Metagenome / Metatranscriptome Family F081469

Basic Information
Family ID	F081469
Family Type	Metagenome / Metatranscriptome
Number of Sequences	114
Average Sequence Length	38 residues
Representative Sequence	MGLKGDKSGEMSVSNALTALTKSNQVRREGGKYRAAA
Number of Associated Samples	90
Number of Associated Scaffolds	114

Quality Assessment
Transcriptomic Evidence	Yes
Most common taxonomic group	Bacteria
% of genes with valid RBS motifs	19.30 %
% of genes near scaffold ends (potentially truncated)	67.54 %
% of genes from short scaffolds (< 2000 bps)	93.86 %
Associated GOLD sequencing projects	85
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.40

Most Common Taxonomy
Group	Bacteria (63.158 % of family members)
NCBI Taxonomy ID	2
Taxonomy	All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (14.912 % of family members)
Environment Ontology (ENVO)	Unclassified (36.842 % of family members)
Earth Microbiome Project Ontology (EMPO)	Host-associated → Plant → Plant rhizosphere (57.895 % of family members)

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 15.38% β-sheet: 12.31% Coil/Unstructured: 72.31%
Feature Viewer

Powered by Feature Viewer

Pfam ID	Name	% Frequency in 114 Family Scaffolds
PF08447	PAS_3	4.39
PF12728	HTH_17	3.51
PF13975	gag-asp_proteas	3.51
PF01695	IstB_IS21	2.63
PF13650	Asp_protease_2	2.63
PF02805	Ada_Zn_binding	0.88
PF00501	AMP-binding	0.88
PF04536	TPM_phosphatase	0.88
PF13410	GST_C_2	0.88
PF02775	TPP_enzyme_C	0.88
PF10609	ParA	0.88
PF05598	DUF772	0.88
PF13545	HTH_Crp_2	0.88
PF05406	WGR	0.88
PF00211	Guanylate_cyc	0.88
PF00378	ECH_1	0.88
PF02668	TauD	0.88
PF03328	HpcH_HpaI	0.88
PF00313	CSD	0.88
PF00239	Resolvase	0.88
PF08448	PAS_4	0.88
PF05930	Phage_AlpA	0.88
PF04909	Amidohydro_2	0.88
PF01255	Prenyltransf	0.88
PF13417	GST_N_3	0.88
PF07883	Cupin_2	0.88
PF13827	DUF4189	0.88
PF01527	HTH_Tnp_1	0.88
PF00950	ABC-3	0.88
PF12833	HTH_18	0.88

COG ID	Name	Functional Category	% Frequency in 114 Family Scaffolds
COG1484	DNA replication protein DnaC	Replication, recombination and repair [L]	2.63
COG0020	Undecaprenyl pyrophosphate synthase	Lipid transport and metabolism [I]	0.88
COG0469	Pyruvate kinase	Carbohydrate transport and metabolism [G]	0.88
COG0609	ABC-type Fe3+-siderophore transport system, permease component	Inorganic ion transport and metabolism [P]	0.88
COG1108	ABC-type Mn2+/Zn2+ transport system, permease component	Inorganic ion transport and metabolism [P]	0.88
COG1961	Site-specific DNA recombinase SpoIVCA/DNA invertase PinE	Replication, recombination and repair [L]	0.88
COG2114	Adenylate cyclase, class 3	Signal transduction mechanisms [T]	0.88
COG2169	Methylphosphotriester-DNA--protein-cysteine methyltransferase (N-terminal fragment of Ada), contains Zn-binding and two AraC-type DNA-binding domains	Replication, recombination and repair [L]	0.88
COG2175	Taurine dioxygenase, alpha-ketoglutarate-dependent	Secondary metabolites biosynthesis, transport and catabolism [Q]	0.88
COG2301	Citrate lyase beta subunit	Carbohydrate transport and metabolism [G]	0.88
COG2452	Predicted site-specific integrase-resolvase	Mobilome: prophages, transposons [X]	0.88
COG3311	DNA-binding transcriptional regulator AlpA	Transcription [K]	0.88
COG3831	WGR domain, predicted DNA-binding domain in MolR	Transcription [K]	0.88
COG3836	2-keto-3-deoxy-L-rhamnonate aldolase RhmA	Carbohydrate transport and metabolism [G]	0.88
COG4606	ABC-type enterochelin transport system, permease component	Inorganic ion transport and metabolism [P]	0.88

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	63.16 %
Unclassified	root	N/A	36.84 %

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	63.16 %
Unclassified	root	N/A	36.84 %

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	63.16 %
Unclassified	root	N/A	36.84 %

Name	Rank	Taxonomy	Distribution
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	53.51 %
Unclassified	root	N/A	36.84 %
Terrabacteria group	clade	All Organisms → cellular organisms → Bacteria → Terrabacteria group	0.88 %
Bacteria incertae sedis	no rank	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis	0.88 %
Acidobacteria	phylum	All Organisms → cellular organisms → Bacteria → Acidobacteria	0.88 %

Name	Rank	Taxonomy	Distribution
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	46.49 %
Unclassified	root	N/A	36.84 %
unclassified Acidobacteria	no rank	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria	0.88 %
Bacteria candidate phyla	clade	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla	0.88 %
delta/epsilon subdivisions	subphylum	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions	0.88 %
Actinobacteria	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	0.88 %

Name	Rank	Taxonomy	Distribution
unclassified Alphaproteobacteria	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria	38.60 %
Unclassified	root	N/A	36.84 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	4.39 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	0.88 %
Candidatus Rokubacteria	phylum	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria	0.88 %
Rhodospirillales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales	0.88 %
Actinomycetia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	0.88 %
Deltaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	0.88 %

Name	Rank	Taxonomy	Distribution
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	38.60 %
Unclassified	root	N/A	36.84 %
Methylobacteriaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae	1.75 %
Myxococcales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales	0.88 %
Acetobacteraceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae	0.88 %
Propionibacteriales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales	0.88 %
unclassified Candidatus Rokubacteria	no rank	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria	0.88 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	0.88 %

Name	Rank	Taxonomy	Distribution
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	38.60 %
Unclassified	root	N/A	36.84 %
Microvirga	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Microvirga	1.75 %
Candidatus Rokubacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	0.88 %
Nannocystineae	suborder	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Nannocystineae	0.88 %
Acidisphaera	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Acidisphaera	0.88 %
Propionibacteriales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales	0.88 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	0.88 %

Name	Rank	Taxonomy	Distribution
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	38.60 %
Unclassified	root	N/A	36.84 %
Microvirga	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Microvirga	1.75 %
unclassified Acidisphaera	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Acidisphaera → unclassified Acidisphaera	0.88 %
Kofleriaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Nannocystineae → Kofleriaceae	0.88 %
Candidatus Rokubacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	0.88 %
Propionibacteriales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales	0.88 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	0.88 %

Name	Rank	Taxonomy	Distribution
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	38.60 %
Unclassified	root	N/A	36.84 %
Microvirga	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Microvirga	1.75 %
Acidisphaera sp. S103	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Acidisphaera → unclassified Acidisphaera → Acidisphaera sp. S103	0.88 %
Haliangium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Nannocystineae → Kofleriaceae → Haliangium	0.88 %
Candidatus Rokubacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	0.88 %
Propionibacteriales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales	0.88 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	0.88 %

Name	Rank	Taxonomy	Distribution
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	38.60 %
Unclassified	root	N/A	36.84 %
Microvirga	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Microvirga	1.75 %
unclassified Haliangium	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Nannocystineae → Kofleriaceae → Haliangium → unclassified Haliangium	0.88 %
Acidisphaera sp. S103	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Acidisphaera → unclassified Acidisphaera → Acidisphaera sp. S103	0.88 %
Candidatus Rokubacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	0.88 %
Propionibacteriales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales	0.88 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	0.88 %

Name	Rank	Taxonomy	Distribution
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	38.60 %
Unclassified	root	N/A	36.84 %
Microvirga	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Microvirga	1.75 %
Haliangium sp. UPWRP_2	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Nannocystineae → Kofleriaceae → Haliangium → unclassified Haliangium → Haliangium sp. UPWRP_2	0.88 %
Acidisphaera sp. S103	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Acidisphaera → unclassified Acidisphaera → Acidisphaera sp. S103	0.88 %
Candidatus Rokubacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	0.88 %
Propionibacteriales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales	0.88 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	0.88 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
3300004081\|Ga0063454_101007372	Not Available	671	Open in IMG/M
3300004153\|Ga0063455_100848783	All Organisms → cellular organisms → Bacteria → Proteobacteria	640	Open in IMG/M
3300004153\|Ga0063455_101708487	All Organisms → cellular organisms → Bacteria	500	Open in IMG/M
3300004643\|Ga0062591_102688492	Not Available	526	Open in IMG/M
3300004803\|Ga0058862_10642029	Not Available	529	Open in IMG/M
3300005175\|Ga0066673_10315262	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	912	Open in IMG/M
3300005179\|Ga0066684_10392386	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	931	Open in IMG/M
3300005329\|Ga0070683_101110756	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Microvirga	759	Open in IMG/M
3300005335\|Ga0070666_10218966	Not Available	1342	Open in IMG/M
3300005353\|Ga0070669_101378864	Not Available	611	Open in IMG/M
3300005458\|Ga0070681_10852823	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	829	Open in IMG/M
3300005471\|Ga0070698_101065669	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	756	Open in IMG/M
3300005541\|Ga0070733_10331416	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1008	Open in IMG/M
3300005569\|Ga0066705_10465602	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	792	Open in IMG/M
3300005617\|Ga0068859_101728116	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	691	Open in IMG/M
3300005618\|Ga0068864_100810395	All Organisms → cellular organisms → Bacteria	921	Open in IMG/M
3300005618\|Ga0068864_101609932	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	653	Open in IMG/M
3300005841\|Ga0068863_101683500	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	644	Open in IMG/M
3300006031\|Ga0066651_10347813	All Organisms → cellular organisms → Bacteria → Proteobacteria	795	Open in IMG/M
3300006237\|Ga0097621_101640183	All Organisms → cellular organisms → Bacteria	612	Open in IMG/M
3300006804\|Ga0079221_11709662	Not Available	513	Open in IMG/M
3300006893\|Ga0073928_10048608	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	3848	Open in IMG/M
3300006914\|Ga0075436_100568194	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	834	Open in IMG/M
3300009090\|Ga0099827_10348759	All Organisms → cellular organisms → Bacteria	1259	Open in IMG/M
3300009090\|Ga0099827_10689874	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	882	Open in IMG/M
3300009090\|Ga0099827_11391415	Not Available	611	Open in IMG/M
3300009100\|Ga0075418_10294012	All Organisms → cellular organisms → Bacteria	1731	Open in IMG/M
3300009143\|Ga0099792_10397985	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	842	Open in IMG/M
3300009143\|Ga0099792_11187156	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	517	Open in IMG/M
3300009148\|Ga0105243_11062340	Not Available	816	Open in IMG/M
3300009551\|Ga0105238_12906553	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	515	Open in IMG/M
3300009553\|Ga0105249_12251056	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	618	Open in IMG/M
3300009789\|Ga0126307_11183697	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	619	Open in IMG/M
3300009789\|Ga0126307_11410333	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	564	Open in IMG/M
3300010037\|Ga0126304_11167711	Not Available	527	Open in IMG/M
3300010040\|Ga0126308_11103225	Not Available	559	Open in IMG/M
3300010166\|Ga0126306_10212012	Not Available	1466	Open in IMG/M
3300010371\|Ga0134125_11832666	Not Available	660	Open in IMG/M
3300010379\|Ga0136449_103779825	Not Available	570	Open in IMG/M
3300012199\|Ga0137383_10291189	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1196	Open in IMG/M
3300012200\|Ga0137382_11106612	Not Available	566	Open in IMG/M
3300012206\|Ga0137380_10504215	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1066	Open in IMG/M
3300012212\|Ga0150985_100511335	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	694	Open in IMG/M
3300012212\|Ga0150985_101810399	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	919	Open in IMG/M
3300012212\|Ga0150985_103957336	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	502	Open in IMG/M
3300012212\|Ga0150985_111124678	Not Available	526	Open in IMG/M
3300012212\|Ga0150985_116650232	Not Available	500	Open in IMG/M
3300012212\|Ga0150985_117654261	All Organisms → cellular organisms → Bacteria	684	Open in IMG/M
3300012212\|Ga0150985_120895695	Not Available	500	Open in IMG/M
3300012212\|Ga0150985_122560003	Not Available	689	Open in IMG/M
3300012350\|Ga0137372_10582073	Not Available	823	Open in IMG/M
3300012350\|Ga0137372_11189706	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	516	Open in IMG/M
3300012362\|Ga0137361_11397372	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	623	Open in IMG/M
3300012363\|Ga0137390_10010983	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	8031	Open in IMG/M
3300012469\|Ga0150984_105130171	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	661	Open in IMG/M
3300012469\|Ga0150984_108900209	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	761	Open in IMG/M
3300012469\|Ga0150984_117138394	Not Available	614	Open in IMG/M
3300012469\|Ga0150984_122849791	Not Available	528	Open in IMG/M
3300012915\|Ga0157302_10004597	All Organisms → cellular organisms → Bacteria → Proteobacteria	3123	Open in IMG/M
3300012917\|Ga0137395_10905325	Not Available	637	Open in IMG/M
3300012917\|Ga0137395_11223896	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	524	Open in IMG/M
3300012937\|Ga0162653_100023481	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales	848	Open in IMG/M
3300012957\|Ga0164303_10722622	Not Available	674	Open in IMG/M
3300012957\|Ga0164303_11424122	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	519	Open in IMG/M
3300012984\|Ga0164309_11311801	All Organisms → cellular organisms → Bacteria → Proteobacteria	613	Open in IMG/M
3300012986\|Ga0164304_10768301	Not Available	740	Open in IMG/M
3300013306\|Ga0163162_12577242	Not Available	585	Open in IMG/M
3300013503\|Ga0120127_10188130	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	508	Open in IMG/M
3300013764\|Ga0120111_1060575	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	931	Open in IMG/M
3300014150\|Ga0134081_10052486	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1220	Open in IMG/M
3300014497\|Ga0182008_10546700	Not Available	643	Open in IMG/M
3300014968\|Ga0157379_10258508	Not Available	1582	Open in IMG/M
3300014969\|Ga0157376_12082566	Not Available	606	Open in IMG/M
3300015374\|Ga0132255_105086333	Not Available	557	Open in IMG/M
3300017792\|Ga0163161_10643062	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	878	Open in IMG/M
3300018468\|Ga0066662_10795434	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	917	Open in IMG/M
3300019356\|Ga0173481_10477214	Not Available	630	Open in IMG/M
3300019361\|Ga0173482_10627624	Not Available	544	Open in IMG/M
3300019888\|Ga0193751_1056311	Not Available	1667	Open in IMG/M
3300019888\|Ga0193751_1175616	Not Available	743	Open in IMG/M
3300022557\|Ga0212123_10096162	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	2435	Open in IMG/M
3300022557\|Ga0212123_10496661	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	793	Open in IMG/M
3300022557\|Ga0212123_10726683	Not Available	607	Open in IMG/M
3300024310\|Ga0247681_1025131	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	869	Open in IMG/M
3300025903\|Ga0207680_10840406	All Organisms → cellular organisms → Bacteria → Proteobacteria	658	Open in IMG/M
3300025903\|Ga0207680_11165514	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	550	Open in IMG/M
3300025917\|Ga0207660_10280844	All Organisms → cellular organisms → Bacteria	1321	Open in IMG/M
3300025918\|Ga0207662_11029768	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	585	Open in IMG/M
3300025925\|Ga0207650_10330042	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Microvirga	1251	Open in IMG/M
3300025930\|Ga0207701_10157403	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Acidisphaera → unclassified Acidisphaera → Acidisphaera sp. S103	2011	Open in IMG/M
3300025930\|Ga0207701_10935627	Not Available	724	Open in IMG/M
3300025936\|Ga0207670_11166729	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	651	Open in IMG/M
3300025972\|Ga0207668_10944748	All Organisms → cellular organisms → Bacteria → Proteobacteria	769	Open in IMG/M
3300026023\|Ga0207677_12256214	Not Available	507	Open in IMG/M
3300026075\|Ga0207708_11735556	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	548	Open in IMG/M
3300026078\|Ga0207702_10281251	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Nannocystineae → Kofleriaceae → Haliangium → unclassified Haliangium → Haliangium sp. UPWRP_2	1573	Open in IMG/M
3300026095\|Ga0207676_10057379	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	3065	Open in IMG/M
3300026118\|Ga0207675_102535809	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	523	Open in IMG/M
3300026316\|Ga0209155_1284374	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	513	Open in IMG/M
3300026527\|Ga0209059_1012900	All Organisms → cellular organisms → Bacteria	3781	Open in IMG/M
3300026557\|Ga0179587_11193647	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	501	Open in IMG/M
3300027787\|Ga0209074_10468908	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	541	Open in IMG/M
3300027867\|Ga0209167_10239973	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	971	Open in IMG/M
3300027875\|Ga0209283_10734879	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	613	Open in IMG/M
3300027882\|Ga0209590_10565169	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	733	Open in IMG/M
3300028379\|Ga0268266_11170606	Not Available	744	Open in IMG/M
3300028592\|Ga0247822_11930534	Not Available	506	Open in IMG/M
3300030986\|Ga0308154_109816	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	618	Open in IMG/M
3300031122\|Ga0170822_17048829	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	666	Open in IMG/M
3300031671\|Ga0307372_10166209	Not Available	1511	Open in IMG/M
3300031672\|Ga0307373_10181303	All Organisms → cellular organisms → Bacteria → Proteobacteria	1555	Open in IMG/M
3300031708\|Ga0310686_109937961	Not Available	565	Open in IMG/M
3300032515\|Ga0348332_14462296	Not Available	876	Open in IMG/M
3300034678\|Ga0314803_136157	Not Available	511	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	64.91%
Host-Associated	Host-Associated	35.09%

Habitat	Taxonomy	Distribution
Terrestrial	Environmental → Terrestrial	61.40%
Plants	Host-Associated → Plants	34.21%
Aquatic	Environmental → Aquatic	3.51%
Human	Host-Associated → Human	0.88%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	59.65%
Rhizoplane	Host-Associated → Plants → Rhizoplane	16.67%
Rhizosphere	Host-Associated → Plants → Rhizosphere	16.67%
Thermal Springs	Environmental → Aquatic → Thermal Springs	3.51%
Plant Litter	Environmental → Terrestrial → Plant Litter	0.88%
Agricultural Field	Environmental → Terrestrial → Agricultural Field	0.88%
Digestive System	Host-Associated → Human → Digestive System	0.88%
Roots	Host-Associated → Plants → Roots	0.88%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	47.37%
Loam	Environmental → Terrestrial → Soil → Loam	10.53%
Soil	Host-Associated → Plants → Rhizosphere → Soil	9.65%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	8.77%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified	7.89%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	7.02%
Hot (42-90C)	Environmental → Aquatic → Thermal Springs → Hot (42-90C)	3.51%
Clay	Environmental → Terrestrial → Soil → Clay	1.75%
Unclassified	Environmental → Terrestrial → Plant Litter → Unclassified	0.88%
Unclassified	Environmental → Terrestrial → Agricultural Field → Unclassified	0.88%
Large Intestine	Host-Associated → Human → Digestive System → Large Intestine	0.88%
Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere	0.88%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	33.33%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	9.65%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	8.77%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified	7.89%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	7.02%
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	6.14%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	6.14%
Grasslands	Environmental → Terrestrial → Soil → Loam → Grasslands	4.39%
Acidic	Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic	3.51%
Agricultural Land	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land	2.63%
Permafrost	Environmental → Terrestrial → Soil → Unclassified → Permafrost	1.75%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	1.75%
Agricultural	Environmental → Terrestrial → Soil → Unclassified → Agricultural	1.75%
Unclassified	Environmental → Terrestrial → Soil → Clay → Unclassified	1.75%
Unclassified	Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified	0.88%
Unclassified	Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified	0.88%
Fecal	Host-Associated → Human → Digestive System → Large Intestine → Fecal	0.88%
Soil	Host-Associated → Plants → Roots → Rhizosphere → Soil	0.88%

Habitat	Taxonomy	Distribution
Vadose Zone Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil	14.91%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	9.65%
Avena Fatua Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere	7.02%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere	6.14%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	5.26%
Serpentine Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil	4.39%
Soil	Environmental → Terrestrial → Soil → Loam → Grasslands → Soil	4.39%
Iron-Sulfur Acid Spring	Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring	3.51%
Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil	3.51%
Avena Fatua Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere	3.51%
Corn Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere	2.63%
Surface Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil	1.75%
Agricultural Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil	1.75%
Permafrost	Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost	1.75%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere	1.75%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil	1.75%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	1.75%
Switchgrass Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere	1.75%
Soil	Environmental → Terrestrial → Soil → Clay → Unclassified → Soil	1.75%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	1.75%
Populus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere	1.75%
Terrestrial Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil	0.88%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil	0.88%
Peatlands Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil	0.88%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil	0.88%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil	0.88%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	0.88%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil	0.88%
Plant Litter	Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter	0.88%
Soil	Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil	0.88%
Host-Associated	Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated	0.88%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere	0.88%
Corn Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere	0.88%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere	0.88%
Miscanthus Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere	0.88%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	0.88%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	0.88%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere	0.88%
Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere	0.88%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	0.88%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	0.88%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300004081	Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2)	Environmental	Open in IMG/M
3300004153	Grasslands soil microbial communities from Hopland, California, USA (version 2)	Environmental	Open in IMG/M
3300004643	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3	Environmental	Open in IMG/M
3300004803	Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300005175	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122	Environmental	Open in IMG/M
3300005179	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133	Environmental	Open in IMG/M
3300005329	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG	Environmental	Open in IMG/M
3300005335	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG	Host-Associated	Open in IMG/M
3300005353	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG	Host-Associated	Open in IMG/M
3300005458	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG	Environmental	Open in IMG/M
3300005471	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG	Environmental	Open in IMG/M
3300005541	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1	Environmental	Open in IMG/M
3300005569	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154	Environmental	Open in IMG/M
3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Host-Associated	Open in IMG/M
3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Host-Associated	Open in IMG/M
3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Host-Associated	Open in IMG/M
3300006031	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100	Environmental	Open in IMG/M
3300006237	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2)	Host-Associated	Open in IMG/M
3300006804	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200	Environmental	Open in IMG/M
3300006893	Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG	Environmental	Open in IMG/M
3300006914	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5	Host-Associated	Open in IMG/M
3300009090	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG	Environmental	Open in IMG/M
3300009100	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2	Host-Associated	Open in IMG/M
3300009143	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2	Environmental	Open in IMG/M
3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Host-Associated	Open in IMG/M
3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Host-Associated	Open in IMG/M
3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Host-Associated	Open in IMG/M
3300009789	Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28	Environmental	Open in IMG/M
3300010037	Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot25	Environmental	Open in IMG/M
3300010040	Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55	Environmental	Open in IMG/M
3300010166	Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27	Environmental	Open in IMG/M
3300010371	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1	Environmental	Open in IMG/M
3300010379	Sb_50d combined assembly	Environmental	Open in IMG/M
3300012199	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG	Environmental	Open in IMG/M
3300012200	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG	Environmental	Open in IMG/M
3300012206	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG	Environmental	Open in IMG/M
3300012212	Combined assembly of Hopland grassland soil	Host-Associated	Open in IMG/M
3300012350	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG	Environmental	Open in IMG/M
3300012362	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG	Environmental	Open in IMG/M
3300012363	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG	Environmental	Open in IMG/M
3300012469	Combined assembly of Soil carbon rhizosphere	Host-Associated	Open in IMG/M
3300012915	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S103-311B-2	Environmental	Open in IMG/M
3300012917	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG	Environmental	Open in IMG/M
3300012937	Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t5i015	Environmental	Open in IMG/M
3300012957	Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG	Environmental	Open in IMG/M
3300012984	Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG	Environmental	Open in IMG/M
3300012986	Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG	Environmental	Open in IMG/M
3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Host-Associated	Open in IMG/M
3300013503	Permafrost microbial communities from Nunavut, Canada - A23_5cm_12M	Environmental	Open in IMG/M
3300013764	Permafrost microbial communities from Nunavut, Canada - A28_35cm_6M	Environmental	Open in IMG/M
3300014150	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_5_24_1 metaG	Environmental	Open in IMG/M
3300014497	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG	Host-Associated	Open in IMG/M
3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Host-Associated	Open in IMG/M
3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Host-Associated	Open in IMG/M
3300015374	Col-0 rhizosphere combined assembly	Host-Associated	Open in IMG/M
3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Host-Associated	Open in IMG/M
3300018468	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111	Environmental	Open in IMG/M
3300019356	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2)	Environmental	Open in IMG/M
3300019361	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2)	Environmental	Open in IMG/M
3300019888	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1c2	Environmental	Open in IMG/M
3300022557	Paint Pots_combined assembly	Environmental	Open in IMG/M
3300024310	Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK22	Environmental	Open in IMG/M
3300025903	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025917	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes)	Environmental	Open in IMG/M
3300025918	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes)	Environmental	Open in IMG/M
3300025925	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025930	Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes)	Environmental	Open in IMG/M
3300025936	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes)	Environmental	Open in IMG/M
3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026075	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes)	Environmental	Open in IMG/M
3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026316	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 (SPAdes)	Environmental	Open in IMG/M
3300026527	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 (SPAdes)	Environmental	Open in IMG/M
3300026557	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal	Environmental	Open in IMG/M
3300027787	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes)	Environmental	Open in IMG/M
3300027867	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes)	Environmental	Open in IMG/M
3300027875	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes)	Environmental	Open in IMG/M
3300027882	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes)	Environmental	Open in IMG/M
3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300028592	Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Cellulose_Day30	Environmental	Open in IMG/M
3300030986	Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_143 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300031122	Oak Spring Coassembly Site 11 - Champenoux / Amance forest	Environmental	Open in IMG/M
3300031671	Soil microbial communities from Risofladan, Vaasa, Finland - OX-1	Environmental	Open in IMG/M
3300031672	Soil microbial communities from Risofladan, Vaasa, Finland - OX-2	Environmental	Open in IMG/M
3300031708	FICUS49499 Metagenome Czech Republic combined assembly	Environmental	Open in IMG/M
3300032515	FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data)	Environmental	Open in IMG/M
3300034678	Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48R4 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.40
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.40
Powered by PDBe Molstar

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome / Metatranscriptome Family F081469

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
Ga0063454_1010073722	3300004081	Soil	LERMGLKGDKQGEMSVSNALTALAKRNQIRREGGKYYPGSQG*
Ga0063455_1008487831	3300004153	Soil	EILERMGLKGDKSGEMSVSNALTTLTKSNQVHREGGKYRATK*
Ga0063455_1017084871	3300004153	Soil	MGLKGDKAGEMSVSNALTALTKRNQVRREGGQILSGLPRCW*
Ga0062591_1026884921	3300004643	Soil	GEILERMGLKGDKSGEMSVSNALTALTKRNEVRRDGGKYHSA*
Ga0058862_106420292	3300004803	Host-Associated	AKMDLKGNKAGEMSVSNALTALTKAGVVVRRDGKYIGGVG*
Ga0066673_103152622	3300005175	Soil	ILDKMGLKGNKTGEMSVSNALTALTKSKQVIRRDRKYIAS*
Ga0066684_103923862	3300005179	Soil	RGEILDKMGLKGNKTGEMSVSNALTALTKSKQVIRRDRKYIAS*
Ga0070683_1011107561	3300005329	Corn Rhizosphere	GEILERMGLKGDKSGEMSVSNALSALTKRNQLSRTGGKYRAA*
Ga0070666_102189663	3300005335	Switchgrass Rhizosphere	LAKMGLKGDKAGEMSVSNALTALSKSNQVRREGGKYHVAA*
Ga0070669_1013788641	3300005353	Switchgrass Rhizosphere	GELLQSLGLKGDKSGEMSVSNALSALTKSNQVRRGGGKYHAV*
Ga0070681_108528232	3300005458	Corn Rhizosphere	LEKMGLKGDKAGEMSVSNALTALGKSNQVRREGGKYHIAA*
Ga0070698_1010656693	3300005471	Corn, Switchgrass And Miscanthus Rhizosphere	TRGEILDKMGLKGNKAGEMSVSNALTALTKSKQVARKDRKYVAA*
Ga0070733_103314162	3300005541	Surface Soil	MGLKGNKTGEMSVSNALTALTKGNQISRRDGKYHAS*
Ga0066705_104656021	3300005569	Soil	EILEKMGLKGNKAGEMSVSNALTALTKSKQVARRDRKYVAG*
Ga0068859_1017281162	3300005617	Switchgrass Rhizosphere	KMGLKGNKSGEMSVSNALTALTKAMHVRREGGKYHSA*
Ga0068864_1008103953	3300005618	Switchgrass Rhizosphere	MGLKGDKSGEMSVSNALTALTKSNQVRREDGKYRAAM*
Ga0068864_1016099322	3300005618	Switchgrass Rhizosphere	MGLKGDKSGEMSVSNALTALTKNNQVQRDGGKYRATT*
Ga0068863_1016835002	3300005841	Switchgrass Rhizosphere	MGLKGDKSGEMSVSNALTALTKSNQVRREDGKYRAAT*
Ga0066651_103478131	3300006031	Soil	LKGNKSGEMSVSNALTALTKNNQVRRDGRKYLAA*
Ga0097621_1016401831	3300006237	Miscanthus Rhizosphere	EILERMGLKGDKSSEMSVSNALTALTKRNQVSRIGGKYRAA*
Ga0079221_117096622	3300006804	Agricultural Soil	GEILERMGLKGDKSGEMSVSNALTALTKSNQVHREGGKYRAAM*
Ga0073928_100486083	3300006893	Iron-Sulfur Acid Spring	MRLKGNKAGEMSVSNALTALTKGNQVVRADGRYRVA*
Ga0075436_1005681943	3300006914	Populus Rhizosphere	GLKGNKAGEMSVSNALTALTKTNQVTRKDGKYAAA*
Ga0099827_103487591	3300009090	Vadose Zone Soil	RGEIFQRMGLKGDKSGEMSVSNALTALTKANQVIRRDGPYSAA*
Ga0099827_106898742	3300009090	Vadose Zone Soil	MGLKGDKSGEMSVSNALTALTKANQVIRRDGRYSAA*
Ga0099827_113914151	3300009090	Vadose Zone Soil	LKGNKTGEMSVSNALTALTKGNQVARRDGKYVTA*
Ga0075418_102940123	3300009100	Populus Rhizosphere	MGLKGDKSGEMAVSNALTALFKGGQVRREGGKYHAA*
Ga0099792_103979852	3300009143	Vadose Zone Soil	LKGDKSGEMSVSNALTALTKANEVTRRDGRYITA*
Ga0099792_111871561	3300009143	Vadose Zone Soil	RGQILEKMGLKGNKAGEMSVSNALTALTKGNQVRREGRSYHSA*
Ga0105243_110623402	3300009148	Miscanthus Rhizosphere	MGLKGDKSREMSVSNALTALTKRNQVSRIGGKYRAA*
Ga0105238_129065531	3300009551	Corn Rhizosphere	SRREILDKMRLKGNKSGEMSVSNALTALTKAMHVRREGGKYHSA*
Ga0105249_122510561	3300009553	Switchgrass Rhizosphere	MGLKGDKSSEMSVSNALTALTKRNQVSRIGGKYRAA*
Ga0126307_111836972	3300009789	Serpentine Soil	MGLKGNKSGEMSVSNALTALTKSNQVRRNEERKYVAA*
Ga0126307_114103331	3300009789	Serpentine Soil	MGLKGNKSGEMSVSNALTALTKSNQLRRNEERKYVAA*
Ga0126304_111677112	3300010037	Serpentine Soil	ILERMGLKGDKSGEMSVSNALTALTKSNQVSRSGGKYRGA*
Ga0126308_111032252	3300010040	Serpentine Soil	KGDKSGEMSVSNALTALTKRNEVRREGGRYLPAS*
Ga0126306_102120121	3300010166	Serpentine Soil	LKGDKSGEMSVSNALTALTKSNQVSRSGGKYRGA*
Ga0134125_118326663	3300010371	Terrestrial Soil	ERMGLKGDKSGEMSVSNALTALTKRNQVRREGGKYHPAS*
Ga0136449_1037798251	3300010379	Peatlands Soil	MGLKGDRLAEKSVSNALTALTKSNQVSRREGKYVIDG*
Ga0137383_102911891	3300012199	Vadose Zone Soil	MGLKGNKTGEMSVSNALTALTKSKQVIRRDRKYIAS*
Ga0137382_111066123	3300012200	Vadose Zone Soil	LKGNKSGEMSVSNALTALTKGKQVARKDRKYVAA*
Ga0137380_105042151	3300012206	Vadose Zone Soil	ILEKMGLKGNKLGEMSVSNALTALTKGNQVRREGGKYLSS*
Ga0150985_1005113352	3300012212	Avena Fatua Rhizosphere	MGLKGDKSSEMSVSNALTALTKSNQVHREGGKYRAAT*
Ga0150985_1018103991	3300012212	Avena Fatua Rhizosphere	RMGLKGNKSGEMSVSNALTALTKTNQVSRHEGRYIAQGG*
Ga0150985_1039573361	3300012212	Avena Fatua Rhizosphere	MGLKGNKAGEMSVSNALTALTKTNQIARRDRKYVVG*
Ga0150985_1111246781	3300012212	Avena Fatua Rhizosphere	GEILERMGLKGDKSGEMSVSNALTALTKRNQVRREGGKYLPAG*
Ga0150985_1166502321	3300012212	Avena Fatua Rhizosphere	LERMGLKGDKSGEMSVSNALTALTKRNQVRRDGGKYHPAS*
Ga0150985_1176542612	3300012212	Avena Fatua Rhizosphere	MGLKGDKSGEMSVSNALTALTKRNQVRRDGGRYHPAS*
Ga0150985_1208956952	3300012212	Avena Fatua Rhizosphere	EILTKMGLKGDKAGEMAISNALTALTKNNQIRRDGGKYHAG*
Ga0150985_1225600033	3300012212	Avena Fatua Rhizosphere	LKGDKSGEMSVSNALTALTKSNQVFRDGGKYRAAM*
Ga0137372_105820733	3300012350	Vadose Zone Soil	GLKGNKTGEMSVSNALTALTKGNQVARRDGKYVAA*
Ga0137372_111897062	3300012350	Vadose Zone Soil	GLKGNKSDEMSVSNALTALTKANHVQRNSDRKYVVA*
Ga0137361_113973722	3300012362	Vadose Zone Soil	MGLKGNKAGEMSVSNALTALTKSNQVSRHEGKYRASA*
Ga0137390_100109838	3300012363	Vadose Zone Soil	GLKGNKTGEMSVSNALTALTKAGQVHRQDGKYRSA*
Ga0150984_1051301711	3300012469	Avena Fatua Rhizosphere	MGLKGDKSGEMSVSNALTALTKSNQVRREDGKYRAAA*
Ga0150984_1089002091	3300012469	Avena Fatua Rhizosphere	MGLKGDKSGEMSVSNALTALTKSNQVHRDGGKYRIADGDG
Ga0150984_1171383941	3300012469	Avena Fatua Rhizosphere	LSRGEILERMGLKGDKSGEMSVSNALTALTKRNEVRREGGKYLPA*
Ga0150984_1228497911	3300012469	Avena Fatua Rhizosphere	RGEILERMGLKGDKSGEMSVSNALTALTKANQVNRRDGKYIAA*
Ga0157302_100045971	3300012915	Soil	MGLKGDKAGEMSVSNALTALTKSNQVQREGGKYRAAT*
Ga0137395_109053251	3300012917	Vadose Zone Soil	EILDNMGLEGNKAGEMSVSNALTALTKSKQVALNDRKYMAA*
Ga0137395_112238961	3300012917	Vadose Zone Soil	ILEEMGLKGNKSGEMSVSNALTALTKSQQVTRREGKYVIA*
Ga0162653_1000234813	3300012937	Soil	QKMGLKGDKAGEMSVSNALTALSKSNQVRREGGKYHLAP*
Ga0164303_107226222	3300012957	Soil	LERMGLKGDKSGETSVSNALTALTKSNQLRREGGKYRTAA*
Ga0164303_114241222	3300012957	Soil	MGLKGDKSGEMSVSNALTALTKSNQVHREGGKYRAM*
Ga0164309_113118012	3300012984	Soil	GLKGDKSGEMSVSNALTALTKSNQVHREGGKYRAM*
Ga0164304_107683012	3300012986	Soil	MGLKGDKSGEMSVSNALTALTKSNQVRREGGKYRAAA*
Ga0163162_125772422	3300013306	Switchgrass Rhizosphere	MGLKGDKAGEMSVSNALTALSKSNQVRREGGKYHVAA*
Ga0120127_101881302	3300013503	Permafrost	LLDKMGLKGNKSGEMSVSNALTALTKGNQVVRRDGKYVASMG*
Ga0120111_10605751	3300013764	Permafrost	MGLKGNKAGEMSVSNALTALTKGNQVRRDGGKYLAA*
Ga0134081_100524862	3300014150	Grasslands Soil	RGEILDKMGLKGNKSGEMSVSNALTALTKSKQVTRRDRKYVAS*
Ga0182008_105467002	3300014497	Rhizosphere	MGLKGDKSGEMSVSNALTALTKSGQVSRNEGKYTAA*
Ga0157379_102585084	3300014968	Switchgrass Rhizosphere	MGLKGDKSSEMSVSNALTALTKRNQVSRIEGKYRAA*
Ga0157376_120825661	3300014969	Miscanthus Rhizosphere	MGLKGDKAGEMSVSNALTALSKSNQVRREGGKYHLAA*
Ga0132255_1050863331	3300015374	Arabidopsis Rhizosphere	MGLKGDKAGEMSISNALTALTKSNQVRREDGKYHRA*
Ga0163161_106430622	3300017792	Switchgrass Rhizosphere	MGLKGDKSSEMSVSNALTALTKRNQVSRIEGKYRAA
Ga0066662_107954341	3300018468	Grasslands Soil	GLKGNKSGEMSVSNALTALTKSKQVTRRDRKYVAS
Ga0173481_104772142	3300019356	Soil	TRGEILERMELKGDKSSEMSVSNALTALTKRNQVSRIGGKYRAA
Ga0173482_106276242	3300019361	Soil	LLQKMGLKGDKAGEMSVSNALTALSKNNQVRREGGKYHVQA
Ga0193751_10563112	3300019888	Soil	MGLKGDKSGEMSISNALTALIKANQISRRDGKYTSA
Ga0193751_11756162	3300019888	Soil	LLDKMGLKGDKTGEMSVSNALTALTKADQVARHDGKYVSA
Ga0212123_100961622	3300022557	Iron-Sulfur Acid Spring	MGLKGNKSGEMSVSNALTALTKAKEVVRAEGRYRVA
Ga0212123_104966613	3300022557	Iron-Sulfur Acid Spring	MRLKGNKAGEMSVSNALTALTKASQVVRADGRYRAA
Ga0212123_107266832	3300022557	Iron-Sulfur Acid Spring	KMGLKGNKAGEMSVSNALTALTKASQVVRADGRYRAA
Ga0247681_10251311	3300024310	Soil	LEQMGLKGDKSGEMSVSNALTALAKTSQVTRRDGRYVTG
Ga0207680_108404062	3300025903	Switchgrass Rhizosphere	LEKMGLKGDKSGEMSVSNALTALTKTSQVSRHEGRYRSG
Ga0207680_111655142	3300025903	Switchgrass Rhizosphere	MGLKGDKSGEMSVSNALTALTKRNQVRRDGGKYHSA
Ga0207660_102808441	3300025917	Corn Rhizosphere	MGLKGDKSGAMSVSNALTALTKANQVQREGGKYRIAA
Ga0207662_110297682	3300025918	Switchgrass Rhizosphere	MGLKGDKSGEMSVSNALTALTKTSQVSRHEGRYRSG
Ga0207650_103300422	3300025925	Switchgrass Rhizosphere	MGLKGDKSSEMSVSNALTALTKRNQVSRIGGKYRAA
Ga0207701_101574033	3300025930	Corn, Switchgrass And Miscanthus Rhizosphere	MGLKGDKSSEMSVSNALTALTKRNQLSRTGGKYRAA
Ga0207701_109356272	3300025930	Corn, Switchgrass And Miscanthus Rhizosphere	MGLKGDKAGEMSVSNVLTALSKSNQVRRDGGKYHVAA
Ga0207670_111667292	3300025936	Switchgrass Rhizosphere	MGLKGDKSREMSVSNALTALTKRNQVSRIGGKYRAA
Ga0207668_109447482	3300025972	Switchgrass Rhizosphere	GEILDRMGLKGDKSSEMSVSNALTALTKRNQVSRIGGKYRAA
Ga0207677_122562141	3300026023	Miscanthus Rhizosphere	MGLKGDKAGEMSVSNALTALAKGNQVHRDGGKYRMTA
Ga0207708_117355561	3300026075	Corn, Switchgrass And Miscanthus Rhizosphere	MGLKGDKSGEMSVSNALSALTKRNQLSRTGGKYRAA
Ga0207702_102812512	3300026078	Corn Rhizosphere	MGLKGDKSGEMSVSNALSALTKRNQLSRTGGKYRTA
Ga0207676_100573791	3300026095	Switchgrass Rhizosphere	MGLKGDKSGEMSVSNALTALTKNNQVQRDGGKYRATT
Ga0207675_1025358091	3300026118	Switchgrass Rhizosphere	ILERMGLKGDKSGEMSVSNALTALTKRNQVRRDGGKYHSA
Ga0209155_12843742	3300026316	Soil	ILDKMGLKGNKTGEMSVSNALTALTKSKQVIRRDRKYIAS
Ga0209059_10129001	3300026527	Soil	HIKGNKAGETSVSNALTALLKREQIVRRERKYRVE
Ga0179587_111936471	3300026557	Vadose Zone Soil	EILDKMGLKGNKAGEMSVSNALTALTKSKQVSRKDRKYIAA
Ga0209074_104689081	3300027787	Agricultural Soil	MGLKGNKTGEMSVSNALTALTKSKQVIRRDRKYIAS
Ga0209167_102399732	3300027867	Surface Soil	MGLKGNKTGEMSVSNALTALTKGNQISRRDGKYHAS
Ga0209283_107348793	3300027875	Vadose Zone Soil	ILEKMGLKGNKSGEMSVSNALTALTKANQVSRRDGKYHAA
Ga0209590_105651692	3300027882	Vadose Zone Soil	MGLKGDKSGEMSVSNALTALTKANQVIRRDGRYSAA
Ga0268266_111706062	3300028379	Switchgrass Rhizosphere	ILEKMGLKGDKSGEMSVSNALTALTKSNQVRRNAERKYVAA
Ga0247822_119305341	3300028592	Soil	GLKGDKSGEMSVSNALTALTKSNQVRREGGKYRTAM
Ga0308154_1098161	3300030986	Soil	EILERMGLKGDKSGEMSVSNALTALTKSNQVRREDGKYRAAT
Ga0170822_170488291	3300031122	Forest Soil	LEKLRLKGDKSGEMSVSNALTALIKGNQVRRDDRKYVAA
Ga0307372_101662093	3300031671	Soil	MGLKGDKAGEMSVSNALTALTKVNQVMRREGKYVAA
Ga0307373_101813031	3300031672	Soil	IIERMGLKGDKTGEMSVSNALTALIKANQLTRRDGRYIAA
Ga0310686_1099379611	3300031708	Soil	MGLKGDKSGAMSVSNALTALSKANQVVRRDGRYIAHEGMTA
Ga0348332_144622961	3300032515	Plant Litter	KGDKSGAMSVSNALTALSKANQVVRRDGKYIAHEGIAA
Ga0314803_136157_2_118	3300034678	Soil	EKLGLKGDKSGEMSVSNALTALTKGSHIRRDGGKYHAA

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign