Basic Information | |
---|---|
Family ID | F081594 |
Family Type | Metagenome |
Number of Sequences | 114 |
Average Sequence Length | 44 residues |
Representative Sequence | EFRRNLILLKEALTDRTKEEHERQRELVHVQETLMRVMGIRH |
Number of Associated Samples | 94 |
Number of Associated Scaffolds | 114 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 0.88 % |
% of genes near scaffold ends (potentially truncated) | 95.61 % |
% of genes from short scaffolds (< 2000 bps) | 85.09 % |
Associated GOLD sequencing projects | 89 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.57 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (91.228 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (30.702 % of family members) |
Environment Ontology (ENVO) | Unclassified (34.211 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (53.509 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 52.86% β-sheet: 0.00% Coil/Unstructured: 47.14% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.57 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 114 Family Scaffolds |
---|---|---|
PF01979 | Amidohydro_1 | 12.28 |
PF00291 | PALP | 8.77 |
PF13360 | PQQ_2 | 4.39 |
PF01740 | STAS | 4.39 |
PF07690 | MFS_1 | 4.39 |
PF01850 | PIN | 1.75 |
PF01590 | GAF | 1.75 |
PF00076 | RRM_1 | 1.75 |
PF13442 | Cytochrome_CBB3 | 1.75 |
PF00989 | PAS | 0.88 |
PF00188 | CAP | 0.88 |
PF00793 | DAHP_synth_1 | 0.88 |
PF00440 | TetR_N | 0.88 |
PF02163 | Peptidase_M50 | 0.88 |
PF00027 | cNMP_binding | 0.88 |
PF13466 | STAS_2 | 0.88 |
PF02463 | SMC_N | 0.88 |
PF13518 | HTH_28 | 0.88 |
PF01011 | PQQ | 0.88 |
PF00324 | AA_permease | 0.88 |
PF09650 | PHA_gran_rgn | 0.88 |
PF13673 | Acetyltransf_10 | 0.88 |
PF12849 | PBP_like_2 | 0.88 |
PF04909 | Amidohydro_2 | 0.88 |
PF02517 | Rce1-like | 0.88 |
PF13520 | AA_permease_2 | 0.88 |
PF00202 | Aminotran_3 | 0.88 |
PF09828 | Chrome_Resist | 0.88 |
PF00857 | Isochorismatase | 0.88 |
PF10604 | Polyketide_cyc2 | 0.88 |
PF01476 | LysM | 0.88 |
PF11954 | DUF3471 | 0.88 |
COG ID | Name | Functional Category | % Frequency in 114 Family Scaffolds |
---|---|---|---|
COG0531 | Serine transporter YbeC, amino acid:H+ symporter family | Amino acid transport and metabolism [E] | 0.88 |
COG0833 | Amino acid permease | Amino acid transport and metabolism [E] | 0.88 |
COG1113 | L-asparagine transporter or related permease | Amino acid transport and metabolism [E] | 0.88 |
COG1115 | Na+/alanine symporter | Amino acid transport and metabolism [E] | 0.88 |
COG1266 | Membrane protease YdiL, CAAX protease family | Posttranslational modification, protein turnover, chaperones [O] | 0.88 |
COG1335 | Nicotinamidase-related amidase | Coenzyme transport and metabolism [H] | 0.88 |
COG1535 | Isochorismate hydrolase | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.88 |
COG2340 | Spore germination protein YkwD and related proteins with CAP (CSP/antigen 5/PR1) domain | Cell cycle control, cell division, chromosome partitioning [D] | 0.88 |
COG4449 | Predicted protease, Abi (CAAX) family | General function prediction only [R] | 0.88 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 91.23 % |
Unclassified | root | N/A | 8.77 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2199352024|deeps__Contig_92141 | Not Available | 732 | Open in IMG/M |
3300000955|JGI1027J12803_106607984 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 862 | Open in IMG/M |
3300002562|JGI25382J37095_10053514 | All Organisms → cellular organisms → Bacteria | 1547 | Open in IMG/M |
3300004092|Ga0062389_102570161 | All Organisms → cellular organisms → Bacteria | 676 | Open in IMG/M |
3300005180|Ga0066685_10764524 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 657 | Open in IMG/M |
3300005187|Ga0066675_10067697 | All Organisms → cellular organisms → Bacteria | 2261 | Open in IMG/M |
3300005187|Ga0066675_11058405 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 607 | Open in IMG/M |
3300005468|Ga0070707_101242807 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 711 | Open in IMG/M |
3300005555|Ga0066692_10284466 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1047 | Open in IMG/M |
3300005576|Ga0066708_10043463 | All Organisms → cellular organisms → Bacteria | 2480 | Open in IMG/M |
3300005598|Ga0066706_11431045 | Not Available | 521 | Open in IMG/M |
3300005617|Ga0068859_102424673 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 578 | Open in IMG/M |
3300005618|Ga0068864_102121567 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 568 | Open in IMG/M |
3300005764|Ga0066903_108259035 | Not Available | 532 | Open in IMG/M |
3300005921|Ga0070766_10704151 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium 13_1_40CM_2_60_3 | 684 | Open in IMG/M |
3300006175|Ga0070712_101742389 | All Organisms → cellular organisms → Bacteria | 545 | Open in IMG/M |
3300006176|Ga0070765_100221006 | All Organisms → cellular organisms → Bacteria | 1727 | Open in IMG/M |
3300006806|Ga0079220_10441218 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 867 | Open in IMG/M |
3300006893|Ga0073928_10116266 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2214 | Open in IMG/M |
3300006893|Ga0073928_10896478 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 608 | Open in IMG/M |
3300006914|Ga0075436_100914325 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 656 | Open in IMG/M |
3300007255|Ga0099791_10273831 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 803 | Open in IMG/M |
3300007255|Ga0099791_10544975 | All Organisms → cellular organisms → Bacteria | 565 | Open in IMG/M |
3300009038|Ga0099829_10285326 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1351 | Open in IMG/M |
3300009038|Ga0099829_11317322 | All Organisms → cellular organisms → Bacteria | 597 | Open in IMG/M |
3300009038|Ga0099829_11418307 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 574 | Open in IMG/M |
3300009088|Ga0099830_11048768 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 676 | Open in IMG/M |
3300009088|Ga0099830_11187653 | All Organisms → cellular organisms → Bacteria | 633 | Open in IMG/M |
3300009089|Ga0099828_11149430 | All Organisms → cellular organisms → Bacteria | 689 | Open in IMG/M |
3300009143|Ga0099792_10165047 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1232 | Open in IMG/M |
3300009143|Ga0099792_10763650 | All Organisms → cellular organisms → Bacteria | 630 | Open in IMG/M |
3300010046|Ga0126384_10129817 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1911 | Open in IMG/M |
3300010046|Ga0126384_10453055 | All Organisms → cellular organisms → Bacteria | 1096 | Open in IMG/M |
3300010048|Ga0126373_12415144 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 585 | Open in IMG/M |
3300010333|Ga0134080_10199307 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 867 | Open in IMG/M |
3300010336|Ga0134071_10231933 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 916 | Open in IMG/M |
3300010343|Ga0074044_10277472 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1104 | Open in IMG/M |
3300010358|Ga0126370_12389864 | Not Available | 525 | Open in IMG/M |
3300010400|Ga0134122_11362543 | All Organisms → cellular organisms → Bacteria | 721 | Open in IMG/M |
3300011270|Ga0137391_10057081 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 3337 | Open in IMG/M |
3300012096|Ga0137389_10019319 | All Organisms → cellular organisms → Bacteria | 4760 | Open in IMG/M |
3300012189|Ga0137388_11530906 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 604 | Open in IMG/M |
3300012202|Ga0137363_11065020 | All Organisms → cellular organisms → Bacteria | 687 | Open in IMG/M |
3300012203|Ga0137399_10603665 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 923 | Open in IMG/M |
3300012205|Ga0137362_10498247 | All Organisms → cellular organisms → Bacteria | 1053 | Open in IMG/M |
3300012207|Ga0137381_11016666 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 715 | Open in IMG/M |
3300012359|Ga0137385_11481653 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 542 | Open in IMG/M |
3300012361|Ga0137360_11567645 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 563 | Open in IMG/M |
3300012362|Ga0137361_10559802 | All Organisms → cellular organisms → Bacteria | 1049 | Open in IMG/M |
3300012362|Ga0137361_11062183 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 730 | Open in IMG/M |
3300012683|Ga0137398_11001565 | All Organisms → cellular organisms → Bacteria | 579 | Open in IMG/M |
3300012917|Ga0137395_10073197 | All Organisms → cellular organisms → Bacteria | 2217 | Open in IMG/M |
3300012922|Ga0137394_10666764 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 877 | Open in IMG/M |
3300012923|Ga0137359_10052424 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3550 | Open in IMG/M |
3300012923|Ga0137359_11045007 | All Organisms → cellular organisms → Bacteria | 700 | Open in IMG/M |
3300012927|Ga0137416_10033501 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3452 | Open in IMG/M |
3300012927|Ga0137416_12215251 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 505 | Open in IMG/M |
3300012929|Ga0137404_11888293 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 556 | Open in IMG/M |
3300012944|Ga0137410_10184857 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1606 | Open in IMG/M |
3300012986|Ga0164304_11664753 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 533 | Open in IMG/M |
3300015358|Ga0134089_10201812 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 800 | Open in IMG/M |
3300018433|Ga0066667_10868834 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 773 | Open in IMG/M |
3300018468|Ga0066662_10923270 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 859 | Open in IMG/M |
3300020004|Ga0193755_1208443 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 552 | Open in IMG/M |
3300020579|Ga0210407_10171975 | All Organisms → cellular organisms → Bacteria | 1676 | Open in IMG/M |
3300020579|Ga0210407_10378884 | All Organisms → cellular organisms → Bacteria | 1107 | Open in IMG/M |
3300020579|Ga0210407_10648153 | All Organisms → cellular organisms → Bacteria | 821 | Open in IMG/M |
3300020580|Ga0210403_11532925 | Not Available | 500 | Open in IMG/M |
3300020581|Ga0210399_10680485 | All Organisms → cellular organisms → Bacteria | 847 | Open in IMG/M |
3300021046|Ga0215015_10089374 | All Organisms → cellular organisms → Bacteria | 674 | Open in IMG/M |
3300021170|Ga0210400_10039671 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3654 | Open in IMG/M |
3300021170|Ga0210400_11671316 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 501 | Open in IMG/M |
3300021171|Ga0210405_10033375 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4114 | Open in IMG/M |
3300021171|Ga0210405_10603784 | All Organisms → cellular organisms → Bacteria | 854 | Open in IMG/M |
3300021171|Ga0210405_11115151 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 589 | Open in IMG/M |
3300021401|Ga0210393_11517509 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium 13_1_40CM_2_60_3 | 533 | Open in IMG/M |
3300021406|Ga0210386_10780491 | All Organisms → cellular organisms → Bacteria | 822 | Open in IMG/M |
3300021420|Ga0210394_10164706 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1929 | Open in IMG/M |
3300021474|Ga0210390_10076719 | All Organisms → cellular organisms → Bacteria | 2766 | Open in IMG/M |
3300021474|Ga0210390_11154694 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium 13_1_40CM_2_60_3 | 627 | Open in IMG/M |
3300021479|Ga0210410_11546825 | All Organisms → cellular organisms → Bacteria | 556 | Open in IMG/M |
3300021559|Ga0210409_10317581 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1402 | Open in IMG/M |
3300021560|Ga0126371_11388361 | All Organisms → cellular organisms → Bacteria | 834 | Open in IMG/M |
3300021560|Ga0126371_13316345 | Not Available | 544 | Open in IMG/M |
3300024219|Ga0247665_1028906 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 718 | Open in IMG/M |
3300024225|Ga0224572_1059328 | Not Available | 709 | Open in IMG/M |
3300024232|Ga0247664_1014335 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1833 | Open in IMG/M |
3300024251|Ga0247679_1073318 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium 13_1_40CM_2_60_3 | 574 | Open in IMG/M |
3300024330|Ga0137417_1485674 | All Organisms → cellular organisms → Bacteria | 2640 | Open in IMG/M |
3300024347|Ga0179591_1190520 | All Organisms → cellular organisms → Bacteria | 1995 | Open in IMG/M |
3300025905|Ga0207685_10317635 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 776 | Open in IMG/M |
3300025922|Ga0207646_11068915 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 711 | Open in IMG/M |
3300026294|Ga0209839_10203838 | Not Available | 634 | Open in IMG/M |
3300026317|Ga0209154_1021115 | All Organisms → cellular organisms → Bacteria | 3056 | Open in IMG/M |
3300026320|Ga0209131_1095834 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1573 | Open in IMG/M |
3300026333|Ga0209158_1135570 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 911 | Open in IMG/M |
3300027603|Ga0209331_1060372 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidipila → unclassified Acidipila → Acidipila sp. | 951 | Open in IMG/M |
3300027610|Ga0209528_1138772 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 533 | Open in IMG/M |
3300027738|Ga0208989_10153154 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 774 | Open in IMG/M |
3300027765|Ga0209073_10089291 | All Organisms → cellular organisms → Bacteria | 1073 | Open in IMG/M |
3300027846|Ga0209180_10652014 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 577 | Open in IMG/M |
3300027867|Ga0209167_10398738 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 750 | Open in IMG/M |
3300027882|Ga0209590_10378814 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 913 | Open in IMG/M |
3300028536|Ga0137415_11384956 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 524 | Open in IMG/M |
3300031718|Ga0307474_10035704 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3657 | Open in IMG/M |
3300031718|Ga0307474_11234783 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 591 | Open in IMG/M |
3300031754|Ga0307475_11569095 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 504 | Open in IMG/M |
3300031823|Ga0307478_11025152 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 689 | Open in IMG/M |
3300031879|Ga0306919_10112751 | Not Available | 1933 | Open in IMG/M |
3300031942|Ga0310916_10557997 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 974 | Open in IMG/M |
3300031945|Ga0310913_10074857 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2250 | Open in IMG/M |
3300031962|Ga0307479_10061563 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 3617 | Open in IMG/M |
3300031962|Ga0307479_11416543 | All Organisms → cellular organisms → Bacteria | 653 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 30.70% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 19.30% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 7.89% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 5.26% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 5.26% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 3.51% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 3.51% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.51% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.63% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 2.63% |
Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 1.75% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.75% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.75% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.75% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.88% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.88% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.88% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.88% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.88% |
Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.88% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.88% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.88% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.88% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.88% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2199352024 | Bare-fallow DEEP SOIL | Environmental | Open in IMG/M |
3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300002562 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm | Environmental | Open in IMG/M |
3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
3300010333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300010336 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015 | Environmental | Open in IMG/M |
3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
3300015358 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
3300020004 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1a2 | Environmental | Open in IMG/M |
3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
3300021046 | Soil microbial communities from Shale Hills CZO, Pennsylvania, United States - 90cm depth | Environmental | Open in IMG/M |
3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
3300024219 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK06 | Environmental | Open in IMG/M |
3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic ? CZU5 | Host-Associated | Open in IMG/M |
3300024232 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK05 | Environmental | Open in IMG/M |
3300024251 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK20 | Environmental | Open in IMG/M |
3300024330 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300024347 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026294 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050 (SPAdes) | Environmental | Open in IMG/M |
3300026317 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 (SPAdes) | Environmental | Open in IMG/M |
3300026320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cm (SPAdes) | Environmental | Open in IMG/M |
3300026333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 (SPAdes) | Environmental | Open in IMG/M |
3300027603 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M3 (SPAdes) | Environmental | Open in IMG/M |
3300027610 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M3 (SPAdes) | Environmental | Open in IMG/M |
3300027738 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M1 (SPAdes) | Environmental | Open in IMG/M |
3300027765 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes) | Environmental | Open in IMG/M |
3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027867 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
deeps_01589110 | 2199352024 | Soil | QLEFRRNLILLKEALNDRTRDEHERQAECQKLQSTLMRVLGLQH |
JGI1027J12803_1066079844 | 3300000955 | Soil | LKEALTDRTKEEHERERELAHVNETLLRIMGLRPLDRR* |
JGI25382J37095_100535144 | 3300002562 | Grasslands Soil | QLEFRRNLILLKEALTDRTKAEHERQKELVHVQETLMRVMGIRR* |
Ga0062389_1025701612 | 3300004092 | Bog Forest Soil | LGQLEFRRNLLLLKEALTDRTKEEHERQRELVHVQETLMRVMGIRR* |
Ga0066685_107645242 | 3300005180 | Soil | VLAQLEFRRNLLLLKETLTDRTREEHERQRELVHVQETLMRVLGLRAVPASAR* |
Ga0066675_100676973 | 3300005187 | Soil | RRNLILLKEALTDRTIEEHERQRELVHVQETLMRVMGLRHLPASARPR* |
Ga0066675_110584052 | 3300005187 | Soil | NLLLLKEALTDRTKEEHERQRELVHVQESLMRVMGLRQR* |
Ga0070707_1012428071 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | LAQMEFRRNLILLKEALNDRTKEEHARERELQKIQQTLVRVLQVHI* |
Ga0066692_102844661 | 3300005555 | Soil | LLKEALTDRTKEEHERQRELVHVQETLMRVMGLRQR* |
Ga0066708_100434632 | 3300005576 | Soil | LVLAQLEFRRNLLLLKETLTDRTREEHERQRELVHVQETLMRVLGLRAVPASAR* |
Ga0066706_114310451 | 3300005598 | Soil | NLMLLKEALNDRTKEEHERQADLIKLQETLLRVMRLRP* |
Ga0068859_1024246733 | 3300005617 | Switchgrass Rhizosphere | RNLLLLKEALVDRTKAEHQRERELIKLQETLFRVMNLRP* |
Ga0068864_1021215671 | 3300005618 | Switchgrass Rhizosphere | MLLKEALTDRTKEEHERERELAHVNETLLRIMGLRPLDRR* |
Ga0066903_1082590351 | 3300005764 | Tropical Forest Soil | FRRNLMLLKEALLDRTKEEHERQRELTKLQETLFRVMKLHP* |
Ga0070766_107041512 | 3300005921 | Soil | SDRTKQEHERELELVKLQATLVRVLGLRHSVSATQQ* |
Ga0070712_1017423892 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | RRNLRLLKEALTDRTHAEHERERELLKLQQTLTRVLGLRVQ* |
Ga0070765_1002210063 | 3300006176 | Soil | MEFRRNLVLLKEALSDRTKEEHEREQELLKVQATLMRVLGLRHSVATGESR* |
Ga0079220_104412181 | 3300006806 | Agricultural Soil | LEFRRHLFLLKETLTDRTREEHERQRELVHVQETLMRVMGLRKSSASAT* |
Ga0073928_101162661 | 3300006893 | Iron-Sulfur Acid Spring | LILLKEALSDRTKEEHEREQELLKLQATLVRVLGLRHAVPVKQSR* |
Ga0073928_108964781 | 3300006893 | Iron-Sulfur Acid Spring | KEALSDRTKEEHEREQELLKVQATLMRVLGLRHSATAK* |
Ga0075436_1009143251 | 3300006914 | Populus Rhizosphere | RNLMLLKEALTDRTKEEHERQGELVKLQQTLLRVIGLRP* |
Ga0099791_102738313 | 3300007255 | Vadose Zone Soil | RRNLILLKEALSDRTKEEHERQRELIHVQETLMRILGLRQVPKSASAR* |
Ga0099791_105449751 | 3300007255 | Vadose Zone Soil | LEFRRNLILLKEALTDRSKEEHERQSELVHVQETLMRVMGLRQLPATTRSR* |
Ga0099829_102853261 | 3300009038 | Vadose Zone Soil | QLEFRRNLILLKEALTDRTMEEHERQRELVHVQETLMRVMGLRQLPGSARPR* |
Ga0099829_113173222 | 3300009038 | Vadose Zone Soil | MQMEFRRNLLLLKEALSDRTHEEHERERELKKVQDQLLRVLRLHN* |
Ga0099829_114183072 | 3300009038 | Vadose Zone Soil | RRNLILLKEALTDRTKEEHERQRELVHVQETLMRVMGIRH* |
Ga0099830_110487681 | 3300009088 | Vadose Zone Soil | EFRRNLILLKEALTDRTMEEHERQRELVHVQETLMRVMGLRQLPASARPR* |
Ga0099830_111876532 | 3300009088 | Vadose Zone Soil | QLEFRRNLILLKEVLTDRTREEHERQRELLHVQETMMRVVGIRHH* |
Ga0099828_111494302 | 3300009089 | Vadose Zone Soil | LLKEALSDRTQEEHERERELKKVRDQLLRVLRLRP* |
Ga0099792_101650474 | 3300009143 | Vadose Zone Soil | LILLKEALTDRTKEEHERQRELVHVQETLMRVMGIRH* |
Ga0099792_107636502 | 3300009143 | Vadose Zone Soil | EFRRNLLLLKEALSDRTQEEHEREHELKKVQDQLLRVLRLHP* |
Ga0126384_101298171 | 3300010046 | Tropical Forest Soil | MLLKEALLDRTKEEHQRQRELTKLQETLFRVMNLHP* |
Ga0126384_104530551 | 3300010046 | Tropical Forest Soil | NLMLLKEALVDRSKAEHERERELIKLQETLFRVMNLRP* |
Ga0126373_124151441 | 3300010048 | Tropical Forest Soil | QLEFRRNLLLLKEALNDRAKEEHERQQELVRLQQTLVRVLGLRR* |
Ga0134080_101993071 | 3300010333 | Grasslands Soil | KEALIDRTKEEHERQQELLKLQQTLLRVLGLRGSKP* |
Ga0134071_102319332 | 3300010336 | Grasslands Soil | LAQLEFRRNLFLLKETLTDRTREEHERQRELVHVQETLMRVMGLRKSRASAR* |
Ga0074044_102774723 | 3300010343 | Bog Forest Soil | MEFRRNLILLKEALSDRTKEEHEREKELIHLQEALVRVLRLGHAVKVKSSR* |
Ga0126370_123898642 | 3300010358 | Tropical Forest Soil | NLILLKEALNDRTREEHERERELQKAQETLLRVLRLHP* |
Ga0134122_113625432 | 3300010400 | Terrestrial Soil | LKEALTDRTHAEHERERELLKLQQTLTRVLGLRVQ* |
Ga0137391_100570815 | 3300011270 | Vadose Zone Soil | RRNLILLKEALSDRTREEHERERELKKVQDQLLRVLHLHS* |
Ga0137389_100193191 | 3300012096 | Vadose Zone Soil | RLVLMQMEFRRNLLLLKEALSDRTQEEHERERELKKVQDQLLRVLRLRP* |
Ga0137388_115309062 | 3300012189 | Vadose Zone Soil | EFRRNLVLLKEALTDRTKEDHERERELKKLQEQLVKVLHLHI* |
Ga0137363_110650202 | 3300012202 | Vadose Zone Soil | RLVLMQMEFRRNLLLLKEALSDRTHEEHERERELKKVQDQLLRVLHLHS* |
Ga0137399_106036653 | 3300012203 | Vadose Zone Soil | FRRNLILLKEALSDRTKEEHERQRELVHVQETLMRVLGLRQPPKSASAR* |
Ga0137362_104982471 | 3300012205 | Vadose Zone Soil | EFRRNLILLKEALSDRTREEHERERELKKVQDTLMRVVRVQS* |
Ga0137381_110166662 | 3300012207 | Vadose Zone Soil | EFRRNLILLKEALNDRTKEEHERQRELQKLQQTLLRVMNLHI* |
Ga0137385_114816532 | 3300012359 | Vadose Zone Soil | IAQLEFRRNLLLLKEALTDRTKEEHERQRELVHVQETLMRVMGLRQR* |
Ga0137360_115676451 | 3300012361 | Vadose Zone Soil | QLEFRRNLILLKEALTDRTKEEHERQRELVHVQETLMRVMGIRNPPPR* |
Ga0137361_105598021 | 3300012362 | Vadose Zone Soil | EFRRNLILLKEALNDRTREEHERERELKKVQDTLLRVLRVHT* |
Ga0137361_110621831 | 3300012362 | Vadose Zone Soil | LVLAQLEFRRNLILLKEALTDRTMEEHERQRELVHVQETLMRVMGLRQLPASARPR* |
Ga0137398_110015651 | 3300012683 | Vadose Zone Soil | LVLMQMEFRRNLLLLKEALSDRTQEEHERERELKKVQDQLLRVLRLHP* |
Ga0137395_100731971 | 3300012917 | Vadose Zone Soil | LMQMEFRRNLLLLKEALSDRTQEEHERERELKKVQDQLLRVLRLHP* |
Ga0137394_106667643 | 3300012922 | Vadose Zone Soil | LLKEALTDRTKEEHERQRELVHVQETLMRVMGIRH* |
Ga0137359_100524245 | 3300012923 | Vadose Zone Soil | LLKEALTDRTKEEHERQRELVHVQETLMRVMGIRNPPPR* |
Ga0137359_110450072 | 3300012923 | Vadose Zone Soil | LLKEALSDRTREEHERERELKKVQDTLMRVVRVQP* |
Ga0137416_100335011 | 3300012927 | Vadose Zone Soil | RRNLILLKEALSDRTKEEHERQRELVHVQETLMRVLGLRQIPQSASAR* |
Ga0137416_122152511 | 3300012927 | Vadose Zone Soil | RRNLILLKEALTDRTKEEHERQRELVHVQETLMRVVGIRH* |
Ga0137404_118882932 | 3300012929 | Vadose Zone Soil | NLILLKEALTDRTKEEHERQRELVHVQETLMRVMGIRH* |
Ga0137410_101848574 | 3300012944 | Vadose Zone Soil | EFRRNLILLKEALTDRTKEEHERQRELVHVQETLMRVMGIRH* |
Ga0164304_116647531 | 3300012986 | Soil | RNLILLKEALSDRTKEEHEREQELLKVQATLMRVLGLRSSASAS* |
Ga0134089_102018122 | 3300015358 | Grasslands Soil | EFRRNLFLLKETLTDRTREEHERQRELVHVQETLMRVMGLRKSQASAGSR* |
Ga0066667_108688341 | 3300018433 | Grasslands Soil | QLEFRRNLFLLKETLTDRTREEHERQRELVHVQETLMRVMGLRKSQASAGSR |
Ga0066662_109232701 | 3300018468 | Grasslands Soil | NLILLREALTDRTLKEHERERELLALQEKLLRVINLHP |
Ga0193755_12084432 | 3300020004 | Soil | EFRRNLILLKEALTDRTKEEHERQRELVHVQETLMRVMGIRH |
Ga0210407_101719752 | 3300020579 | Soil | NLILLKEALTNRTKEEHERQRELVHVQETLMRVMGLRQIPASARIR |
Ga0210407_103788842 | 3300020579 | Soil | RRNLILLKEALSDRTREEHDRERELKKVQDQLLRVLRLHP |
Ga0210407_106481531 | 3300020579 | Soil | RRNLILLKEALSDRTKEEHEREQELLKVQATLMRVLGLHHSVSTAKP |
Ga0210403_115329251 | 3300020580 | Soil | LLKEALSDRTREEHERERELKKVQDTLMRVLRVRT |
Ga0210399_106804852 | 3300020581 | Soil | EALSDRTKEEHEREQELLKVQATLMRVLGLRHSVASGKP |
Ga0215015_100893741 | 3300021046 | Soil | MEFRRNLILLKEALSDRTREEHERERELKKVQDQLLRVLHLHS |
Ga0210400_100396715 | 3300021170 | Soil | MQMEFRRNLILLKEALNDRTREEHERERELKKVQDQLVRVLRLQP |
Ga0210400_116713161 | 3300021170 | Soil | VLGQLEFRRNLLLLKEALTDRTKEEHERQRELVHVQETLMRVMGIRR |
Ga0210405_100333751 | 3300021171 | Soil | AQLEFRRNLMLLKEALADRTKEEHERQRELVKLQQTLLRVLGLRP |
Ga0210405_106037841 | 3300021171 | Soil | KEALSDRTKEEHEREQELLKVQATLMRVLGLHHSVSTAKP |
Ga0210405_111151512 | 3300021171 | Soil | RLVLGQMEFRRNLLLLKEALTDRTKEEHERQRELVHVQETLMRVMGIRH |
Ga0210393_115175091 | 3300021401 | Soil | FRRNLILLKEALSDRTKVEHEREQELLKLQATLMRVLGLRHVASASLSAKP |
Ga0210386_107804912 | 3300021406 | Soil | QMEFRRNLILLKEALSDRTREEHERERELKKVQDTLMRVLRVKT |
Ga0210394_101647061 | 3300021420 | Soil | LLKEALTDRTKEEHERQRELVHVQETLMRVMGIRR |
Ga0210390_100767191 | 3300021474 | Soil | ILLKEALSDRTKEEHERQAELLKLQATLMRVLGLRHSVSAR |
Ga0210390_111546942 | 3300021474 | Soil | LAQMEFRRNLILLKEVLSDRTKEEHEREQELIKLQATLVRVLGLRQSVSG |
Ga0210410_115468251 | 3300021479 | Soil | LVLMQMEFRRNLILLKEALSDRTREEHDRERELKKVQDQLLRVLRLHP |
Ga0210409_103175814 | 3300021559 | Soil | FRRNLILLKEALTDRTKEEHERQHELIHVQETLMRVMGLRQLPASPKPL |
Ga0126371_113883611 | 3300021560 | Tropical Forest Soil | QLEFRRNLMLLKEALLDRTKEEHERQRELTKLQETLFRVMKLHS |
Ga0126371_133163452 | 3300021560 | Tropical Forest Soil | VLAQLEFRRNLILLKEALIDRTKEEHERQKELTKLQETLFRVMRLRR |
Ga0247665_10289062 | 3300024219 | Soil | RNLILLKEALSDRTKEEHEREQELLKVQATLMRVLGLRSSASA |
Ga0224572_10593281 | 3300024225 | Rhizosphere | AQMEFRRNLILLKEALSDRTKEEHERQAELLKLQATLMRVLGLRHSVSAR |
Ga0247664_10143351 | 3300024232 | Soil | KEALTDRTKEEHERERELAHVNETLLRIMGLRPLDRR |
Ga0247679_10733182 | 3300024251 | Soil | ILLKAALSDRTKEEHEREQELLKVQATLMRVLGLRNSASAR |
Ga0137417_14856744 | 3300024330 | Vadose Zone Soil | MQMEFRRNLILLKEALSDRTREEHERERELKKVQDTLMRVVRVQS |
Ga0179591_11905202 | 3300024347 | Vadose Zone Soil | LLLLKEALSDRTQEEHERERELKKVQDQLLRVLRLQSLASSPRLQSPS |
Ga0207685_103176352 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | MQMEFRRNLILLKEALSDRTREEHERERELKKVQDTLMRVLRVQA |
Ga0207646_110689151 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | LAQMEFRRNLILLKEALNDRTKEEHARERELQKIQQTLVRVLQVHI |
Ga0209839_102038382 | 3300026294 | Soil | FRRNLILLKEALNDRTKDEHERQAECTRLQATLMRVLGLQPH |
Ga0209154_10211151 | 3300026317 | Soil | FRRNLFLLKETLTDRTREEHERQRELVHVQETLMRVMGLRKSQASAGSR |
Ga0209131_10958344 | 3300026320 | Grasslands Soil | QLEFRRNLILLKEALSDRTKEEHERQRELIHVQETLMRILGLRQVPKSASAR |
Ga0209158_11355702 | 3300026333 | Soil | EFRRNLLLLKETLTDRTREEHERQRELVHVQETLMRVLGLRAVPASAR |
Ga0209331_10603723 | 3300027603 | Forest Soil | LAQMEFRRNLILLREALTDRTHKEHERERELLVLQEKLLRVMNLHG |
Ga0209528_11387721 | 3300027610 | Forest Soil | RRNLILLKEALTDRTKEEHERQRELVHVQETLVRVMGLRQPPASARPR |
Ga0208989_101531543 | 3300027738 | Forest Soil | RNLILLKEALTDRTKEEHERQRELAHVQETLMRVMGLRHHPASARPR |
Ga0209073_100892913 | 3300027765 | Agricultural Soil | NLMLLKEALTDRTKEEHERQRELVKLQQTLLRVIGLRP |
Ga0209180_106520142 | 3300027846 | Vadose Zone Soil | LLKEALTDRTKEEHERQRELVHVQETLMRVMGIRH |
Ga0209167_103987381 | 3300027867 | Surface Soil | LVLLKEALSDRTKEEHEREQELLKVQATLMRVLGLRHSVATGQSR |
Ga0209590_103788143 | 3300027882 | Vadose Zone Soil | MEFRRNLILLKEALTDRTKEEHERQKELVHVQETLMRVMGLRQLPAPSRSR |
Ga0209526_102115842 | 3300028047 | Forest Soil | NLILLKEALTDRTKEEHERQRELVHVQETLMRVMGLRQLPGSARPR |
Ga0137415_113849562 | 3300028536 | Vadose Zone Soil | RRNLILLKEALTDRTKEEHERQRELVHVQETLMRVVGIRH |
Ga0307474_100357041 | 3300031718 | Hardwood Forest Soil | RRNLMLLKEALNDRTKDEHQRQLECQKLQATLMRVLHLER |
Ga0307474_112347832 | 3300031718 | Hardwood Forest Soil | NLMLLKEALNDRTKEEHERETELIKLQETLLRVMKLGL |
Ga0307475_115690952 | 3300031754 | Hardwood Forest Soil | LEFRRNLILLKEALTDRTKEEHQRQQELLHVQETLMRVMGLRQLPASPKPL |
Ga0307478_110251522 | 3300031823 | Hardwood Forest Soil | VLAQMEFRRNLILLKEALNDRTKEEHAREQELQKIQQTLVRVMQVRI |
Ga0306919_101127512 | 3300031879 | Soil | RNLLHLKEALNDRAKEEHERQRELVKLQQTLLRVTGLRA |
Ga0310916_105579971 | 3300031942 | Soil | VLAQLEFRRNLLHLKEALNDRAKEEHERQRELVKLQQTLLRVTGLRA |
Ga0310913_100748572 | 3300031945 | Soil | LEFRRNLLHLKEALNDRAKEEHERQRELVKLQQTLLRVTGLRA |
Ga0307479_100615635 | 3300031962 | Hardwood Forest Soil | QMEFRRNLVLLKEALSDRTREEHERERELKKVQDQLLRVLHLHS |
Ga0307479_114165432 | 3300031962 | Hardwood Forest Soil | LILLKEALSDRTREEHERERELKKVQDQLLRVLHLHS |
⦗Top⦘ |