NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F080760

Metagenome / Metatranscriptome Family F080760

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F080760
Family Type Metagenome / Metatranscriptome
Number of Sequences 114
Average Sequence Length 106 residues
Representative Sequence MTTKTLATTAAVPEGQKLPILEPQRGACVEFVKFCKEQHLGSRAAHTFLRVLHNKTWEVECDKIRESMRPEVDRIFEPAEKALNEGANCKEVLAVLVQSLKKAEEL
Number of Associated Samples 70
Number of Associated Scaffolds 114

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 32.46 %
% of genes near scaffold ends (potentially truncated) 28.07 %
% of genes from short scaffolds (< 2000 bps) 62.28 %
Associated GOLD sequencing projects 70
AlphaFold2 3D model prediction Yes
3D model pTM-score0.67

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (100.000 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog
(21.053 % of family members)
Environment Ontology (ENVO) Unclassified
(58.772 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Water (non-saline)
(35.965 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 55.97%    β-sheet: 0.00%    Coil/Unstructured: 44.03%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.67
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 114 Family Scaffolds
PF13561adh_short_C2 25.44
PF00106adh_short 3.51
PF01256Carb_kinase 3.51
PF02367TsaE 3.51
PF08032SpoU_sub_bind 2.63
PF07885Ion_trans_2 2.63
PF04945YHS 1.75
PF00691OmpA 1.75
PF06723MreB_Mbl 1.75
PF02629CoA_binding 1.75
PF08238Sel1 0.88
PF127294HB_MCP_1 0.88
PF00682HMGL-like 0.88
PF08281Sigma70_r4_2 0.88
PF00549Ligase_CoA 0.88
PF00903Glyoxalase 0.88
PF13579Glyco_trans_4_4 0.88
PF02080TrkA_C 0.88
PF16363GDP_Man_Dehyd 0.88
PF03853YjeF_N 0.88
PF08922DUF1905 0.88
PF00334NDK 0.88
PF08442ATP-grasp_2 0.88
PF03992ABM 0.88
PF01381HTH_3 0.88
PF00701DHDPS 0.88
PF00374NiFeSe_Hases 0.88
PF04551GcpE 0.88
PF00753Lactamase_B 0.88
PF13451zf-trcl 0.88
PF12697Abhydrolase_6 0.88
PF00171Aldedh 0.88

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 114 Family Scaffolds
COG0063NAD(P)H-hydrate repair enzyme Nnr, NAD(P)H-hydrate dehydratase domainNucleotide transport and metabolism [F] 3.51
COG0351Hydroxymethylpyrimidine/phosphomethylpyrimidine kinaseCoenzyme transport and metabolism [H] 3.51
COG0802tRNA A37 threonylcarbamoyladenosine biosynthesis protein TsaETranslation, ribosomal structure and biogenesis [J] 3.51
COG0566tRNA G18 (ribose-2'-O)-methylase SpoUTranslation, ribosomal structure and biogenesis [J] 2.63
COG0045Succinyl-CoA synthetase, beta subunitEnergy production and conversion [C] 1.75
COG03294-hydroxy-tetrahydrodipicolinate synthase/N-acetylneuraminate lyaseCell wall/membrane/envelope biogenesis [M] 1.75
COG0458Carbamoylphosphate synthase large subunitAmino acid transport and metabolism [E] 1.75
COG1077Cell shape-determining ATPase MreB, actin-like superfamilyCell cycle control, cell division, chromosome partitioning [D] 1.75
COG0014Gamma-glutamyl phosphate reductaseAmino acid transport and metabolism [E] 0.88
COG0026Phosphoribosylaminoimidazole carboxylase (NCAIR synthetase)Nucleotide transport and metabolism [F] 0.88
COG0062NAD(P)H-hydrate repair enzyme Nnr, NAD(P)H-hydrate epimerase domainNucleotide transport and metabolism [F] 0.88
COG0074Succinyl-CoA synthetase, alpha subunitEnergy production and conversion [C] 0.88
COG0105Nucleoside diphosphate kinaseNucleotide transport and metabolism [F] 0.88
COG0151Phosphoribosylamine-glycine ligaseNucleotide transport and metabolism [F] 0.88
COG0374Ni,Fe-hydrogenase I large subunitEnergy production and conversion [C] 0.88
COG08214-hydroxy-3-methylbut-2-enyl diphosphate synthase IspG/GcpELipid transport and metabolism [I] 0.88
COG1012Acyl-CoA reductase or other NAD-dependent aldehyde dehydrogenaseLipid transport and metabolism [I] 0.88
COG1042Acyl-CoA synthetase (NDP forming)Energy production and conversion [C] 0.88
COG3259Coenzyme F420-reducing hydrogenase, alpha subunitEnergy production and conversion [C] 0.88
COG4230Delta 1-pyrroline-5-carboxylate dehydrogenaseAmino acid transport and metabolism [E] 0.88

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms100.00 %
UnclassifiedrootN/A0.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300004628|Ga0070399_1000062All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae101260Open in IMG/M
3300005944|Ga0066788_10029105All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1252Open in IMG/M
3300009665|Ga0116135_1195655All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium771Open in IMG/M
3300009665|Ga0116135_1423708All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium543Open in IMG/M
3300009759|Ga0116101_1138701All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium589Open in IMG/M
3300010339|Ga0074046_10255699All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1086Open in IMG/M
3300012206|Ga0137380_10178457All Organisms → cellular organisms → Bacteria1932Open in IMG/M
3300012209|Ga0137379_10573154All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1036Open in IMG/M
3300014160|Ga0181517_10003869All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis13987Open in IMG/M
3300014160|Ga0181517_10088868All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1816Open in IMG/M
3300014160|Ga0181517_10110272All Organisms → cellular organisms → Bacteria1590Open in IMG/M
3300014160|Ga0181517_10638928All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium531Open in IMG/M
3300014161|Ga0181529_10002171All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis23987Open in IMG/M
3300014161|Ga0181529_10064299All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2489Open in IMG/M
3300014167|Ga0181528_10000006All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis267002Open in IMG/M
3300014167|Ga0181528_10000009All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis246122Open in IMG/M
3300014167|Ga0181528_10003506All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis9619Open in IMG/M
3300014168|Ga0181534_10283264All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium889Open in IMG/M
3300014168|Ga0181534_10953427All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium516Open in IMG/M
3300014169|Ga0181531_10015089All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis4430Open in IMG/M
3300014169|Ga0181531_10062344All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2190Open in IMG/M
3300014199|Ga0181535_10090919All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1981Open in IMG/M
3300014492|Ga0182013_10116169All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1764Open in IMG/M
3300014492|Ga0182013_10225631All Organisms → cellular organisms → Bacteria1104Open in IMG/M
3300014492|Ga0182013_10246331All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1037Open in IMG/M
3300014492|Ga0182013_10494173All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium638Open in IMG/M
3300014493|Ga0182016_10041690All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis3696Open in IMG/M
3300014493|Ga0182016_10335392All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium913Open in IMG/M
3300014655|Ga0181516_10016833All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae3873Open in IMG/M
3300014655|Ga0181516_10027448All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2930Open in IMG/M
3300014655|Ga0181516_10076405All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1688Open in IMG/M
3300014655|Ga0181516_10197158All Organisms → cellular organisms → Bacteria1022Open in IMG/M
3300014655|Ga0181516_10339289All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium765Open in IMG/M
3300014658|Ga0181519_10780710All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium590Open in IMG/M
3300014838|Ga0182030_10018088All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis13547Open in IMG/M
3300014838|Ga0182030_10018683All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae13275Open in IMG/M
3300014838|Ga0182030_10535703All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1154Open in IMG/M
3300014838|Ga0182030_10547009All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1137Open in IMG/M
3300016705|Ga0181507_1049414All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium536Open in IMG/M
3300016722|Ga0183100_1061087All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium582Open in IMG/M
3300016728|Ga0181500_1205892All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium617Open in IMG/M
3300016728|Ga0181500_1431772All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium507Open in IMG/M
3300017948|Ga0187847_10027687All Organisms → cellular organisms → Bacteria → Acidobacteria3405Open in IMG/M
3300017948|Ga0187847_10456069All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium706Open in IMG/M
3300017988|Ga0181520_10000462All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis90380Open in IMG/M
3300017988|Ga0181520_10001132All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis55849Open in IMG/M
3300017988|Ga0181520_10023389All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae6887Open in IMG/M
3300017988|Ga0181520_10811143All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium630Open in IMG/M
3300018037|Ga0187883_10644223All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium551Open in IMG/M
3300018043|Ga0187887_10545354All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium684Open in IMG/M
3300018043|Ga0187887_10698891All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium599Open in IMG/M
3300018046|Ga0187851_10006493All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis9095Open in IMG/M
3300018046|Ga0187851_10697541All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium572Open in IMG/M
3300018062|Ga0187784_11226613All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium595Open in IMG/M
3300019230|Ga0181501_1350744All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium590Open in IMG/M
3300022861|Ga0224528_1000165All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis55388Open in IMG/M
3300022863|Ga0224532_1002431All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2089Open in IMG/M
3300022863|Ga0224532_1014402All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1013Open in IMG/M
3300022877|Ga0224527_1008486All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae3024Open in IMG/M
3300023088|Ga0224555_1090354All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium981Open in IMG/M
3300023091|Ga0224559_1044766All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1766Open in IMG/M
3300023091|Ga0224559_1154631All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium814Open in IMG/M
3300023091|Ga0224559_1255744All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium591Open in IMG/M
3300026456|Ga0255351_1002800All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae6200Open in IMG/M
3300026502|Ga0255350_1023325All Organisms → cellular organisms → Bacteria1658Open in IMG/M
(restricted) 3300028024|Ga0255336_100463All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis63432Open in IMG/M
3300028084|Ga0255356_1026836All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1323Open in IMG/M
3300028090|Ga0255349_1087516All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium573Open in IMG/M
3300028560|Ga0302144_10115180All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium866Open in IMG/M
3300028574|Ga0302153_10220699All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium649Open in IMG/M
3300028748|Ga0302156_10005222All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis9304Open in IMG/M
3300028762|Ga0302202_10089004All Organisms → cellular organisms → Bacteria1807Open in IMG/M
3300028785|Ga0302201_10098580All Organisms → cellular organisms → Bacteria1321Open in IMG/M
3300028866|Ga0302278_10140734All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1273Open in IMG/M
3300028873|Ga0302197_10364969All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium642Open in IMG/M
3300029915|Ga0311358_10012970All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae11643Open in IMG/M
3300029915|Ga0311358_10605727All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium826Open in IMG/M
3300029945|Ga0311330_10941148All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium643Open in IMG/M
3300029953|Ga0311343_10850952All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium736Open in IMG/M
3300029953|Ga0311343_11340112All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium537Open in IMG/M
3300029954|Ga0311331_10087494All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis4057Open in IMG/M
3300029955|Ga0311342_11045623All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium601Open in IMG/M
3300029956|Ga0302150_10375400All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium526Open in IMG/M
3300029994|Ga0302283_1097332All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1228Open in IMG/M
3300030011|Ga0302270_10002408All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis18251Open in IMG/M
3300030020|Ga0311344_10390338All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1284Open in IMG/M
3300031261|Ga0302140_11019654All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium568Open in IMG/M
3300031524|Ga0302320_10742787All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1102Open in IMG/M
3300031759|Ga0316219_1008233All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis6436Open in IMG/M
3300031788|Ga0302319_10053013All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis6482Open in IMG/M
3300031813|Ga0316217_10048790All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2283Open in IMG/M
3300031813|Ga0316217_10115901All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1206Open in IMG/M
3300031813|Ga0316217_10145629All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1025Open in IMG/M
3300032560|Ga0316223_1154381All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium762Open in IMG/M
3300032579|Ga0316228_1205526All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium641Open in IMG/M
3300032668|Ga0316230_1275016All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium564Open in IMG/M
3300032722|Ga0316231_1081271All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1642Open in IMG/M
3300032753|Ga0316224_1103063All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → unclassified Granulicella → Granulicella sp. L461070Open in IMG/M
3300033402|Ga0326728_10016136All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis15325Open in IMG/M
3300033402|Ga0326728_10034651All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis8251Open in IMG/M
3300033402|Ga0326728_10055406All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae5645Open in IMG/M
3300033402|Ga0326728_10122226All Organisms → cellular organisms → Bacteria2986Open in IMG/M
3300033402|Ga0326728_10189104All Organisms → cellular organisms → Bacteria2106Open in IMG/M
3300033405|Ga0326727_10002133All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis69652Open in IMG/M
3300033405|Ga0326727_10028064All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis10271Open in IMG/M
3300033405|Ga0326727_10059922All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis5738Open in IMG/M
3300033405|Ga0326727_10297779All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter1593Open in IMG/M
3300033755|Ga0371489_0001267All Organisms → cellular organisms → Bacteria39704Open in IMG/M
3300033755|Ga0371489_0018077All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis5854Open in IMG/M
3300034124|Ga0370483_0000004All Organisms → cellular organisms → Bacteria100511Open in IMG/M
3300034199|Ga0370514_060500All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium955Open in IMG/M
3300034282|Ga0370492_0012398All Organisms → cellular organisms → Bacteria → Acidobacteria3486Open in IMG/M
3300034282|Ga0370492_0159184All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium922Open in IMG/M
3300034282|Ga0370492_0354682All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium595Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog21.05%
BogEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Bog17.54%
SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Soil10.53%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland9.65%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil9.65%
BogEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Bog8.77%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater7.89%
Untreated Peat SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil4.39%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland2.63%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil1.75%
BioreactorEngineered → Bioreactor → Anaerobic → Unclassified → Unclassified → Bioreactor1.75%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland0.88%
Bog Forest SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil0.88%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Soil0.88%
Sandy SoilEnvironmental → Terrestrial → Soil → Sand → Unclassified → Sandy Soil0.88%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen0.88%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300004628Microbial communities from bioreactor (seeded with sewage sludge) at LBNL, California, USA - Biofuel metagenome 4 (version 1)EngineeredOpen in IMG/M
3300005944Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 2 DNA2013-048EnvironmentalOpen in IMG/M
3300009665Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10EnvironmentalOpen in IMG/M
3300009759Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_10EnvironmentalOpen in IMG/M
3300010339Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3EnvironmentalOpen in IMG/M
3300012206Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaGEnvironmentalOpen in IMG/M
3300012209Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaGEnvironmentalOpen in IMG/M
3300014160Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_30_metaGEnvironmentalOpen in IMG/M
3300014161Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_30_metaGEnvironmentalOpen in IMG/M
3300014167Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_10_metaGEnvironmentalOpen in IMG/M
3300014168Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_10_metaGEnvironmentalOpen in IMG/M
3300014169Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaGEnvironmentalOpen in IMG/M
3300014199Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_30_metaGEnvironmentalOpen in IMG/M
3300014492Permafrost microbial communities from Stordalen Mire, Sweden - 612S2M metaGEnvironmentalOpen in IMG/M
3300014493Permafrost microbial communities from Stordalen Mire, Sweden - 712S2M metaGEnvironmentalOpen in IMG/M
3300014655Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_10_metaGEnvironmentalOpen in IMG/M
3300014658Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_10_metaGEnvironmentalOpen in IMG/M
3300014838Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300016705Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016722Microbial communities from bioreactor (seeded with anoxic lake sediment) at LBNL, California, USA - Biofuel metagenome 2EngineeredOpen in IMG/M
3300016728Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_10_metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300017948Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_10EnvironmentalOpen in IMG/M
3300017988Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_30_metaGEnvironmentalOpen in IMG/M
3300018037Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_10EnvironmentalOpen in IMG/M
3300018043Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_10EnvironmentalOpen in IMG/M
3300018046Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_10EnvironmentalOpen in IMG/M
3300018062Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300019230Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_30_metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300022861Peat soil microbial communities from Stordalen Mire, Sweden - C.B.S.T25EnvironmentalOpen in IMG/M
3300022863Peat soil microbial communities from Stordalen Mire, Sweden - 717 E1 1-5EnvironmentalOpen in IMG/M
3300022877Peat soil microbial communities from Stordalen Mire, Sweden - C.B.S.T0EnvironmentalOpen in IMG/M
3300023088Peat soil microbial communities from Stordalen Mire, Sweden - 717 S2 30-34EnvironmentalOpen in IMG/M
3300023091Peat soil microbial communities from Stordalen Mire, Sweden - 717 S3 30-34EnvironmentalOpen in IMG/M
3300026456Peat soil microbial communities from Stordalen Mire, Sweden - H.B.S.T-25.r2EnvironmentalOpen in IMG/M
3300026502Peat soil microbial communities from Stordalen Mire, Sweden - H.B.S.T-25.r1EnvironmentalOpen in IMG/M
3300028024 (restricted)Sandy soil microbial communities from University of British Columbia, Vancouver, Canada - MeOH1_35cm_T3_179EnvironmentalOpen in IMG/M
3300028084Peat soil microbial communities from Stordalen Mire, Sweden - H.B.S.T100EnvironmentalOpen in IMG/M
3300028090Peat soil microbial communities from Stordalen Mire, Sweden - C.B.S.T-25.v15EnvironmentalOpen in IMG/M
3300028560Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E2_2EnvironmentalOpen in IMG/M
3300028574Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N2_2EnvironmentalOpen in IMG/M
3300028748Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N3_2EnvironmentalOpen in IMG/M
3300028762Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N3_3EnvironmentalOpen in IMG/M
3300028785Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N3_2EnvironmentalOpen in IMG/M
3300028866Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N3_2EnvironmentalOpen in IMG/M
3300028873Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N2_1EnvironmentalOpen in IMG/M
3300029915III_Bog_E1 coassemblyEnvironmentalOpen in IMG/M
3300029945I_Bog_N2 coassemblyEnvironmentalOpen in IMG/M
3300029953II_Bog_E3 coassemblyEnvironmentalOpen in IMG/M
3300029954I_Bog_N3 coassemblyEnvironmentalOpen in IMG/M
3300029955II_Bog_E2 coassemblyEnvironmentalOpen in IMG/M
3300029956Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N1_2EnvironmentalOpen in IMG/M
3300029994Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_E1_4EnvironmentalOpen in IMG/M
3300030011Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_E2_3EnvironmentalOpen in IMG/M
3300030020II_Bog_N1 coassemblyEnvironmentalOpen in IMG/M
3300031261Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E1_1EnvironmentalOpen in IMG/M
3300031524Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_3EnvironmentalOpen in IMG/M
3300031759Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18003PEnvironmentalOpen in IMG/M
3300031788Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_2EnvironmentalOpen in IMG/M
3300031813Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - 1anoAEnvironmentalOpen in IMG/M
3300032560Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18009EnvironmentalOpen in IMG/M
3300032579Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18021EnvironmentalOpen in IMG/M
3300032668Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18025EnvironmentalOpen in IMG/M
3300032722Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18027EnvironmentalOpen in IMG/M
3300032753Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18013EnvironmentalOpen in IMG/M
3300033402Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB31MNEnvironmentalOpen in IMG/M
3300033405Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB29MYEnvironmentalOpen in IMG/M
3300033755Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB26FY SIP fractionEnvironmentalOpen in IMG/M
3300034124Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_06D_14EnvironmentalOpen in IMG/M
3300034199Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_01D_14EnvironmentalOpen in IMG/M
3300034282Peat soil microbial communities from wetlands in Alaska, United States - Eight_mile_03D_16EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
Ga0070399_1000062673300004628BioreactorMTIKTTAAALSAEQALPIVDPQRETCVEFVKFCKEQHLKSRAAHTFLRVFHNKSWNAECEKIRESMRPEVNRIFEPAEKALNEGANCKEVLALLVRSLKEAEDL*
Ga0066788_1002910513300005944SoilMTTKTLAKSAAVSEGQSLPVLEPQRGACVEFVKFCKEQHLSSRAAQTFLRVLHNKTWEAECDKIRESMRPEVEQIFEPAEKAISEGANCKEVLAVLIRSLQQAERL*
Ga0116135_119565513300009665PeatlandMTTNTLDDKKAAVPEGQKLPVVEPQKGACVEFVKFCKEQHLHSRAAHTFLRVFHNNRWEAECEEIRENMRPEIDRMFAPAEKALEQGANCKEVLAKLVKSLKKAEEL*
Ga0116135_142370813300009665PeatlandMTTKNLNSTVAVLDEQLPVLEPQRGACVEFVKFCKEQHLSSRAAHTFLRVLHNHTWEAECETIRESMRPEIDRMFEPAEKALLEGRNCREVLDILVRTLKETENM*
Ga0116101_113870123300009759PeatlandMTTNTLDDKKAAVPEGQKLPVVEPQKGACVEFVKFCKEQHLRAQAAETFIRVLHNHAWQVECEHIREAMRPEIDQMFAPI
Ga0074046_1025569913300010339Bog Forest SoilMTTKTLEVTAAASEGQTTPLPETQRGACVEFVKFCKEQHLNARAAHTFLRVLHNDRWEHECEHIRESMRPEVDRIFAPAEKALQDGLNCKEVLKVLVESLKKAEEL*
Ga0137380_1017845733300012206Vadose Zone SoilMTTKTLATTAAVPEGQKLPILEPQRGACVEFVKFCKEQHLSSRAAHTFLRVLHNKTWDAECDKIRDSMRPEVDRIFEPAEKALSEGANCKEVLAVLVQSLKKAEEL*
Ga0137379_1057315413300012209Vadose Zone SoilMTTKTLATTAAVPEGQKLPILEPQRGACVEFVKFCKEQHLGSRAAHTFLRVLHNKTWEVECDKIRESMRPEVDRIFEPAEKALNEGANCKEVLAVLVQSLKKAEEL*
Ga0181517_1000386913300014160BogMTTKTLETTAAVLDGQDFPVIEPQRGACVEFVKFCKEQHLNSRAAHTFLRVLHNKPWEQECEKIREAMRPEVDRIFGPAEKALNEGVNCKEVLAMLVEALKKAENL*
Ga0181517_1008886823300014160BogMTTKTLDETPVAVLDGQNLPVFETQRGACVEFVKFCKEQHLNSRAAHTFLRVLHNKTWEAECDKIRESMRPEVDHIFKPAEKALKDGANCKEVLAVLVRSLKEAEDL*
Ga0181517_1011027223300014160BogMTTKNLDPSLAVIAEQKSAPEPRGGACVEFVKFCKEQHLNSRAAHTFLRVLHNKTWEAECEKIRESMRPEVDRMFEPAEKALAEGKNCREVLDLLVHALKQAENL*
Ga0181517_1063892813300014160BogSETPDNTAAVPDGQKLPVLETQRGACVDFVSFCKEQHLNSRAANTFLRVLHNKTWEAECHTIRESMRPEVDRIFEPAERALKEGANCKEVLAVLVHSLKEVEDL*
Ga0181529_1000217123300014161BogMTSETPDNTAAVPDGQKLPVLETQRGACVDFVSFCKEQHLNSRAANTFLRVLHNKTWEAECHTIRESMRPEVDRIFEPAERALKEGANCKEVLAVLVHSLKEVEDL*
Ga0181529_1006429923300014161BogMTTKNLDPSLPVINEQKDAPDPRGGACIEFVKFCKEQHLNSRAAHTFLRLLHNKPWDHECEKIRESMRPEVDHMFEPAEKALAEGKNCREVLDLLVQALKKAEDL*
Ga0181528_100000061873300014167BogMTTMTPAPTAVVLDEQKSPVCEPQRGACVEFVKFCKEQHLNSRAAHTFLHVLHNKTWEAECDKIRESMRPEVDRIFGPAEKALNEGLNCKDVLKTLIRSLEEAEYLK*
Ga0181528_10000009403300014167BogMTTKNLEMTAVVPEEKLQVLEPQRGACVEFVKFCKEQHLSSRAAHTFLRVLHNKTWEAECDKIRESMRPEVDRMFEPAEKALSEGRNCREVLDILVHTLTETENM*
Ga0181528_1000350653300014167BogMTNKNLETIAVTPEASACEPHRGACVEFVKFCKEQHLNSRAANTFLRVLHNHNWENERDHIRESMRPEVDRLFEPAEQALKEGRNCIEVLNVLMATLHKNEDL*
Ga0181534_1028326423300014168BogMLEALFGVTMTTKTLETTAAVLDGQDFPVIEPQRGACVEFVKFCKEQHLNSRAAHTFLRVLHNKPWEQECEKIREAMRPEVDRIFGPAEKALNEGVNCKEVLAMLVEALKKAENL*
Ga0181534_1095342713300014168BogMTTKNLNSTVAVLDEQLPVLEPQRGACVEFVKFCKERHLSSRAAHTFLRVLHNHTWEAECETIRESMRPEIDRMFEPAEKALLEGRNCR
Ga0181531_1001508943300014169BogMTTIDLAPSAVVIEEKKPVLEPQRGACVEFVKFCKEQHLSSRAAHTFLRVLHNKPWEDECEKIRESMRPEIDRMFEPAERALKEGRSCREVLDLLVHTLKETENM*
Ga0181531_1006234413300014169BogMTSKTPDNTAAAPEGQKLPVLDTQRGACVEFVKFCKEQHLNSRAANTFLRVLRNKTWEAECHTIRDSMRPEVDRIFEPAEKALQEGANCKQVLAVLVRSLKEAENL*
Ga0181535_1009091913300014199BogMTTKNLDPSLPVINEQKDAPDPRGGACIEFVKFCKEQHLNSRAAHTFLRLLHNKPWDHECEKIRESMRPEVDHMFEPAEKALAEGKNCREVLDLLMQALKKAEDL*
Ga0182013_1011616923300014492BogMTDKNLETIAVTPEASACEPHRGACVEFVKFCKEQHLSSRAANTFLRVLHNHNWETERDHIRESMRPEVDRLFEPAEQALKEGRNCIEVLNVLMATLHKNEDL*
Ga0182013_1022563123300014492BogMTTMTPAPTAVVLDEQKSPACEPQRGACVEFVKFCKEQHLNSRAAHTFLHVLHNKTWEAECDTIRESMRPEVDRIFGPAEKALNDGVNCKEVLATLVRSLKEAEELK*
Ga0182013_1024633123300014492BogMLDSARVVFLELYMTKTLEVSAVVSEGQCLPVIEPQRGACVEFVEFCKEQHLGSRAAHTFLRMFHNKAWNAECDKIREAMRPEVDRIFAPAEKALQAGANC
Ga0182013_1049417313300014492BogMTTKTPDSTVVVLDEQKSPACQPRGGACVEFVKFCKEQHLDSRVAHTFLHVLHNKTWQAECDQIREAMRPEADRIFGPAEKALNEGANCTEVFATLVRSLKKEAEELK*
Ga0182016_1004169043300014493BogMTTDTLDETTAAVSEGRKLPVVEPQRGACVEFVQFCKEQHLNSRAAHTFLRVFHNDRWEAECEKIRDSMRPEIDRMFGPAEKALKDGLNCKQVLAVLVESLKDAEDL*
Ga0182016_1033539213300014493BogMLDSARVVFLELYMTKTLEVSAVVSEGQCLPVIEPQRGACVEFVEFCKEQHLGSRAAHTFLRMFHNKAWNAECDKIREAMRPEVDRIFAPAEKALQAGANCTEVLQVLVKSLKDAEDL*
Ga0181516_1001683323300014655BogMTNKNLETIAVTPEASACEPHRGACVEFVKFCKEQHLNSRAANTFLRVLHNHNWENERDHIRESMRPEVDRLFEPAEQALKEGRNCIEVLNVLMATLHKNEVL*
Ga0181516_1002744813300014655BogMTTNTLDDKKAAVPEGQKLPVVEPQKGACVEFVKFCKEQHLHSRAAHTFLRVFHNNRWEAECEEIRENMRPEIDRMFAPAEKALEQGANCKEVLAKLVKSLKKAEEL
Ga0181516_1007640523300014655BogMTTIDLAPSAVVIEEKKPVLEPQRGACVEFVKFCKEQHLSSRAAHTFLRVLHNKPWEDECEKIRESMRPEIDRMFEPAEKALKEGRSCREVLDLLVHTLKETENM*
Ga0181516_1019715823300014655BogMPTKDLAPTDVVIEEKLPVPEPQRGACVEFVKFCKEQHLNSRAAHTFLRVLHNKTWEAECETIRESMRPEVDRMFEPAEKALSEGRNCREILDLLVHALKKAENM*
Ga0181516_1033928913300014655BogMTSKTLNKTAAASEDQNSPNQNLPIQSLPIVEPQRGACVEFVKFCKEQHLNSRAANTFLRVLHNQTWEAERDQIRDSMRPEVERIFAPAEKAMNAGANCKEVLAVLVRS
Ga0181519_1078071013300014658BogMTSKTIDKAAAVPEGQTLPVLDTQRGACVDFVQFCKEQHLNSRAANTFLRVLHNKTWEAECNTIRESMRPEVDRIFGPAEKALKEGANCKEVLAVLVNSLKEAENL*
Ga0182030_10018088153300014838BogEPQRGACVEFVEFCKEQHLGSRAAHTFLRMFHNKAWNAECDKIREAMRPEVDRIFAPAEKALQAGANCTEVLQVLVKSLKDAEDL*
Ga0182030_1001868313300014838BogMLDSARVVFLELYMTKTLEVSAVVSEGQCLPVIEPQRGACVEFVKFCKEQHLGSRAAHTFLRMFHNKAWNAECDKIREAMRPEVDRIFAPAEKALQEGANCREVLQVLVKSLKDAENL*
Ga0182030_1053570313300014838BogMLEALFGVTMTTKTLETTVAVLDGQDLPVVESQRGACVEFVKFCKEQHLNSRAAHTFLRVLHNKPWEQECEKIREAMRPEVDLIFGPAERALNEGVNCKEVLATLVQALKKAEDL*
Ga0182030_1054700923300014838BogMTTDTLDETTAAVSEGRKLPVVEPQRGACVEFVQFCKEQHLNSRAAHTFLRVFHNDRWEAECEKIRDSMRPEIDRMFGPAEKALKDGLNCKQVLAVLVESLKDAE
Ga0181507_104941413300016705PeatlandMMASQRWPRSRVPRSIGVLLSDETPVAVLDGQNLPVYETQRGACVEFVKFCKEQHLNSRAAHTFLRVLHNKTWEAECNTIRESMRPEVDNIFKPAEKALEEGLNCKEVLAVLVRS
Ga0183100_106108713300016722BioreactorVRAITSGSLKDGYGLVLMATKAPMTAANSDEQALPIVDPQRETCIEFVKFCKEQHLKSRAAHTFLRVFHNKTWDAECEKIRASMRPEVDRIFGPAEKALNEGANCKEVLALLVRSLKEAEDL
Ga0181500_120589213300016728PeatlandKNLEMTAVVPEEKLQVLEPQRGACVEFVKFCKEQHLSSRAAHTFLRVLHNKTWEAECDKIRESMRPEVDRMFEPAEKALSEGRNCREVLDILVHTLTETENM
Ga0181500_143177213300016728PeatlandVQIVGAGNSALNKTAAASEDQNSPNQNLTIQSLPIVEPQRGACVEFVKFCKEQHLNSRAANTFLRVLHNQTWEAERDQIRDSMRPEVERIFAPAEKAMNAGANCKEVLAVLVRSLKEAED
Ga0187847_1002768723300017948PeatlandMTTTTLAPKAAVADEQKMPVQQPLRGACVEFVEFCKEQHLNSRAAHTFLHVLHNKTWEAECDTIRESMRPEVNRIFEPAEKALQAGANCKEVLAVLVRSLKEEEKQDL
Ga0187847_1045606923300017948PeatlandMTTITLDETTAAVSEGQNLPVVEPQRGACVEFVKFCKEQHLNSRAAHTFLRVLHNKPWEQECEKIREAMRPEVDRIFGPAEKALNEGVNCKEVLAM
Ga0181520_10000462583300017988BogMTTKTLDETPVAVLDGQNLPVFETQRGACVEFVKFCKEQHLNSRAAHTFLRVLHNKTWEAECDKIRESMRPEVDHIFKPAEKALKDGANCKEVLAVLVRSLKEAEDL
Ga0181520_10001132273300017988BogMTTKTLETTAAVLDGQDFPVIEPQRGACVEFVKFCKEQHLNSRAAHTFLRVLHNKPWEQECEKIREAMRPEVDRIFGPAEKALNEGVNCKEVLAMLVEALKKAENL
Ga0181520_1002338943300017988BogMTTKTLDTMPAASDAQSLPVLETQRGACVEFVQFCKEQHLNSRAAHTFLRVLHNDRWEAECEKIRDSMRPEVDRIFEPAEKALKEGANCKQVLAVLVHSLKVAEEL
Ga0181520_1081114323300017988BogMMTKNLDPSLPVINEQKDAPDPRGGACIEFVKFCKEQHLNSRAAHTFLRLLHNKPWDHECEKIRESMRPEVDHMFEPAEKALAEGKNCREVLDLLMQALKKAEDL
Ga0187883_1064422313300018037PeatlandMTSKTIDKTAAVPEGQSLPVLDTQRGACVEFVEFCKEQHLNSRAANTFLRVLRNKTWEAECHTIRESMRPEIDRMFEPAEKALKEGRSCREVLDLLVHTLKENENM
Ga0187887_1054535413300018043PeatlandMTTNTLDETTAAVSEGQKLPVVEPQRGACVEFVQFCKEQHLNSRAAHTFLRVFHNNRWEAECEKIRDSMRPEIDRMFGPAEKALKDGLNCKQVLAVLVQSLKDAEEL
Ga0187887_1069889113300018043PeatlandMTTKTLETTVAVLDGQDLPVVESQRGACVEFVKFCKEQHLNSRAAHTFLRVLHNKPWEQECEKIREAMRPEVDRIFGPAEKALNEGVNCKEVLAMLVEALKKAENL
Ga0187851_1000649363300018046PeatlandMTKTLEVSAAVSEGQSLPVIEPQRGACVEFVEFCKEQHLGSRSAHTFLRMFHNKAWNAECDKIREAMRPEVDRIFEPAEKALQEGANCKEVLRILVKSLKDAEEL
Ga0187851_1069754113300018046PeatlandMTTKTLETTVAVLDGQDLPVVEPQRGACVEFVKFCKEQHLNSRAAHTFLRVLHNKPWEAECETIRESMRPEIDRMFEPAEKALNEGRNCHEVLDLLVRTLKENENM
Ga0187784_1122661323300018062Tropical PeatlandMTSKTIDKTAAVPEGQNLPVLDTQRGACVEFVEFCKEQHLNSRAANTFLRVLHNKTWEAECHTIREYMRPEVDQIFEPAERALREGANCKE
Ga0181501_135074413300019230PeatlandMTTKNLDPSLAVIAEQKSAPEPRGGACVEFVKFCKEQHLNSRAAHTFLRVLHNKTWEAECEKIRESMRPEVDRMFEPAEKALAEGKNCREVLDLLVHALKQAENL
Ga0224528_100016553300022861SoilMTTKTLEKTATVPEGQSLPVLEPQRGACVEFVKFCKEQHLNSRAANTFLRVLHNKTWDTECETIRESMRPEVERIFEPAEKAMNEGANCKEVLAVLVCSLKEAEEL
Ga0224532_100243123300022863SoilMTTKNLEMTAVVPEEKLQVLEPQRGACVEFVKFCKEQHLNSRAAHTFLRVLHNKTWEAECEKIRESMRPEVDSMFEPAEKALSEGRNCREVLDILVHTLKETENM
Ga0224532_101440223300022863SoilMTTKTLEMTDVVPEEQKLPVAETQRGACVEFVKFCKEQHLNSRAAHTFLRVLHNKPWEEECDKIREAMRPEVDRIFGPAEKALQEGVNCKEALARLVQALKKAEDL
Ga0224527_100848643300022877SoilMTTKNLNSDAAVLDEKLPVLEPQRGACVEFVKFCKEQHLNSRAAHTFLRVLHNKQWETECETIRESMRPEVDHLFEPAEKALKEGRNCREVLDLLVQTLKANENM
Ga0224555_109035423300023088SoilMSMLDSARVVFLELYMTKTLEVSAVVSEGQCLPVIEPQRGACVEFVEFCKEQHLGSRAAHTFLRMFHNKAWNAECDKIREAMRPEVDRIFAPAEKALQEGANCREVLQVLVKSLKDAENL
Ga0224559_104476623300023091SoilMIKTLEMSAAVSEGQSLPMIEPQRGACVEFVEFCKEQHLGSRSAHTFLRMFHNKAWNAECDKIREAMRPEVDRIFAPAEKALQEGANCKEVLRILVKSLKDAQNL
Ga0224559_115463113300023091SoilYVEQRKSGFLELFMTKTLEMSAAGSEGQSLPVIEPQRGACVEFVEFCKEQHLGSRAAHTFLRMFHNKAWNAECDKIREAMRPEVDRIFAPAEKALQEGANCREVLQVLVKSLKDAENL
Ga0224559_125574413300023091SoilMTSKTSDNTDAIPEGQKLPVLDTQRGACVDFVEFCKEQHLNARAANTFLRVLHNKTWEAECHTIREAMRPEVDRVFGPAEKALKDGANCKEVLAVLVQSLKEAENL
Ga0255351_100280043300026456SoilMTDKNLETIAVTPEASACEPHRGACVEFVKFCKEQHLSSRAANTFLRVLHNHNWETERDHIREAMRPEVDRLFEPAEQALKEGRNCIEVLNVLMATLHKNEDL
Ga0255350_102332523300026502SoilMTTKNLNSDAAVLDEKLPVLEPQRGACVEFVKFCKEQHLSSRAAHTFLRVLHNKQWETECETIRESMRPEVDHLFEPAEKALKEGRNCREVLDLLVQTLKANENM
(restricted) Ga0255336_100463313300028024Sandy SoilMTTKTLATTAAVPEGQKLSVLEPQRGACVEFVKFCKEQHLSSRAAHTFLRVLHNKTWDAECDKIRDSMRPEVDRIFEPAEKALNEGANCKEVLAVLVESLKKAEEL
Ga0255356_102683613300028084SoilMTTKNLNSTVAVLDEQLPVLEPQRGACVEFVKFCKEQHLSSRAAHTFLRVLHNHTWEAECETIRESMRPEIDRMFEPAEKALLEGRNCREVLDILVRTLKETENM
Ga0255349_108751623300028090SoilMTTKNLNSDAAVLDEKLPVLEPQRGACVEFVKFCKEQHLNSRAAHTFLRVLHNKQWETECETIRESMRPEVDHLFEPAEKALKEGRNCREVLDLLVQTLKA
Ga0302144_1011518023300028560BogVEQKSPACQPRGGACVEFVKFCKEQHLDSRVAHTFLHVLHNKTWQAECDQIREAMRPEADRIFGPAEKALNEGANCTEVFATLVRSLKKEAEELK
Ga0302153_1022069923300028574BogRDYLIILMTTKTPDSTVVVLDEQKSPACQPRGGACVEFVKFCKEQHLDSRVAHTFLHVLHNKTWQAECDQIREAMRPEADRIFGPAEKALNEGANCTEVFATLVRSLKKEAEELK
Ga0302156_1000522233300028748BogMTTKTPDSTVVVLDEQKSPACQPRGGACVEFVKFCKEQHLDSRVAHTFLHVLHNKTWQAECDQIREAMRPEADRIFGPAEKALNEGANCTEVFATLVRSLKKEAEELK
Ga0302202_1008900423300028762BogMTTMTPAPTAVVLDEQKSPACEPQRGACVEFVKFCKEQHLNSRAAHTFLHVLHNKTWEAECDTIRESMRPEVDRIFGPAEKALNDGVNCKEVLATLVRSLKEAEELK
Ga0302201_1009858023300028785BogMTPAPTAVVLDEQKSPACEPQRGACVEFVKFCKEQHLNSRAAHTFLHVLHNKTWEAECDTIRESMRPEVDRIFGPAEKALNDGVNCKEVLATLVRSLKEAEELK
Ga0302278_1014073423300028866BogMVMLEAQVGVPMTTKTLEMTDVVPEEQKLPVAETQRGACVEFVKFCKEQHLNSRAAHTFLRVLHNKPWEEECDKIREAMRPEVDRIFGPAEKALQEGVNCKEALARLVQALKKAEDL
Ga0302197_1036496913300028873BogDEQKSPACEPQRGACVEFVKFCKEQHLNSRAAHTFLHVLHNKTWEAECDTIRESMRPEVDRIFGPAEKALNDGVNCKEVLATLVRSLKEAEELK
Ga0311358_1001297083300029915BogVSDVTATAPKRDYLIILMTTKTPDSTVVVLDEQKSPACQPRGGACVEFVKFCKEQHLDSRVAHTFLHVLHNKTWQAECDQIREAMRPEADRIFGPAEKALNEGANCTEVFATLVRSLKKEAEELK
Ga0311358_1060572713300029915BogFVSDITSRWQKGKYLVVLMTTKTLDPPAAAIEGQKLPVVEQQRGACIEFVEFCKEQHLNSRAEHTFLRLLHNKAWEAECAKIRQTMSLEVDRIFEPAEKALQSGANCKEVLAVLVRSLKEAENL
Ga0311330_1094114823300029945BogMTTKTLDPPAAAIEGQKLPVVEQQRGACIEFLEFCKEQHLNSRAEHTFLRLLHNKAWEAECAKIRQTMSLEVDRIFEPAEKALQSGANCKEVLAVLVRSLKEAENL
Ga0311343_1085095213300029953BogTTKTLDPPAAAIEGQKLPVVEQQRGACIEFVEFCKEQHLNSRAEHTFLRLLHNKAWEAECAKIRQTMSLEVDRIFEPAEKALQSGANCKEVLAVLVRSLKEAENL
Ga0311343_1134011223300029953BogMTTKNLNSTVAVLDEQLPVLEPQRGACVEFVKFCKEQHLSSRAAHTFLRVLHNHTWEAECETIRESMRPEIDRMFEPAEKALLEGRNCRE
Ga0311331_1008749413300029954BogGRKMVMLEAQVGVPMTTKTLEMTDVVPEEQKLPVAETQRGACVEFVKFCKEQHLNSRAAHTFLRVLHNKPWDEECDKIREAMRPEVDRIFGPAEKALQEGVNCKEALARLVQALKKAEDL
Ga0311342_1104562323300029955BogMTTKTLDPPAAAIEGQKLPVVEQQRGACIEFVEFCKEQHLNSRAEHTFLRLLHNKAWEAECAKIRQTMSLEVDRIFEPAEKALQSGAN
Ga0302150_1037540023300029956BogLRYHRSPHSVSDVTATAPKRDYLIILMTTKTPDSTVVVLDEQKSPACQPRGGACVEFVKFCKEQHLDSRVAHTFLHVLHNKTWQAECDQIREAMRPEADRIFGPAEKALNEGANCTEVFATLVRSLKKEAEELK
Ga0302283_109733223300029994FenMTTKTPDSTVVVLDEQKSPACQPRGGACVEFVKFCKEQHLSSRAANTFLRVLHNHNWETERDHIRESMRPEVDRLFEPAEQALKEGRNCIEVLNVLMATLHKNEDL
Ga0302270_10002408183300030011BogMTTMTPAPTAVVLDEQKSPACEPQRGACVEFVKFCKEQHLNSRAAHTFLHVLHNKTWEAECDTIRESMRPEVDRIFGPAEKALNDGVNCKEVLATLVRSLKEAEE
Ga0311344_1039033813300030020BogHRSPHSVSDVTATAPKRDYLIILMTTKTPDSTVVVLDEQKSPACQPRGGACVEFVKFCKEQHLDSRVAHTFLHVLHNKTWQAECDQIREAMRPEADRIFGPAEKALNEGANCTEVFATLVRSLKKEAEELK
Ga0302140_1101965413300031261BogTKTLEMTDVVPEEQKLPVAETQRGACVEFVKFCKEQHLNSRAAHTFLRVLHNKPWEEECDKIREAMRPEVDRIFGPAEKALQEGVNCKEALARLVQALKKAEDL
Ga0302320_1074278723300031524BogMAKTLEMSAAGSEGQSLPVIEPQRGACVEFVKFCKEQHLGSRAAHTFLRMFHNKAWNAECDKIREAMRPEVDRIFAPAEKALQEGANCREVLQVLVKSLKDAENL
Ga0316219_100823353300031759FreshwaterVSDITSIWQKAEYLVVLMTTITHDPPAAAIEGQKLPVVEQQRGACIEFVEFCKEQHLNSRAEHTFLRLLHNKAWEAECAKIRQSMSLEVDRIFEPAEKALKSGANCKEVLAVLVRSLKETENL
Ga0302319_1005301313300031788BogMTTMTPAPTAVVLDEQKSPACEPQRGACVEFVKFCKEQHLNSRAANTFLHVLHNKTWEAECDTIRESMRPEVDRIFGPAEKALNDGV
Ga0316217_1004879013300031813FreshwaterMNKTLETPAAASEGQNLPSCDPQRGACVEFVEFCKEQHLSSRAANTFLRLFHNKTWNEECNKIRESMRPEVDRVFEPAEKALQEGANCKEVLRILVKSLKDAENL
Ga0316217_1011590123300031813FreshwaterMTTKTLDPPAAAIEGQKLPVVEQQRGACIEFVEFCKEQHLNSRAEHTFLRLLHNKAWEAECAKIRQSMSLEVDRIFEPAEKALKSGANCKEVLATLVRSLKEAEDL
Ga0316217_1014562923300031813FreshwaterMTTTTLDPKAAVPDKQKLPVAEPQRGACIEFVEFCKEQHLNSRAEHTFLRLLHNKAWEAECDKIRQSMSHEVDQLFEPAEKALKEGANCREVLAVLVRSLKQAENM
Ga0316223_115438113300032560FreshwaterYLVVLMTTITHDPPAAAIEGQKLPVVEQQRGACIEFVEFCKEQHLNSRAEHTFLRLLHNKAWEAECAKIRQSMSLEVDRIFEPAEKALKSGANCKEVLAVLVRSLKETENL
Ga0316228_120552613300032579FreshwaterMNKTLETPAAVSQGQNVPTCDPQRGACVEFVEFCKEQHLSSRAANTFLRLFHNKTWNEECSKIRESMRPEVDRIFEPAEKALQEGVNCKEVLRILVKSLKDAENL
Ga0316230_127501613300032668FreshwaterTPAAVSQGQNVPTCDPQRGACVEFVEFCKEQHLSSRAANTFLRLFHNKTWNEECSKIRESMRPEVDRIFEPAEKALQEGVNCKEVLRILVKSLKDAENL
Ga0316231_108127123300032722FreshwaterMNKTLETPAAVSQGQNVPTCDPQRGACVEFVEFCKEQHLSSRAANTFLRLFHNKTWNEECSKIRESMRPEVDRIFEPAEKALQEGVNCKEVLRILVKSLKDAERAQNFFARLAFINSFVSPS
Ga0316224_110306313300032753FreshwaterMTTITHDPPAAAIEGQKLPVVEQQRGACIEFVEFCKEQHLNSRAEHTFLRLLHNKAWEAECAKIRQSMSLEVDRIFEPAEKALKSGANCKEVLAVLVRSLKETENL
Ga0326728_10016136133300033402Peat SoilMTTKTLETKVAVLDGQDLPVIEPQRGACVEFVKFCKEQHLNSRAAHTFLRVLHNKPWEQECEKIREAMRPEVDRIFGPAEKALNEGVNCKEVLAMLVEALKKAEDL
Ga0326728_1003465113300033402Peat SoilMTTKNLDPIAVVADEQNALACEPRRGACVEFVKFCKEQHLNSRAAHTFLRVLHNKSWEAECDKIRESMRPEVDHLFEPAEKALKEGKNCMEVLNVLVRTLEENEKL
Ga0326728_1005540623300033402Peat SoilMTANTLNPKPAAAEGECQPPDLQRGACLEFVQFCKEQHLNSRAAHTFLHVLHNQTWEKECEKIRESMRPEVDRIFAPIEKALQDGANCREVLALLVDRLNKAEYLK
Ga0326728_1012222643300033402Peat SoilMTTNTLETKPAAPEDKPELQRGACLEFVKFCKEQHLKSRAAHTFLHILHNQSWEKECEKIREAMRPEVDRIFAPIEK
Ga0326728_1018910423300033402Peat SoilMTTKNLETIAAAPEASACEPHRGACVEFVKFCKEQHLNSRAANTFLRVLHNHNWEAERDHIRESMRPEVDRLFEPAEQALKEGRNCIEVLDMLVATLHKNENL
Ga0326727_10002133273300033405Peat SoilMLEAFFGVTMTTKTLETKVAVLDGQDLPVIEPQRGACVEFVKFCKEQHLNSRAAHTFLRVLHNKPWEQECEKIREAMRPEVDRIFGPAEKALNEGVNCKEVLAMLVEALKKAEDL
Ga0326727_1002806433300033405Peat SoilMTTNTLETKPAAPEDKPELQRGACLEFVKFCKEQHLKSRAAHTFLHILHNQSWEKECEKIREAMRPEVDRIFAPIEKAMQEGANCREILALLVDRLNKAEYLK
Ga0326727_1005992253300033405Peat SoilMFDSVGVFYLMTTKLEPKPADPEGQSKPPELQRGACLEFVKFCKEQHLNSRAAHTFLHVLHNQSWEKECETIREAMRPEVDRIFAPIEKALQEGANCREVLALLVDRLNKAENLK
Ga0326727_1029777923300033405Peat SoilMTTKALEITAAAPEGKNLPSADPQRGACVEFVQFCKEQHLNARAAHTFLRVLHNNRWEAECEHIRESMRPEVDRIFAPAEKALKDGSNCREVLAVLVHSLKEAEEL
Ga0371489_0001267_32260_325773300033755Peat SoilMTTKNLDPSLPVINEQKDAPDPRGGACIEFVKFCKEQHLNSRAAHTFLRLLHNKPWDHECEKIRESMRPEVDHMFEPAEKALAEGKNCREVLDLLMQALKKAEDL
Ga0371489_0018077_586_9033300033755Peat SoilMTTKLEPKPADPEGQSKPPELQRGACLEFVKFCKEQHLNSRAAHTFLHVLHNQSWEKECETIREAMRPEVDRIFAPIEKALQEGANCREVLALLVDRLNKAENLK
Ga0370483_0000004_15425_157513300034124Untreated Peat SoilMTTTTLAPKAAVADEQKLPVQQPLRGACVEFVEFCKEQHLNSRAAHTFLHVLHNKTWEAECDTIRESMRPEVDRIFEPAEKALQAGANCKEVLAVLVRSLKAEEKQDL
Ga0370514_060500_160_4773300034199Untreated Peat SoilMTTIDLAPPAVVIEENKPVLEPQRGACVEFVKFCKEQHLSSRAAHTFLRVLHNKPWEAECETIRESMRPEIDRMFEPAEKALNEGRNCHEVLDLLVRTLKENENM
Ga0370492_0012398_2573_28963300034282Untreated Peat SoilMTTMTPAPTAVVLDEQKSPACEPQRGACVEFVKFCKEQHLNSRAAHTFLHVLHNKSWEAECDKIRESMRPEVDRIFGPAEKALNEGLNCKDALKTLIRSLEEAEYLK
Ga0370492_0159184_90_4103300034282Untreated Peat SoilMTTKTPNTTAVTPEGQKLSILEPQRGACVEFVEFCKEQHLRSRAAHTFLRVLHNKTWNAECDQIRESMRPEVDRIFEPAEKALREGANCKEVLALLVSSLKKAEDL
Ga0370492_0354682_281_5953300034282Untreated Peat SoilSKTPDNAAAVPEGQKLPVIDTQRGACVEFVKFCKEQHLNSRAANTFLRVLHNKTWEAECHTIRDSMRPEVDRIFEPAEKALQEGANCKQVLAVLVRSLKEAENL

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.