NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F080602

Metagenome / Metatranscriptome Family F080602

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F080602
Family Type Metagenome / Metatranscriptome
Number of Sequences 115
Average Sequence Length 51 residues
Representative Sequence GLWKLAMGAVQKPWGIFNVLSFGALLVLLVIAGYTGLFLALMTLKL
Number of Associated Samples 107
Number of Associated Scaffolds 115

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 3.48 %
% of genes near scaffold ends (potentially truncated) 96.52 %
% of genes from short scaffolds (< 2000 bps) 88.70 %
Associated GOLD sequencing projects 99
AlphaFold2 3D model prediction Yes
3D model pTM-score0.55

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (92.174 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog
(12.174 % of family members)
Environment Ontology (ENVO) Unclassified
(34.783 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(45.217 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 56.76%    β-sheet: 0.00%    Coil/Unstructured: 43.24%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.55
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 115 Family Scaffolds
PF13365Trypsin_2 20.87
PF01797Y1_Tnp 4.35
PF01029NusB 4.35
PF00072Response_reg 2.61
PF01471PG_binding_1 2.61
PF07969Amidohydro_3 2.61
PF13437HlyD_3 0.87
PF01875Memo 0.87
PF00216Bac_DNA_binding 0.87
PF09286Pro-kuma_activ 0.87
PF01546Peptidase_M20 0.87
PF13964Kelch_6 0.87

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 115 Family Scaffolds
COG1943REP element-mobilizing transposase RayTMobilome: prophages, transposons [X] 4.35
COG0776Bacterial nucleoid DNA-binding protein IHF-alphaReplication, recombination and repair [L] 0.87
COG1355Predicted class III extradiol dioxygenase, MEMO1 familyGeneral function prediction only [R] 0.87
COG4934Serine protease, subtilase familyPosttranslational modification, protein turnover, chaperones [O] 0.87


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms92.17 %
UnclassifiedrootN/A7.83 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300001593|JGI12635J15846_10508829All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium709Open in IMG/M
3300001661|JGI12053J15887_10581790All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium533Open in IMG/M
3300002245|JGIcombinedJ26739_100508606All Organisms → cellular organisms → Bacteria → Acidobacteria1082Open in IMG/M
3300002245|JGIcombinedJ26739_100975996All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium731Open in IMG/M
3300004082|Ga0062384_100712634All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium692Open in IMG/M
3300004092|Ga0062389_102822976All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium649Open in IMG/M
3300004152|Ga0062386_101820014All Organisms → cellular organisms → Bacteria508Open in IMG/M
3300004635|Ga0062388_101398839All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium702Open in IMG/M
3300005468|Ga0070707_100048609All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter4063Open in IMG/M
3300005764|Ga0066903_101139482All Organisms → cellular organisms → Bacteria1442Open in IMG/M
3300005938|Ga0066795_10132852All Organisms → cellular organisms → Bacteria742Open in IMG/M
3300005995|Ga0066790_10136019Not Available1053Open in IMG/M
3300006050|Ga0075028_101015422All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium516Open in IMG/M
3300006052|Ga0075029_101271359All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium516Open in IMG/M
3300006059|Ga0075017_101486058Not Available534Open in IMG/M
3300006059|Ga0075017_101595167All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium515Open in IMG/M
3300006086|Ga0075019_10106331All Organisms → cellular organisms → Bacteria → Acidobacteria1616Open in IMG/M
3300006102|Ga0075015_100223235All Organisms → cellular organisms → Bacteria → Acidobacteria1011Open in IMG/M
3300009519|Ga0116108_1234060All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium537Open in IMG/M
3300009624|Ga0116105_1096478All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium735Open in IMG/M
3300009628|Ga0116125_1097221All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium784Open in IMG/M
3300009644|Ga0116121_1102741All Organisms → cellular organisms → Bacteria → Acidobacteria896Open in IMG/M
3300010341|Ga0074045_10686812All Organisms → cellular organisms → Bacteria → Acidobacteria650Open in IMG/M
3300010379|Ga0136449_104463787All Organisms → cellular organisms → Bacteria → Acidobacteria515Open in IMG/M
3300012917|Ga0137395_10393792All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium991Open in IMG/M
3300012924|Ga0137413_10103801All Organisms → cellular organisms → Bacteria → Acidobacteria1778Open in IMG/M
3300012929|Ga0137404_11019733Not Available757Open in IMG/M
3300014158|Ga0181521_10530877All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium559Open in IMG/M
3300014168|Ga0181534_10768876All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium567Open in IMG/M
3300014169|Ga0181531_10292660All Organisms → cellular organisms → Bacteria → Acidobacteria996Open in IMG/M
3300014201|Ga0181537_10626249All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium733Open in IMG/M
3300014498|Ga0182019_10805794All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium672Open in IMG/M
3300014654|Ga0181525_10558236All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium636Open in IMG/M
3300015264|Ga0137403_10670754All Organisms → cellular organisms → Bacteria → Acidobacteria898Open in IMG/M
3300017929|Ga0187849_1261630All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium656Open in IMG/M
3300017933|Ga0187801_10497158All Organisms → cellular organisms → Bacteria → Acidobacteria514Open in IMG/M
3300017934|Ga0187803_10266445All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium680Open in IMG/M
3300017941|Ga0187850_10352939All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium645Open in IMG/M
3300017943|Ga0187819_10210205All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales1146Open in IMG/M
3300017943|Ga0187819_10765497All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium543Open in IMG/M
3300017972|Ga0187781_10733484All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium715Open in IMG/M
3300017995|Ga0187816_10249593All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium774Open in IMG/M
3300018008|Ga0187888_1169445All Organisms → cellular organisms → Bacteria → Acidobacteria883Open in IMG/M
3300018012|Ga0187810_10380831All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium591Open in IMG/M
3300018017|Ga0187872_10247263Not Available800Open in IMG/M
3300018026|Ga0187857_10159328All Organisms → cellular organisms → Bacteria → Acidobacteria1069Open in IMG/M
3300018026|Ga0187857_10233341All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium851Open in IMG/M
3300018033|Ga0187867_10321212All Organisms → cellular organisms → Bacteria → Acidobacteria864Open in IMG/M
3300018034|Ga0187863_10489657All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium688Open in IMG/M
3300018035|Ga0187875_10651201All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium554Open in IMG/M
3300018037|Ga0187883_10356497Not Available748Open in IMG/M
3300018038|Ga0187855_10237032All Organisms → cellular organisms → Bacteria → Acidobacteria1071Open in IMG/M
3300018042|Ga0187871_10800155All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium526Open in IMG/M
3300018046|Ga0187851_10373357All Organisms → cellular organisms → Bacteria → Acidobacteria819Open in IMG/M
3300018085|Ga0187772_10706358All Organisms → cellular organisms → Bacteria → Acidobacteria723Open in IMG/M
3300018085|Ga0187772_11081342Not Available588Open in IMG/M
3300018086|Ga0187769_10091568All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2174Open in IMG/M
3300018090|Ga0187770_10176038All Organisms → cellular organisms → Bacteria → Acidobacteria1640Open in IMG/M
3300018090|Ga0187770_10421829All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis1050Open in IMG/M
3300019278|Ga0187800_1350038All Organisms → cellular organisms → Bacteria → Acidobacteria579Open in IMG/M
3300019785|Ga0182022_1361114All Organisms → cellular organisms → Bacteria → Acidobacteria1208Open in IMG/M
3300019787|Ga0182031_1299037All Organisms → cellular organisms → Bacteria → Acidobacteria1992Open in IMG/M
3300019888|Ga0193751_1047229All Organisms → cellular organisms → Bacteria → Acidobacteria1879Open in IMG/M
3300021407|Ga0210383_11517045All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium554Open in IMG/M
3300021477|Ga0210398_10735310All Organisms → cellular organisms → Bacteria → Acidobacteria797Open in IMG/M
3300022518|Ga0224548_1016515All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium811Open in IMG/M
3300022521|Ga0224541_1014238All Organisms → cellular organisms → Bacteria → Acidobacteria857Open in IMG/M
3300022521|Ga0224541_1027672Not Available610Open in IMG/M
3300022873|Ga0224550_1062017All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium537Open in IMG/M
3300024041|Ga0224539_1004006All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium509Open in IMG/M
3300025406|Ga0208035_1020120All Organisms → cellular organisms → Bacteria → Acidobacteria1078Open in IMG/M
3300025604|Ga0207930_1096091All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium680Open in IMG/M
3300026340|Ga0257162_1052099All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium521Open in IMG/M
3300026358|Ga0257166_1021926All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium847Open in IMG/M
3300026480|Ga0257177_1031013All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium789Open in IMG/M
3300027587|Ga0209220_1019422All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1815Open in IMG/M
3300027669|Ga0208981_1098870All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium744Open in IMG/M
3300027729|Ga0209248_10182760All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium621Open in IMG/M
3300027745|Ga0209908_10080609All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae776Open in IMG/M
3300027854|Ga0209517_10175021All Organisms → cellular organisms → Bacteria → Acidobacteria1348Open in IMG/M
3300027898|Ga0209067_10071355All Organisms → cellular organisms → Bacteria → Acidobacteria1781Open in IMG/M
3300028665|Ga0302160_10122396Not Available588Open in IMG/M
3300028779|Ga0302266_10028620All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2734Open in IMG/M
3300028792|Ga0307504_10118056All Organisms → cellular organisms → Bacteria → Acidobacteria866Open in IMG/M
3300028798|Ga0302222_10068179All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Magnetospirillum → Magnetospirillum caucaseum1431Open in IMG/M
3300028866|Ga0302278_10023161All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae4481Open in IMG/M
3300028871|Ga0302230_10238846All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium704Open in IMG/M
3300029883|Ga0311327_10021128All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae5518Open in IMG/M
3300029918|Ga0302143_1000053All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae18790Open in IMG/M
3300029939|Ga0311328_10040787All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae4222Open in IMG/M
3300029944|Ga0311352_11406116All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium524Open in IMG/M
3300029953|Ga0311343_11317244All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium543Open in IMG/M
3300029955|Ga0311342_10740929All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium767Open in IMG/M
3300029956|Ga0302150_10016455All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2958Open in IMG/M
3300029981|Ga0302293_10150898All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium737Open in IMG/M
3300029986|Ga0302188_10239542All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium759Open in IMG/M
3300029987|Ga0311334_10095015All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2190Open in IMG/M
3300030001|Ga0302272_1097093All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium829Open in IMG/M
3300030004|Ga0302186_10129767All Organisms → cellular organisms → Bacteria → Acidobacteria908Open in IMG/M
3300030014|Ga0302175_10077690All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium740Open in IMG/M
3300030049|Ga0302191_10344302All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium545Open in IMG/M
3300030688|Ga0311345_10079055All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae3889Open in IMG/M
3300031028|Ga0302180_10019819All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae4370Open in IMG/M
3300031259|Ga0302187_10442562All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium606Open in IMG/M
3300031595|Ga0265313_10292150All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium656Open in IMG/M
3300031720|Ga0307469_10584924All Organisms → cellular organisms → Bacteria → Acidobacteria995Open in IMG/M
3300032160|Ga0311301_11918315All Organisms → cellular organisms → Bacteria → Acidobacteria697Open in IMG/M
3300032805|Ga0335078_10530938All Organisms → cellular organisms → Bacteria → Acidobacteria1503Open in IMG/M
3300032805|Ga0335078_11133815All Organisms → cellular organisms → Bacteria911Open in IMG/M
3300032828|Ga0335080_11823866All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium593Open in IMG/M
3300032892|Ga0335081_10036684All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae7822Open in IMG/M
3300032955|Ga0335076_10588793All Organisms → cellular organisms → Bacteria → Acidobacteria994Open in IMG/M
3300033158|Ga0335077_10015743All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae9455Open in IMG/M
3300033405|Ga0326727_10315406Not Available1522Open in IMG/M
3300033829|Ga0334854_079843All Organisms → cellular organisms → Bacteria → Acidobacteria780Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
BogEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Bog12.17%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland11.30%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds6.09%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment5.22%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil5.22%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland5.22%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil5.22%
SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Soil5.22%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil4.35%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog4.35%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland4.35%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil4.35%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil3.48%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen3.48%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa3.48%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil2.61%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.74%
FenEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Fen1.74%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Soil1.74%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil0.87%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.87%
PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland0.87%
Bog Forest SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil0.87%
Thawing PermafrostEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Thawing Permafrost0.87%
BogEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Bog0.87%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.87%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere0.87%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil0.87%
RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere0.87%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300001593Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2EnvironmentalOpen in IMG/M
3300001661Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly)EnvironmentalOpen in IMG/M
3300002245Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027)EnvironmentalOpen in IMG/M
3300004082Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3EnvironmentalOpen in IMG/M
3300004092Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3EnvironmentalOpen in IMG/M
3300004152Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3EnvironmentalOpen in IMG/M
3300004635Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3EnvironmentalOpen in IMG/M
3300005468Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaGEnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005938Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 2 DNA2013-191EnvironmentalOpen in IMG/M
3300005995Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050EnvironmentalOpen in IMG/M
3300006050Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014EnvironmentalOpen in IMG/M
3300006052Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013EnvironmentalOpen in IMG/M
3300006059Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012EnvironmentalOpen in IMG/M
3300006086Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013EnvironmentalOpen in IMG/M
3300006102Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013EnvironmentalOpen in IMG/M
3300009519Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_150EnvironmentalOpen in IMG/M
3300009624Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_10EnvironmentalOpen in IMG/M
3300009628Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_10EnvironmentalOpen in IMG/M
3300009644Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_10EnvironmentalOpen in IMG/M
3300010341Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2EnvironmentalOpen in IMG/M
3300010379Sb_50d combined assemblyEnvironmentalOpen in IMG/M
3300012917Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaGEnvironmentalOpen in IMG/M
3300012924Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012929Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300014158Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_60_metaGEnvironmentalOpen in IMG/M
3300014168Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_10_metaGEnvironmentalOpen in IMG/M
3300014169Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaGEnvironmentalOpen in IMG/M
3300014201Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_10_metaGEnvironmentalOpen in IMG/M
3300014498Permafrost microbial communities from Stordalen Mire, Sweden - 812E2M metaGEnvironmentalOpen in IMG/M
3300014654Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_10_metaGEnvironmentalOpen in IMG/M
3300015264Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300017929Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_100EnvironmentalOpen in IMG/M
3300017933Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1EnvironmentalOpen in IMG/M
3300017934Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_3EnvironmentalOpen in IMG/M
3300017941Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_150EnvironmentalOpen in IMG/M
3300017943Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4EnvironmentalOpen in IMG/M
3300017972Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300017995Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1EnvironmentalOpen in IMG/M
3300018008Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_40EnvironmentalOpen in IMG/M
3300018012Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_5EnvironmentalOpen in IMG/M
3300018017Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_40EnvironmentalOpen in IMG/M
3300018026Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_100EnvironmentalOpen in IMG/M
3300018033Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_10EnvironmentalOpen in IMG/M
3300018034Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10EnvironmentalOpen in IMG/M
3300018035Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_10EnvironmentalOpen in IMG/M
3300018037Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_10EnvironmentalOpen in IMG/M
3300018038Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_10EnvironmentalOpen in IMG/M
3300018042Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_10EnvironmentalOpen in IMG/M
3300018046Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_10EnvironmentalOpen in IMG/M
3300018085Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018086Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MGEnvironmentalOpen in IMG/M
3300018090Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300019278Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019785Permafrost microbial communities from Stordalen Mire, Sweden - 612E3M metaG (PacBio error correction)EnvironmentalOpen in IMG/M
3300019787Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (PacBio error correction)EnvironmentalOpen in IMG/M
3300019888Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1c2EnvironmentalOpen in IMG/M
3300021407Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-OEnvironmentalOpen in IMG/M
3300021477Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-OEnvironmentalOpen in IMG/M
3300022518Peat soil microbial communities from Stordalen Mire, Sweden - 717 P2 20-24EnvironmentalOpen in IMG/M
3300022521Peat soil microbial communities from Stordalen Mire, Sweden - 717 E3 20-24EnvironmentalOpen in IMG/M
3300022873Peat soil microbial communities from Stordalen Mire, Sweden - 717 P3 10-14EnvironmentalOpen in IMG/M
3300024041Peat soil microbial communities from Stordalen Mire, Sweden - 717 E3 1-5EnvironmentalOpen in IMG/M
3300025406Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_10 (SPAdes)EnvironmentalOpen in IMG/M
3300025604Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-3 shallow-092012 (SPAdes)EnvironmentalOpen in IMG/M
3300026340Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-04-AEnvironmentalOpen in IMG/M
3300026358Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-14-BEnvironmentalOpen in IMG/M
3300026480Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-07-BEnvironmentalOpen in IMG/M
3300027587Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M3 (SPAdes)EnvironmentalOpen in IMG/M
3300027669Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM1_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300027729Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM1 (SPAdes)EnvironmentalOpen in IMG/M
3300027745Thawing permafrost microbial communities from the Arctic, studying carbon transformations - Permafrost 812P2MEnvironmentalOpen in IMG/M
3300027854Peat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes)EnvironmentalOpen in IMG/M
3300027898Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 (SPAdes)EnvironmentalOpen in IMG/M
3300028665Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_E1_3EnvironmentalOpen in IMG/M
3300028779Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_E1_2EnvironmentalOpen in IMG/M
3300028792Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 19_SEnvironmentalOpen in IMG/M
3300028798Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E2_2EnvironmentalOpen in IMG/M
3300028866Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N3_2EnvironmentalOpen in IMG/M
3300028871Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N2_1EnvironmentalOpen in IMG/M
3300029883I_Bog_E2 coassemblyEnvironmentalOpen in IMG/M
3300029918Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E2_1EnvironmentalOpen in IMG/M
3300029939I_Bog_E3 coassemblyEnvironmentalOpen in IMG/M
3300029944II_Palsa_E1 coassemblyEnvironmentalOpen in IMG/M
3300029953II_Bog_E3 coassemblyEnvironmentalOpen in IMG/M
3300029955II_Bog_E2 coassemblyEnvironmentalOpen in IMG/M
3300029956Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N1_2EnvironmentalOpen in IMG/M
3300029981Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_N2_2EnvironmentalOpen in IMG/M
3300029986Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_E2_1EnvironmentalOpen in IMG/M
3300029987I_Fen_E3 coassemblyEnvironmentalOpen in IMG/M
3300030001Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N1_2EnvironmentalOpen in IMG/M
3300030004Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_E1_1EnvironmentalOpen in IMG/M
3300030014Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_N3_3EnvironmentalOpen in IMG/M
3300030049Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_E3_1EnvironmentalOpen in IMG/M
3300030688II_Bog_N2 coassemblyEnvironmentalOpen in IMG/M
3300031028Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_2EnvironmentalOpen in IMG/M
3300031259Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_E1_3EnvironmentalOpen in IMG/M
3300031595Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaGHost-AssociatedOpen in IMG/M
3300031720Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515EnvironmentalOpen in IMG/M
3300032160Sb_50d combined assembly (MetaSPAdes)EnvironmentalOpen in IMG/M
3300032805Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2EnvironmentalOpen in IMG/M
3300032828Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4EnvironmentalOpen in IMG/M
3300032892Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5EnvironmentalOpen in IMG/M
3300032955Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5EnvironmentalOpen in IMG/M
3300033158Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1EnvironmentalOpen in IMG/M
3300033405Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB29MYEnvironmentalOpen in IMG/M
3300033829Peat soil microbial communities from Stordalen Mire, Sweden - 715 P2 1-5EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI12635J15846_1050882913300001593Forest SoilLPSVTFLIVFPQIAYGRALGIVVVLLCALVGSLGLWKLALGAVQRPWGLFNVLNFGALCVLLVVAGYTGVFLALMAARL*
JGI12053J15887_1058179023300001661Forest SoilALGAVQKPFGILNVLSFGALFVLLIIASYTGLFLALITVKI*
JGIcombinedJ26739_10050860613300002245Forest SoilVGLWKLALGAVEKPWGIFNVLSFSALLILLVIAGYTGLFLALITLRI*
JGIcombinedJ26739_10097599613300002245Forest SoilGFGLWKLALGVVQKPWGIFNVLCLGALVVVVVIAAYTGLFLALMTVGI*
Ga0062384_10071263413300004082Bog Forest SoilVVPTCGLASGFGLWKLALGAVQKPWGIFNVLSFGALLVLLVIAGYTGLFLALLTLKI*
Ga0062389_10282297613300004092Bog Forest SoilLWKLALGAVQKPLGLFNVLSFATLLVLLVIAGYTGLFLALMTLNP*
Ga0062386_10182001413300004152Bog Forest SoilGSFGLWKLATGAVQKPWGIFNVLSFGALLVLLVTAAYTGLFLALMTLKL*
Ga0062388_10139883923300004635Bog Forest SoilGLFVVPTCGLASGFGLWKLALGAVQKPWGIFNVLSFGALLVLLVIAGYTGLFLALLTLKI
Ga0070707_10004860923300005468Corn, Switchgrass And Miscanthus RhizosphereLWKLALGAVQKPWGLFNVLSVGALLVVLVIAGYTGVFLALMTLKL*
Ga0066903_10113948223300005764Tropical Forest SoilMGAVQRPFGILNALSAGALFVLLVIAGYTGLFLALVT
Ga0066795_1013285233300005938SoilPWGIFNVLSFGALFVLLVIASYTGLFLALMTLKL*
Ga0066790_1013601923300005995SoilLAMGAVEKPWGIFNVLSFGALFVLLVIAGYTGLFLALITSKL*
Ga0075028_10101542213300006050WatershedsQKPWGIFNVLSFGALIVLLIVASYTGLFLAMITVRL*
Ga0075029_10127135923300006052WatershedsLVGSFGLWKLALGAVQKPWGIFNMLNVGALMVLVVIAAYTGVFLALLTLKL*
Ga0075017_10148605813300006059WatershedsALVGSVGLWKLALGAVQKPWGIFNVLSFGALLVLLVIAGYTGLFLALMTLKL*
Ga0075017_10159516713300006059WatershedsLSSFFGLWKLAMGAVEKPWGIFNVLNFGALFVLLVIAAYTGLFLALMTLKL*
Ga0075019_1010633123300006086WatershedsPHGRFVGFLLLPICALLGSFGLWQIALGTVQKPWGIFNILNVTALLVLLVIAGYTGVFLALMTMKL*
Ga0075015_10022323523300006102WatershedsAFPSIPHGRFVGFLLLPICALLGSFGLWQIALGTVQKPWGIFNILNVTALLVLLVIAGYTGVFLALMTMKL*
Ga0116108_123406023300009519PeatlandKLALGAVQKPWGIFNVLSFGALLVLLVIAGYTGLFLALMTLKL*
Ga0116105_109647813300009624PeatlandLVSSFGLWKLALGAVQKPWGIFNVLSFGALIVLLVIAGYTGLFLALMTLKL*
Ga0116125_109722123300009628PeatlandVPLCALIGSFGLWKLALGAVEKPWGIFNILNVTALMVLIVIAAYTGLFLALLTLKL*
Ga0116121_110274113300009644PeatlandGFGLWKLAWGAVQKPWGIFNVLNVGALFVLLVIAAYTGLFLALMTLKL*
Ga0074045_1068681213300010341Bog Forest SoilLALGAVQRPWGIFNVLSFGALFVLLVIAAYTGLFLALMTLKL*
Ga0136449_10446378713300010379Peatlands SoilSFGLWKLALGAVEKPWEIFNVLSFAALLVLLVIASCTGLFLALMTLKL*
Ga0137395_1039379213300012917Vadose Zone SoilKPWGLFNVLSVGALLVVLVIAGYTGVFLALMTLKL*
Ga0137413_1010380113300012924Vadose Zone SoilFGLWKLAMGAVQRPFGILNALSFGALLVLLIIAGYTGIFLAIITARF*
Ga0137404_1101973313300012929Vadose Zone SoilKLAMGAVQRPFGILNALSFGALIVLLIIAGYTGIFLAIITARF*
Ga0181521_1053087713300014158BogLAGSFGLWRLAMGAVQKPWGIFNVLSFGALLVLLVIAGYTGLFLALMTLKL*
Ga0181534_1076887623300014168BogGFLVVPACALTSCFGLWKLANGAVQRPWGIFNVLSFGALLVLLVIAGYTGVFLALMTLKI
Ga0181531_1029266013300014169BogGAVQKPWGIFNVLSFGTLLVLLVIAAYTGLFLALMTLKL*
Ga0181537_1062624913300014201BogHGRVIGMLVVPACALIGCFGLWKLAIGAVQKPWGLFNVLSFGALLVLLVIAGYTGVFLAIMTLKL*
Ga0182019_1080579423300014498FenWKLALGAVEKPWGIFNVLSFGALLVLLVIAGYTGLFLALMTLKL*
Ga0181525_1055823623300014654BogACALIGCFGLWKLAIGAVQKPWGLFNVLSFGALLVLLVIAGYTGVFLAIMTLKL*
Ga0137403_1067075423300015264Vadose Zone SoilKPWGIFNVLSFGMLLVVLVIAGYTGAFLALMTMTLKL*
Ga0187849_126163013300017929PeatlandQKPWGIFNLLNFGALLVLLAIAGYTGLFLALMTLKL
Ga0187801_1049715823300017933Freshwater SedimentLGAVQKPWGIFNVLNVGALLVLLVIAGYTGLFLALMTLKL
Ga0187803_1026644513300017934Freshwater SedimentGLWKLALGAVQKPWGIFNVLSFGALLVLLIIAGYTGLFLALVTVRL
Ga0187850_1035293923300017941PeatlandGLWQLALGVVAKPWGILNILNVTGLFVLLVIAGYTGVFLALLTLKL
Ga0187819_1021020523300017943Freshwater SedimentVVTYLIAFPSIPHGRFVGFLLLPICALAGSLGLFRLALGAVEKPWGIFNILNVAALLVLLVIAAYTGIFLALMTLKL
Ga0187819_1076549713300017943Freshwater SedimentVQKPWGIFNVLSFGALLVLLIIASYTGLFLALITVRL
Ga0187781_1073348413300017972Tropical PeatlandGAVQKPWGIFNVLSVGTLIVLLVIAGYTGVFLALLTLKI
Ga0187816_1024959323300017995Freshwater SedimentRHGRAIGLFVLPACALAGSFGLWKLATGAVQKPWGIFNVLSFGALLVLLVIAGYTGVFLALMTLKL
Ga0187888_116944523300018008PeatlandFGLWKLATGAVQKPWGIFNVLSFGALLVLLVIAGYTGLFLALMTLKL
Ga0187810_1038083123300018012Freshwater SedimentGLWKLATGAVRKPWGIFNVLSFGALLVLLVIAGYTGLFLALMTLKL
Ga0187872_1024726323300018017PeatlandGLWKLATGAVQKPWGIFNVLSFGALLVLLVIAGYTGLFLALMTLKL
Ga0187857_1015932823300018026PeatlandKPWGVFNVLSFGALMVLLVIAGYTGLFLALLTLKL
Ga0187857_1023334113300018026PeatlandCALAGSVGLWKLATGAVQKPWGIFNVLSFGALLVLLVIAGYTGLFLALMTLKL
Ga0187867_1032121213300018033PeatlandLWKLALGAVEKPWGIFNVLSFGALLVLLVIAGYTGLFLALMTLKL
Ga0187863_1048965713300018034PeatlandKPWGIFNVLSFGALLVLLVIAGYTGLFLALMTLKL
Ga0187875_1065120123300018035PeatlandAVQKPWGIFNVLSFGALLVLLVIAAYTGLFLALMTLKL
Ga0187883_1035649713300018037PeatlandLGVVAKPWGIFNILNVTGLFVLLVIAGYTGVFLALLTLKL
Ga0187855_1023703223300018038PeatlandHGRAVGFVVVPICALASGFGLWKLALGAVQKPWGIYNVLSFGALMVLLVIAGYTGLFLALLTVKL
Ga0187871_1080015523300018042PeatlandGLWKLALGAVQKPWGLYNALSFGALIVLLVIAGYTGLFLALMTLKL
Ga0187851_1037335733300018046PeatlandLALGAVQKPWGIFNVLSFGALIVLLVIAAYTGLFLALMTLKL
Ga0187772_1070635813300018085Tropical PeatlandQKPWGIFNVLNVGALLVLLVIAGYTGLFLALMTLKL
Ga0187772_1108134213300018085Tropical PeatlandGAVQKPWGIFNVLNVGGLLVLLVIAGYTGLFLALLTLKL
Ga0187769_1009156813300018086Tropical PeatlandRVAHGRLIGFIVVLVCAVLGSLGLWKLALGAVQKPWGIFNVLNAGALFVLLVIAGYTGLFLALMTLNL
Ga0187770_1017603823300018090Tropical PeatlandGLWKLVLGAVQKPWGIFNVLNVGALLVLLVIAGYTGLFLALMTLKL
Ga0187770_1042182933300018090Tropical PeatlandAVMFLIVFPRVAYGRLIGSLVVLGCALVGSFGLWKLSVGAVQKPWGIFNVLNVGVLLVLLVIAGYTGLFLALITLRL
Ga0187800_135003813300019278PeatlandVQKPWGIFNVLNVGALLVLLVIAGYTGLFLALMTLKL
Ga0182022_136111423300019785FenAVTGVRLAGSIGLWKLAIGAVQKPWGIFNVLSFGALLVLLVIAGYTGLFLALITLKL
Ga0182031_129903733300019787BogVAHGRVLGAVVVPACALTSCFGLWKLALGAVQKPWGIFNVLSFGTILVLLVVAGYTGCFW
Ga0193751_104722913300019888SoilMGGAIGLLLLPACVLVGGFGLWKLALGAVQKPWGIFNVLSFGAVLVLVVIAGYTGLFLALITLKI
Ga0210383_1151704523300021407SoilRVPYGRIVGAFVVPLCAVAGSFGLWKLALGAVQKPLGLFNVLSFATLLVLLVIAGYTGLFLALMTLEP
Ga0210398_1073531023300021477SoilKLATGVVEKPWGIFNVLNFGTLMILLVIAGYTGWFLALMTLKL
Ga0224548_101651513300022518SoilSSIGLWKLAFGAVQKPWGLFNVLSFGALLVLLVIAGYTGLFLALVTLRI
Ga0224541_101423823300022521SoilKLALGAVQRPWGLFNVLNFGALCVLLVVAGYTGVFLALMAARL
Ga0224541_102767213300022521SoilMGVVQKPWGIFNVLCFGSLLILVIIASYTGLFLALMTLKL
Ga0224550_106201723300022873SoilIVFPQIAYGRALGIVVVLLCALVGSLGLWKLALGAVQRPWGLFNVLNFGALCVLLVVAGYTGVFLALMAARL
Ga0224539_100400613300024041SoilISAVQRPFGILNALSVGALMVVLIIATYTGLFLAFIAIKL
Ga0208035_102012023300025406PeatlandPLCALIGSFGMWKLALGAVEKPWGIFNILNVTALMVLIVIAAYTGLFLALLTLKL
Ga0207930_109609113300025604Arctic Peat SoilGLWKLAMGAVQKPWGIFNVLSFGALLVLLVIAGYTGLFLALMTLKL
Ga0257162_105209913300026340SoilGAVQKPFNILNVLSVGALLVLLIIAGYTGLFLALVTAKL
Ga0257166_102192613300026358SoilPACALAGSFGLWKLALGAVQKPWGLFNVLSVGALLVVLVIAGYTGVFLALMTLKL
Ga0257177_103101313300026480SoilALGAVQKPWGLFNVLSVGALLVVLVIAGYTGVFLALMTLKL
Ga0209220_101942213300027587Forest SoilAHGRMIGLFVLPPCLFAGCVGLWKLALGAVEKPWGIFNVLSFSALLILLVIAGYTGLFLALITFRI
Ga0208981_109887023300027669Forest SoilAMGAVQRPFGILNALSFGALILLLIIAGYTGIFLAIITARF
Ga0209248_1018276023300027729Bog Forest SoilIAGGFGLWKLALGAVQKPWGILNVLSFGALVVVLFIAGYTGLFLALITLKL
Ga0209908_1008060933300027745Thawing PermafrostLFLPSVTFLIVFPQIAYGRALGIVVVLLCALVGSLGLWKLALGAVQRPWGLFNVLNFGALCVLLVVAGYTGVFLALMAARL
Ga0209517_1017502123300027854Peatlands SoilALAGSVGLWKLATGAVQKPWGIFNVLSFGALLVLLVIAGYTGLFLALMTLKL
Ga0209067_1007135513300027898WatershedsPHGRFVGFLLLPICALLGSFGLWQIALGTVQKPWGIFNILNVTALLVLLVIAGYTGVFLALMTMKL
Ga0302160_1012239623300028665FenRVIGGVVVTACALAGSVGLWKLALGAVERPWGIFNVVNMVALFVLLVIAGYTGLFLALMTLKL
Ga0302266_1002862033300028779BogLALGAVQKPWGIFNVLSFGALLVLLVIAGYTGIFLALMTLKI
Ga0307504_1011805623300028792SoilGAVQRPFGILSALSLGAMVVLLIMAAYTGLFLALIVANG
Ga0302222_1006817913300028798PalsaLLFLPSVTFLIVFPQIAYGRALGIVVVLLCALVGSLGLWKLALGAVQRPWGLFNVLNFGALCVLLVVAGYTGVFLALMAARL
Ga0302278_1002316143300028866BogVQKPWGIFNVLSFGALLVLLVIAGYTGIFLALMTLKI
Ga0302230_1023884613300028871PalsaKLALGAVQKPWGLFNVLSFGALLVLLVIAGYTGVFLAIMTLKL
Ga0311327_1002112813300029883BogFLIVFPQVAYGRAIGLIIVPLSALTSCFGLWKLALGAVQKPWGIFNVLSFGALLVLLVIAGYTGIFLALMTLKI
Ga0302143_1000053183300029918BogVVVPACALTSCFGLWKLALGAVQKPWGIFNVLSFGTILVLLVIAGYTGLFLALMTLKL
Ga0311328_1004078713300029939BogPATMFLIVFPQVAYGRAIGLIIVPLSALTSCFGLWKLALGAVQKPWGIFNVLSFGALLVLLVIAGYTGIFLALMTLKI
Ga0311352_1140611623300029944PalsaVCALASSFGLWKVAMGAVQKPWGIFNVLSFGALLVLLVIAGYTGLFLALMTLRL
Ga0311343_1131724423300029953BogCALASSFGLWKLALGAVEKPWGIFNVLSFGALMVLLVIAGYTGLFLALMTVNL
Ga0311342_1074092923300029955BogLPAVMFLIVFPQVRFGRALGFFVVPACALTSCFGLSKLANGAVQRPWGIFNVLSFGALLVLLVIAGYTGVFLALMTLKI
Ga0302150_1001645543300029956BogVVVPACALTSCFGLWKLALGAVQKPWGIFNVLSFGTILVLLVVAGYTGLFLALMTLKL
Ga0302293_1015089813300029981FenAVTFLIVFPRVTHGRLIGGVVVTACALAGSFGLWKLALGAVEKPWGIFNVLNMVALFILLVIAGYTGVFLALMTLKL
Ga0302188_1023954213300029986BogIVFPQVRFGRGLGFLVVPACALTSCFGLWKLANGAVQRPWGIFNVLSFGALLVLLVIAGYTGVFLALMTLKI
Ga0311334_1009501513300029987FenASSVGLWKLAFGAVQRPFGILNALSFAALFVLMVIAGYTGLFLALITVKF
Ga0302272_109709323300030001BogTFLIVFPRVTHGRLIGGVVVTACALAGSFGLWKLALGAVEKPWGIFNVLNMVALFILLVIAGYTGVFLALMTLKL
Ga0302186_1012976713300030004BogALGAVQKPWGIFNVLSFGALLVLLVIAGYTGIFLALMTLKI
Ga0302175_1007769013300030014FenVVVTACALAGSFGLWKLALGAVEKPWGIFNVLNMVALFILLVIAGYTGVFLALMTLKL
Ga0302191_1034430213300030049BogLWKLALGAVQKPWGIFNVLSFGALLVLLVIAGYTGIFLALMTLKI
Ga0311345_1007905513300030688BogATMFLIVFPQVAYGRAIGLIIVPLSALTSCFGLWKLALGAVQKPWGIFNVLSFGALLVLLVIAGYTGIFLALMTLKI
Ga0302180_1001981913300031028PalsaPSVTFLIVFPQIAYGRALGIVVVLLCALVGSLGLWKLALGAVQRPWGLFNVLNFGALCVLLVVAGYTGVFLALMAARL
Ga0302187_1044256213300031259BogKPWGIFNVLSFGALLVLLVIAGYTGIFLALMTLKI
Ga0265313_1029215013300031595RhizosphereVVRKPWGIFNVLNVGALLVLLVIAGYTGLFLALMTQKL
Ga0307469_1058492413300031720Hardwood Forest SoilPATTFLIVFPRVPHGRAIGFLVLPLCALAGSFGLWKLAMGAVEKPWGMFNVLSFGALLILLFIAGYTGVFLALMTLQL
Ga0311301_1191831523300032160Peatlands SoilVQKPWGIFNVLNFGALFVLLIIAAYTGLFLALMTLKL
Ga0335078_1053093813300032805SoilALGAVQKPWGIFNVLCVAALIVLLVIAGYTGVFLALLTLKI
Ga0335078_1113381533300032805SoilVGVVEKPWGLFNFLSFGALMILLVIAAYTGLFLALTALRL
Ga0335080_1182386623300032828SoilGFIVVAVCALLGSYGLWKLALGAVAKPWGIFNVLNMVALFVLLVIAGYTGLFLALMTLKL
Ga0335081_1003668493300032892SoilLALGAVQKPWGIFNVLCVGALIVLLVIAGYTGVFLALLTLKI
Ga0335076_1058879323300032955SoilGAVQKPWGIFNVLCVAALIVLLVIAGYTGVFLALLTLKI
Ga0335077_1001574313300033158SoilIGCIVVPACAVAGSLGLWQLALGAVQKPWGIFNVLCVGALIVLLVIAGYTGVFLALLTLK
Ga0326727_1031540613300033405Peat SoilKLALGAVQKPWGIFNVLNVGALLVLLVIAAYTGLFLALMTLKI
Ga0334854_079843_1_1173300033829SoilAVQRPWGLFNVLNFGALCVLLVVAGYTGVFLALMAARL


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.