
3300012359|Ga0137385_10336575All Organisms → cellular organisms → Bacteria1293Open in IMG/M
3300012361|Ga0137360_10151987All Organisms → cellular organisms → Bacteria1835Open in IMG/M
3300012361|Ga0137360_10446481All Organisms → cellular organisms → Bacteria1095Open in IMG/M
3300012363|Ga0137390_11845434All Organisms → cellular organisms → Bacteria → Acidobacteria534Open in IMG/M
3300012582|Ga0137358_10166495All Organisms → cellular organisms → Bacteria1503Open in IMG/M
3300012582|Ga0137358_10324873All Organisms → cellular organisms → Bacteria1043Open in IMG/M
3300012685|Ga0137397_11051052All Organisms → cellular organisms → Bacteria → Acidobacteria596Open in IMG/M
3300012925|Ga0137419_10179842All Organisms → cellular organisms → Bacteria → Acidobacteria1551Open in IMG/M
3300012927|Ga0137416_10582973All Organisms → cellular organisms → Bacteria → Acidobacteria972Open in IMG/M
3300012929|Ga0137404_10436705All Organisms → cellular organisms → Bacteria → Acidobacteria1159Open in IMG/M
3300012930|Ga0137407_12191512All Organisms → cellular organisms → Bacteria → Acidobacteria528Open in IMG/M
3300013296|Ga0157374_10595530All Organisms → cellular organisms → Bacteria1115Open in IMG/M
3300015054|Ga0137420_1054227All Organisms → cellular organisms → Bacteria1181Open in IMG/M
3300015373|Ga0132257_104559850All Organisms → cellular organisms → Bacteria → Acidobacteria504Open in IMG/M
3300017823|Ga0187818_10246223Not Available781Open in IMG/M
3300018042|Ga0187871_10560156All Organisms → cellular organisms → Bacteria → Acidobacteria633Open in IMG/M
3300018057|Ga0187858_10396070All Organisms → cellular organisms → Bacteria859Open in IMG/M
3300018062|Ga0187784_10915526All Organisms → cellular organisms → Bacteria → Acidobacteria698Open in IMG/M
3300018089|Ga0187774_10643233All Organisms → cellular organisms → Bacteria → Acidobacteria693Open in IMG/M
3300018090|Ga0187770_10659298All Organisms → cellular organisms → Bacteria → Acidobacteria834Open in IMG/M
3300018090|Ga0187770_11148839All Organisms → cellular organisms → Bacteria → Acidobacteria627Open in IMG/M
3300019887|Ga0193729_1149545All Organisms → cellular organisms → Bacteria → Acidobacteria845Open in IMG/M
3300020170|Ga0179594_10280996All Organisms → cellular organisms → Bacteria → Acidobacteria629Open in IMG/M
3300020199|Ga0179592_10330086All Organisms → cellular organisms → Bacteria → Acidobacteria674Open in IMG/M
3300020579|Ga0210407_10430727All Organisms → cellular organisms → Bacteria → Acidobacteria1032Open in IMG/M
3300020579|Ga0210407_11283716All Organisms → cellular organisms → Bacteria → Acidobacteria547Open in IMG/M
3300020582|Ga0210395_10319168All Organisms → cellular organisms → Bacteria1168Open in IMG/M
3300020583|Ga0210401_11426134All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium550Open in IMG/M
3300021171|Ga0210405_10594438All Organisms → cellular organisms → Bacteria → Acidobacteria862Open in IMG/M
3300021181|Ga0210388_11102135All Organisms → cellular organisms → Bacteria → Acidobacteria677Open in IMG/M
3300021401|Ga0210393_10667219All Organisms → cellular organisms → Bacteria → Acidobacteria848Open in IMG/M
3300021420|Ga0210394_11372679All Organisms → cellular organisms → Bacteria → Acidobacteria602Open in IMG/M
3300021432|Ga0210384_10051038All Organisms → cellular organisms → Bacteria3757Open in IMG/M
3300021478|Ga0210402_10463950All Organisms → cellular organisms → Bacteria → Acidobacteria1176Open in IMG/M
3300021559|Ga0210409_10043813All Organisms → cellular organisms → Bacteria4235Open in IMG/M
3300024186|Ga0247688_1091367All Organisms → cellular organisms → Bacteria → Acidobacteria523Open in IMG/M
3300024288|Ga0179589_10062430All Organisms → cellular organisms → Bacteria1437Open in IMG/M
3300024330|Ga0137417_1026421All Organisms → cellular organisms → Bacteria1557Open in IMG/M
3300025916|Ga0207663_10973072All Organisms → cellular organisms → Bacteria → Acidobacteria680Open in IMG/M
3300025928|Ga0207700_10989441All Organisms → cellular organisms → Bacteria → Acidobacteria753Open in IMG/M
3300026297|Ga0209237_1178924Not Available742Open in IMG/M
3300026310|Ga0209239_1057164All Organisms → cellular organisms → Bacteria → Acidobacteria1739Open in IMG/M
3300026316|Ga0209155_1182703All Organisms → cellular organisms → Bacteria → Acidobacteria675Open in IMG/M
3300026489|Ga0257160_1022539All Organisms → cellular organisms → Bacteria1001Open in IMG/M
3300026523|Ga0209808_1270450All Organisms → cellular organisms → Bacteria → Acidobacteria543Open in IMG/M
3300026548|Ga0209161_10555705All Organisms → cellular organisms → Bacteria → Acidobacteria512Open in IMG/M
3300026557|Ga0179587_10884783All Organisms → cellular organisms → Bacteria → Acidobacteria589Open in IMG/M
3300026833|Ga0207728_109886All Organisms → cellular organisms → Bacteria → Acidobacteria899Open in IMG/M
3300027097|Ga0208861_104928All Organisms → cellular organisms → Bacteria → Acidobacteria719Open in IMG/M
3300027173|Ga0208097_1001225All Organisms → cellular organisms → Bacteria2235Open in IMG/M
3300027671|Ga0209588_1191918Not Available638Open in IMG/M
3300027678|Ga0209011_1193046All Organisms → cellular organisms → Bacteria → Acidobacteria558Open in IMG/M
3300027727|Ga0209328_10206369All Organisms → cellular organisms → Bacteria → Acidobacteria592Open in IMG/M
3300027825|Ga0209039_10155192All Organisms → cellular organisms → Bacteria → Acidobacteria951Open in IMG/M
3300027882|Ga0209590_10678712All Organisms → cellular organisms → Bacteria → Acidobacteria660Open in IMG/M
3300028017|Ga0265356_1024285All Organisms → cellular organisms → Bacteria → Acidobacteria656Open in IMG/M
3300031718|Ga0307474_11594885All Organisms → cellular organisms → Bacteria → Acidobacteria513Open in IMG/M
3300031719|Ga0306917_11298240All Organisms → cellular organisms → Bacteria → Acidobacteria563Open in IMG/M
3300031736|Ga0318501_10282872All Organisms → cellular organisms → Bacteria → Acidobacteria883Open in IMG/M
3300031754|Ga0307475_10381945All Organisms → cellular organisms → Bacteria1132Open in IMG/M
3300031754|Ga0307475_10681701All Organisms → cellular organisms → Bacteria → Acidobacteria820Open in IMG/M
3300031754|Ga0307475_11067154All Organisms → cellular organisms → Bacteria → Acidobacteria633Open in IMG/M
3300031792|Ga0318529_10225017All Organisms → cellular organisms → Bacteria → Acidobacteria872Open in IMG/M
3300031798|Ga0318523_10653109All Organisms → cellular organisms → Bacteria → Acidobacteria517Open in IMG/M
3300031912|Ga0306921_10241538All Organisms → cellular organisms → Bacteria2116Open in IMG/M
3300031962|Ga0307479_10346934All Organisms → cellular organisms → Bacteria1467Open in IMG/M
3300031962|Ga0307479_10978165All Organisms → cellular organisms → Bacteria → Acidobacteria816Open in IMG/M
3300031962|Ga0307479_11502762All Organisms → cellular organisms → Bacteria → Acidobacteria630Open in IMG/M
3300032090|Ga0318518_10363033All Organisms → cellular organisms → Bacteria → Acidobacteria743Open in IMG/M
3300032094|Ga0318540_10339799All Organisms → cellular organisms → Bacteria → Acidobacteria725Open in IMG/M
3300032094|Ga0318540_10586858All Organisms → cellular organisms → Bacteria → Acidobacteria537Open in IMG/M
3300032180|Ga0307471_102298662All Organisms → cellular organisms → Bacteria → Acidobacteria680Open in IMG/M
3300032205|Ga0307472_100634703All Organisms → cellular organisms → Bacteria → Acidobacteria949Open in IMG/M
3300032261|Ga0306920_100529723All Organisms → cellular organisms → Bacteria1747Open in IMG/M
3300032782|Ga0335082_11019056All Organisms → cellular organisms → Bacteria → Acidobacteria692Open in IMG/M
3300033158|Ga0335077_10671119All Organisms → cellular organisms → Bacteria1071Open in IMG/M
3300033290|Ga0318519_10397937All Organisms → cellular organisms → Bacteria → Acidobacteria820Open in IMG/M
3300033983|Ga0371488_0081942All Organisms → cellular organisms → Bacteria → Acidobacteria1847Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil27.83%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil17.39%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil7.83%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil5.22%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil5.22%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland3.48%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil3.48%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere3.48%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil2.61%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil2.61%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland1.74%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil1.74%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil1.74%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil1.74%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil1.74%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil0.87%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment0.87%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.87%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.87%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil0.87%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil0.87%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.87%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.87%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil0.87%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.87%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.87%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere0.87%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.87%
RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere0.87%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300002914Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cmEnvironmentalOpen in IMG/M
3300005187Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124EnvironmentalOpen in IMG/M
3300005542Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1EnvironmentalOpen in IMG/M
3300005557Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153EnvironmentalOpen in IMG/M
3300005586Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140EnvironmentalOpen in IMG/M
3300005591Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1EnvironmentalOpen in IMG/M
3300005843Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2Host-AssociatedOpen in IMG/M
3300005921Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6EnvironmentalOpen in IMG/M
3300006175Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaGEnvironmentalOpen in IMG/M
3300006800Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109EnvironmentalOpen in IMG/M
3300006804Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200EnvironmentalOpen in IMG/M
3300006806Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100EnvironmentalOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300007258Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3EnvironmentalOpen in IMG/M
3300009038Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaGEnvironmentalOpen in IMG/M
3300009089Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaGEnvironmentalOpen in IMG/M
3300009090Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaGEnvironmentalOpen in IMG/M
3300010303Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015EnvironmentalOpen in IMG/M
3300010322Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300010358Tropical forest soil microbial communities from Panama - MetaG Plot_3EnvironmentalOpen in IMG/M
3300010359Tropical forest soil microbial communities from Panama - MetaG Plot_15EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010379Sb_50d combined assemblyEnvironmentalOpen in IMG/M
3300010396Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2EnvironmentalOpen in IMG/M
3300012096Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaGEnvironmentalOpen in IMG/M
3300012189Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaGEnvironmentalOpen in IMG/M
3300012202Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaGEnvironmentalOpen in IMG/M
3300012203Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaGEnvironmentalOpen in IMG/M
3300012206Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaGEnvironmentalOpen in IMG/M
3300012210Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012359Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaGEnvironmentalOpen in IMG/M
3300012361Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaGEnvironmentalOpen in IMG/M
3300012363Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaGEnvironmentalOpen in IMG/M
3300012582Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaGEnvironmentalOpen in IMG/M
3300012685Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaGEnvironmentalOpen in IMG/M
3300012925Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012927Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012929Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012930Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300013296Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaGHost-AssociatedOpen in IMG/M
3300015054Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300017823Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3EnvironmentalOpen in IMG/M
3300018042Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_10EnvironmentalOpen in IMG/M
3300018057Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_150EnvironmentalOpen in IMG/M
3300018062Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018089Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_20_MGEnvironmentalOpen in IMG/M
3300018090Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300019887Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c2EnvironmentalOpen in IMG/M
3300020170Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300020199Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300020579Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-MEnvironmentalOpen in IMG/M
3300020582Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-OEnvironmentalOpen in IMG/M
3300020583Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-MEnvironmentalOpen in IMG/M
3300021171Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-MEnvironmentalOpen in IMG/M
3300021181Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-OEnvironmentalOpen in IMG/M
3300021401Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-OEnvironmentalOpen in IMG/M
3300021420Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-MEnvironmentalOpen in IMG/M
3300021432Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-MEnvironmentalOpen in IMG/M
3300021478Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-MEnvironmentalOpen in IMG/M
3300021559Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-MEnvironmentalOpen in IMG/M
3300024186Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK29EnvironmentalOpen in IMG/M
3300024288Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungalEnvironmentalOpen in IMG/M
3300024330Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300025916Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025928Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026297Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_40cm (SPAdes)EnvironmentalOpen in IMG/M
3300026310Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm (SPAdes)EnvironmentalOpen in IMG/M
3300026316Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 (SPAdes)EnvironmentalOpen in IMG/M
3300026489Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-11-AEnvironmentalOpen in IMG/M
3300026523Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 (SPAdes)EnvironmentalOpen in IMG/M
3300026548Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes)EnvironmentalOpen in IMG/M
3300026557Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungalEnvironmentalOpen in IMG/M
3300026833Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 54 (SPAdes)EnvironmentalOpen in IMG/M
3300027097Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF019 (SPAdes)EnvironmentalOpen in IMG/M
3300027173Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF036 (SPAdes)EnvironmentalOpen in IMG/M
3300027671Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes)EnvironmentalOpen in IMG/M
3300027678Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M3 (SPAdes)EnvironmentalOpen in IMG/M
3300027727Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300027825Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM1 (SPAdes)EnvironmentalOpen in IMG/M
3300027882Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300028017Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4Host-AssociatedOpen in IMG/M
3300031718Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05EnvironmentalOpen in IMG/M
3300031719Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2)EnvironmentalOpen in IMG/M
3300031736Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21EnvironmentalOpen in IMG/M
3300031754Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515EnvironmentalOpen in IMG/M
3300031792Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23EnvironmentalOpen in IMG/M
3300031798Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19EnvironmentalOpen in IMG/M
3300031912Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2)EnvironmentalOpen in IMG/M
3300031962Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515EnvironmentalOpen in IMG/M
3300032090Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22EnvironmentalOpen in IMG/M
3300032094Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f25EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M
3300032782Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1EnvironmentalOpen in IMG/M
3300033158Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1EnvironmentalOpen in IMG/M
3300033290Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15EnvironmentalOpen in IMG/M
3300033983Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB23AN SIP fractionEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI25617J43924_1018641013300002914Grasslands SoilSYLIARGISFTGRVANLFDKQYQDAMGFPALGRDFRLGLHYRFSGRD*
Ga0066675_1013471013300005187SoilRGVSLYARSTNLFDKKYQDVVGFPALGRDVRVGMNYRFSGHN*
Ga0070732_1043798313300005542Surface SoilVTNFLDKHYQEAIGFPALGRDFRLGMNYRFDGRN*
Ga0066704_1016348213300005557SoilRVANLFDKQFQDALGFPALGRDFRLGMKFVLGGE*
Ga0066691_1086265523300005586SoilAANLFDKQYQDALGYPALGRDFRLGLKYRFTGRN*
Ga0070761_1033113823300005591SoilFYARAANLFDKQYQDALGYPALGRDVRAGVRYTFSGRN*
Ga0068860_10284960213300005843Switchgrass RhizosphereYLRAANLFDKSYQDALGYPALGREVRAGMAYRFGGHN*
Ga0070766_1007025913300005921SoilLYARGTNLFDKKYQDALGYPALGRDVVGGVRYTFSGRN*
Ga0070712_10009485543300006175Corn, Switchgrass And Miscanthus RhizosphereATNLFDKQYQDVLGYPALGRDARIGLRYQFSGRN*
Ga0070712_10019016443300006175Corn, Switchgrass And Miscanthus RhizosphereYVRVANLFDKSYQDALGYPALGREVRVGMRYRFAGKN*
Ga0066660_1130951323300006800SoilLATSCLLARGVSLYGRVTNLLDKQYQETIGFPALGRDLRLGLNYRFSGRN*
Ga0079221_1017795733300006804Agricultural SoilVSFYARAANLFDKKYQDALGYPALGRDVRAGVRYTFRGRN*
Ga0079220_1000943663300006806Agricultural SoilSLFARAANLFDKKYQDALGYPALGRDVRAGVRYTFRGRN*
Ga0075425_10024228843300006854Populus RhizosphereSIYARATNLFDKQYQDVLGYPALGRDARIGLRYQFSGRN*
Ga0099793_1030711613300007258Vadose Zone SoilRSTNLFDKKYQDAVGFPTLGRDVRVGMSYRFSGRN*
Ga0099829_1108694923300009038Vadose Zone SoilARAANLFDKQYQDAIGFPALGRDVRAGVRYEFSGRN*
Ga0099829_1133753523300009038Vadose Zone SoilRGVSFYARATNLFDKPYQDVIGFPALGRDVRVGMNYRFSGRN*
Ga0099828_1028902813300009089Vadose Zone SoilRATNLFDKQYQDAIGFPALGRDVRAGVRYEFSGRN*
Ga0099827_1090053113300009090Vadose Zone SoilVSRGLSLYARATNLFDKQYQDAIGFPALGRDMRAGVRYEFSGRN*
Ga0134082_1010700713300010303Grasslands SoilLYARAANLFDKQYQDALGYPALGRDFRLGLKYRFAGRN*
Ga0134084_1013653513300010322Grasslands SoilVSFYGRVTNLLDKQYQDVIGFPALGRDFRIGLSYRFSGRN*
Ga0126370_1047206213300010358Tropical Forest SoilGMTHGVSIYLRAANLFDKSYQDALGYPALGREVRVGAAYRFGGHN*
Ga0126370_1125376013300010358Tropical Forest SoilFYIHATNLFDRGYQEVIGVPTLGRDVRVGLKYQFHGRN*
Ga0126376_1232731823300010359Tropical Forest SoilSLYARTTNLFDKFYQDALGFPALGRDFRLGLNYRFSGRN*
Ga0126379_1332543823300010366Tropical Forest SoilAANLFDKVYQDALGYPALGREVRVGMAYRFGGQN*
Ga0126381_10244169713300010376Tropical Forest SoilYLRAANLFDKSYQDALGYPALGREVRVGAAYRFGGHH*
Ga0126381_10463399533300010376Tropical Forest SoilFPRGFSFYGRVTNLLDKQYQETIGFPALGRDYRRGLNYRFSGRN*
Ga0136449_10150564613300010379Peatlands SoilATNLFDKQYQDVLGYPALGRDVRIGLRYQFAGRN*
Ga0134126_1093494513300010396Terrestrial SoilRAANLFDKKYQDALGYPALGRDVRAGVRYTFRGRN*
Ga0137389_1037066013300012096Vadose Zone SoilATNLFDKHYQDAIGYPALGRDVRVGMNYRFSGKN*
Ga0137389_1097144723300012096Vadose Zone SoilLSLYARATNLSDKRYQDAIGYPALGRDYRLGMSYRFGGQN*
Ga0137388_1064618613300012189Vadose Zone SoilRGISFTGRVTNLFDKQYQDALGFPALGRDVRVGMNYRFSGRN*
Ga0137388_1106568223300012189Vadose Zone SoilYARATNLFDKQYQDAIGFPALGRDVRAGVRYEFSGRN*
Ga0137363_1137561323300012202Vadose Zone SoilATNLFDKSYQDALGYPALGREVLVGMKYRFSGKN*
Ga0137399_1009551943300012203Vadose Zone SoilSFYGRVTNLLDKQYQDAVGFPALGRDFRLGMNYRFTGRN*
Ga0137380_1118114623300012206Vadose Zone SoilYARAANLFDKQYQDALGYPALGRDFRLGLKYRFAGRN*
Ga0137378_1119505123300012210Vadose Zone SoilSFTGRVTNLFDKQYQDALGFPALGRDFRLGLKYRFAGRN*
Ga0137385_1033657513300012359Vadose Zone SoilVTNLFDKQYQDALGFPALGRDFRLGLNYRFTGRN*
Ga0137360_1015198743300012361Vadose Zone SoilGRVTNLFDKQYQDALGFPALGRDFRLGLNYRFAGRN*
Ga0137360_1044648133300012361Vadose Zone SoilYNVSRGLSLCARATNLFDKQYQDAIGFPALGRDMRAGVRYEFNGRN*
Ga0137390_1184543413300012363Vadose Zone SoilATNLFDKSYQDALGYPALGREVLVGMKYRFGGKN*
Ga0137358_1016649533300012582Vadose Zone SoilSRVANLLDKQYQDVIGYPALGRDVRVGLNYRFSGKD*
Ga0137358_1032487333300012582Vadose Zone SoilKGVTTFVRAANLFDESYQDALGYPGLGREVLVGMKYRFGGKN*
Ga0137397_1105105223300012685Vadose Zone SoilDIATHYEIGYGVSFHARAANLFDKQYQDALGFPALGRDFRLGLHYRFAGRN*
Ga0137419_1017984213300012925Vadose Zone SoilARATNLLDKLYQDALGYPALGRDVRVGMNYRFAGRN*
Ga0137416_1058297313300012927Vadose Zone SoilRGISLYARATNVFDKQYQDAIGFPALGRDVRVGMNYRFAGKN*
Ga0137404_1043670513300012929Vadose Zone SoilFGRGISLYARATNVLDKQYQDAIGFPALGRDVRVGMNYRFAGKN*
Ga0137407_1219151223300012930Vadose Zone SoilRVTNLLDKQYQEAIGFPALGRDFRLGMNYRFSGRN*
Ga0157374_1059553033300013296Miscanthus RhizosphereYLRAANLFDKSYQDALGYPALGRELRIGMNYRFGGKM*
Ga0137420_105422733300015054Vadose Zone SoilRGISFIGRVTNLFDKQYQDVLGFPALGRDFRLGLNYRFTGRN*
Ga0132257_10455985023300015373Arabidopsis RhizosphereAYLRAANLFDKSYQDALGYPALGRELRIGMNYRFGGKM*
Ga0187818_1024622313300017823Freshwater SedimentRGLYFTARVLNLFNKQYQDALGYPALGQTYYFGVRYTFAGRNGAGGAR
Ga0187871_1056015623300018042PeatlandTRGFSLYCRVTNLLDKHYQDAVGFPALDRDYRVGVRYHFGGR
Ga0187858_1039607023300018057PeatlandFSLYGCVINLFNKQYQEALGYPALGRDFRLGMKYTFRRGS
Ga0187784_1091552613300018062Tropical PeatlandLFARAQNLFDRRYQLILGFPALGRQASGGIRYRIGGRS
Ga0187774_1064323323300018089Tropical PeatlandFFTGRVLNLFNKQYQDALGYPALGRYYMLGMRYAFSGRD
Ga0187770_1065929813300018090Tropical PeatlandARATNLFNKSYQDALGYPALGRDARVGLRYQFAGRK
Ga0187770_1114883923300018090Tropical PeatlandTRSLAMTARVWNLFNKQYQDALGYPALGQTYTFGLRYRFAGRN
Ga0193729_114954523300019887SoilVRVANLFDKSYQDALGYPALGREVLVGMKYRFGGKN
Ga0179594_1028099613300020170Vadose Zone SoilNLGRAVSIYARATNLLDKLYQDALGYPALGRDVRVGMNYRFSGRN
Ga0179592_1033008613300020199Vadose Zone SoilGISFNGRVTNLLDKQYQEAIGFPALGRDFRLGMNYRFNGRN
Ga0210407_1043072713300020579SoilLGRGVTTFVRAANLFDKSYQDASGYPALGREVLVGMKYRFGGKN
Ga0210407_1128371623300020579SoilFSFYGRVTNLLDKQYQDAIGFPALGRDFRLGMNYRFGGRN
Ga0210395_1031916833300020582SoilSIYARATNLFDKQYSDVLGYPALGRDARIGLRYQFSGRN
Ga0210401_1142613423300020583SoilYARATNLFDKQYQDAIGYPALGRDVRVGLNYRLPGKN
Ga0210405_1059443813300021171SoilFYGRVTNLLDKQYQEAIGFPALGRDFRLGMNYRFSGHN
Ga0210388_1110213523300021181SoilVRVGNLLNKQYTDAVGFPELGREIRVGLKLKFGGE
Ga0210393_1066721923300021401SoilGLSIYARATNLFDKQYQDVLGYPALGRDARIGLRYQFPGRN
Ga0210394_1137267923300021420SoilYELGHGVLLYARAQNLFDKQYQDALGYSALGRDARVGVRYTFKGRN
Ga0210384_1005103853300021432SoilSFYGRVTNLLDKQYQDAIGFPALGRDFRLGMNYRFGGKN
Ga0210402_1046395033300021478SoilVRAANLFDKSYQDAIGYPALGREVLVGMKYRFGGKN
Ga0210409_1004381313300021559SoilRVTNLLDKQYQDAIGFPALGRDFRLGMNYRFGGRN
Ga0247688_109136713300024186SoilARATNLFDKFYQDALGYPALGRDMRAGVRYTFSGRN
Ga0179589_1006243013300024288Vadose Zone SoilSLYARATNIFDKQYQDAIGFPALGRDVRVGMNYRFAGKN
Ga0137417_102642133300024330Vadose Zone SoilNLGSGVSIYARASNLLDKLYQDALGYPALGRDVRVGMNYRFSGRN
Ga0207663_1097307223300025916Corn, Switchgrass And Miscanthus RhizosphereISTYLRAANLFDKSYQDALGYPALGREVRLGMAYRFGGRN
Ga0207700_1098944123300025928Corn, Switchgrass And Miscanthus RhizosphereLYARAQNLFDKQYQDALGYPALGRDARVGVRYTFKGRD
Ga0209237_117892423300026297Grasslands SoilGRVANLLDKQSQDALGFPALGRDFRLGMKFVLGGE
Ga0209239_105716443300026310Grasslands SoilYARSTNLFDKKYQDVVGFPALGRDVRVGMNYRFSGHN
Ga0209155_118270313300026316SoilSLYARSTNLFDKKYQDVVGFPALGRDVRVGVNYRFSGHN
Ga0257160_102253933300026489SoilYEIGRGVTTFVRAANLFDKSYQDALGYPALGREVLVGMKYRFGGKN
Ga0209808_127045013300026523SoilISFTGRVTNLFDKQYQDALGFPALGCDFRLGLNYRFTGRN
Ga0209161_1055570513300026548SoilYVRVVNLLDKFYQDALGYPALGREARVGMNYRFGGKN
Ga0179587_1088478313300026557Vadose Zone SoilYVRVANLFDKFYQDALGYPALGREVRIGMRYRFAGKN
Ga0207728_10988613300026833Tropical Forest SoilYIFYRGFSVYAKATNLFDKSYQLALGYPALGRDARIGLRYQFAGRD
Ga0208861_10492823300027097Forest SoilGRVTNLLDKQYQDAIGFPALGRDFRLGMNYRFGGRN
Ga0208097_100122543300027173Forest SoilFYGRVTNLLDKQYQEAIGFPALGRDFRLGMNYRFTGRN
Ga0209588_119191813300027671Vadose Zone SoilGVTVYGRVANLLDKQSQDALGFPALGRDFRLGMKFVLGGE
Ga0209011_119304613300027678Forest SoilVLLYARAQNLFDKQYQDALGYPVLGRDARVGVRYTFKGRD
Ga0209328_1020636923300027727Forest SoilTSYYFGRGVHVYGRVANVLDEAYQDAIGFPALGRDVRVGMKYQFSGRN
Ga0209039_1015519213300027825Bog Forest SoilVSFYTRASNLFNKQYQDALGYPALGRNVQAGVRYTFSGRN
Ga0209590_1067871223300027882Vadose Zone SoilLYARATNLFDKQYQDAIGFPALGRDVRAGVRYEFSGRN
Ga0265356_102428513300028017RhizosphereVRVGNLFNKQYQDALGYPALGREIRVGLKLRFGGE
Ga0307474_1159488513300031718Hardwood Forest SoilRVGRGVSLYARATNLFNKKYQDALGYPALERDVVGGVRYTFSGRN
Ga0306917_1129824013300031719SoilYAKATNLFDKSYQLALGYPALGRGARIGLRYQCAGRD
Ga0318501_1028287213300031736SoilAKATNLFDKSYQLALGYPALGRDARIGLRYQFAGRD
Ga0307475_1038194533300031754Hardwood Forest SoilYARAQNLFDRRYQDALGYPALGRDARVGVRYTFKGRD
Ga0307475_1068170123300031754Hardwood Forest SoilGRGVTTFVRAANLFDKSYQDALGFPGLGREVLVGMKYRFGGKN
Ga0307475_1106715413300031754Hardwood Forest SoilRATNLLDKLYQDALGYPALGRDFRFGMNYRFTGRN
Ga0318529_1022501713300031792SoilRGFSVYAKATNLFDKSYQLALGYPALGRDARIGLRYQFAGRD
Ga0318523_1065310913300031798SoilFSVYGRAINLFDKKYQDALGYPALGRDLRIGVRYQFSGRN
Ga0306921_1024153833300031912SoilSRSVNAYFRALNLLDKAYQDALGYPALSRELRVGMSYRLGGKT
Ga0307479_1034693413300031962Hardwood Forest SoilSFYGRVTNLLDKQYQEAIGFPALGRDFRLGMNYRFNGRN
Ga0307479_1097816523300031962Hardwood Forest SoilLSLYIRATNLFDHAYQEVIGVPTLGRDVRVGLKYQFSGRN
Ga0307479_1150276213300031962Hardwood Forest SoilYARATNLLDKQYQDAIGFPALGRDARIGLNYRFSGRN
Ga0318518_1036303313300032090SoilLIRGFLLTARATNLFDKQYQDVLGYPALARDYRFGLCYQFSGRN
Ga0318540_1033979913300032094SoilVYAKATNLFDKSYQLALGYPALGRDARIGLRYQFAGRD
Ga0318540_1058685823300032094SoilTARVINLFNRQYQDAYGYPALGQTYYFGMRYTFAGRN
Ga0307471_10229866213300032180Hardwood Forest SoilHATNVFDNHYQDAIGYPALGRDVRVGMNYRFSGKN
Ga0307472_10063470313300032205Hardwood Forest SoilKGVITFVRAANLFDKSYEDALGYPGLGREVLVGMKYRFGGKN
Ga0306920_10052972313300032261SoilSAYARVTNLFDKFYQDALGYPALGREVRAGMKYRFAGKN
Ga0335082_1101905613300032782SoilGRANNLFDKQYQDALGYPALGRDLRIGVRYRFAGRN
Ga0335077_1067111913300033158SoilRAINLFDKQYQDALGYPALGRWYMLGLRYNFAGKS
Ga0318519_1039793723300033290SoilFFTGRVLNLFDKQYQDALGYPALGRYYMLGMRYTFAGRD
Ga0371488_0081942_1_1083300033983Peat SoilRATNLFNKQYQDAYGYPALGRFYMFGMRYQFAGRN

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.