NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F081678

Metagenome / Metatranscriptome Family F081678

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F081678
Family Type Metagenome / Metatranscriptome
Number of Sequences 114
Average Sequence Length 39 residues
Representative Sequence TAYQERDWLLVGLKTNFLLDPLRSDPRFAELVRKVGLPQ
Number of Associated Samples 102
Number of Associated Scaffolds 114

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.88 %
% of genes near scaffold ends (potentially truncated) 96.49 %
% of genes from short scaffolds (< 2000 bps) 92.98 %
Associated GOLD sequencing projects 100
AlphaFold2 3D model prediction Yes
3D model pTM-score0.39

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (92.982 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland
(13.158 % of family members)
Environment Ontology (ENVO) Unclassified
(21.053 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(57.895 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 31.34%    β-sheet: 0.00%    Coil/Unstructured: 68.66%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.39
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 114 Family Scaffolds
PF00069Pkinase 12.28
PF00072Response_reg 1.75
PF00196GerE 1.75
PF01594AI-2E_transport 1.75
PF13181TPR_8 1.75
PF07690MFS_1 1.75
PF00857Isochorismatase 1.75
PF00486Trans_reg_C 0.88
PF03544TonB_C 0.88
PF00557Peptidase_M24 0.88
PF02371Transposase_20 0.88
PF13360PQQ_2 0.88
PF01431Peptidase_M13 0.88
PF05163DinB 0.88
PF00589Phage_integrase 0.88
PF02620YceD 0.88
PF13414TPR_11 0.88
PF07676PD40 0.88
PF14534DUF4440 0.88
PF07702UTRA 0.88
PF09286Pro-kuma_activ 0.88
PF12681Glyoxalase_2 0.88
PF13683rve_3 0.88
PF13649Methyltransf_25 0.88
PF00753Lactamase_B 0.88
PF01548DEDD_Tnp_IS110 0.88
PF00881Nitroreductase 0.88
PF07730HisKA_3 0.88
PF07883Cupin_2 0.88
PF07366SnoaL 0.88
PF12833HTH_18 0.88
PF04237YjbR 0.88
PF00717Peptidase_S24 0.88
PF10543ORF6N 0.88
PF08238Sel1 0.88
PF00478IMPDH 0.88
PF13519VWA_2 0.88
PF00149Metallophos 0.88
PF00293NUDIX 0.88
PF00775Dioxygenase_C 0.88
PF13474SnoaL_3 0.88
PF01734Patatin 0.88
PF00155Aminotran_1_2 0.88
PF07681DoxX 0.88

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 114 Family Scaffolds
COG0515Serine/threonine protein kinaseSignal transduction mechanisms [T] 49.12
COG0628Predicted PurR-regulated permease PerMGeneral function prediction only [R] 1.75
COG1335Nicotinamidase-related amidaseCoenzyme transport and metabolism [H] 1.75
COG1535Isochorismate hydrolaseSecondary metabolites biosynthesis, transport and catabolism [Q] 1.75
COG3547TransposaseMobilome: prophages, transposons [X] 1.75
COG0810Periplasmic protein TonB, links inner and outer membranesCell wall/membrane/envelope biogenesis [M] 0.88
COG139923S rRNA accumulation protein YceD (essential in plants, uncharacterized in bacteria)Translation, ribosomal structure and biogenesis [J] 0.88
COG1752Predicted acylesterase/phospholipase RssA, containd patatin domainGeneral function prediction only [R] 0.88
COG2259Uncharacterized membrane protein YphA, DoxX/SURF4 familyFunction unknown [S] 0.88
COG2315Predicted DNA-binding protein with ‘double-wing’ structural motif, MmcQ/YjbR familyTranscription [K] 0.88
COG2318Bacillithiol/mycothiol S-transferase BstA/DinB, DinB/YfiT family (unrelated to E. coli DinB)Secondary metabolites biosynthesis, transport and catabolism [Q] 0.88
COG3485Protocatechuate 3,4-dioxygenase beta subunitSecondary metabolites biosynthesis, transport and catabolism [Q] 0.88
COG3590Predicted metalloendopeptidasePosttranslational modification, protein turnover, chaperones [O] 0.88
COG3621Patatin-like phospholipase/acyl hydrolase, includes sporulation protein CotRGeneral function prediction only [R] 0.88
COG3850Signal transduction histidine kinase NarQ, nitrate/nitrite-specificSignal transduction mechanisms [T] 0.88
COG3851Signal transduction histidine kinase UhpB, glucose-6-phosphate specificSignal transduction mechanisms [T] 0.88
COG4270Uncharacterized membrane proteinFunction unknown [S] 0.88
COG4564Signal transduction histidine kinaseSignal transduction mechanisms [T] 0.88
COG4585Signal transduction histidine kinase ComPSignal transduction mechanisms [T] 0.88
COG4667Predicted phospholipase, patatin/cPLA2 familyLipid transport and metabolism [I] 0.88
COG4934Serine protease, subtilase familyPosttranslational modification, protein turnover, chaperones [O] 0.88

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms92.98 %
UnclassifiedrootN/A7.02 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300001867|JGI12627J18819_10220782Not Available764Open in IMG/M
3300002245|JGIcombinedJ26739_100024310All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae5272Open in IMG/M
3300002245|JGIcombinedJ26739_100271187All Organisms → cellular organisms → Bacteria1583Open in IMG/M
3300004080|Ga0062385_10290510All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae932Open in IMG/M
3300004139|Ga0058897_11009142All Organisms → cellular organisms → Bacteria760Open in IMG/M
3300004633|Ga0066395_10131568All Organisms → cellular organisms → Bacteria1247Open in IMG/M
3300005178|Ga0066688_10611561All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae700Open in IMG/M
3300005332|Ga0066388_101862056All Organisms → cellular organisms → Bacteria1072Open in IMG/M
3300005436|Ga0070713_101305591All Organisms → cellular organisms → Bacteria703Open in IMG/M
3300005468|Ga0070707_100517060All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1156Open in IMG/M
3300005586|Ga0066691_10354972All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae868Open in IMG/M
3300005598|Ga0066706_11038981All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae629Open in IMG/M
3300005614|Ga0068856_101238995All Organisms → cellular organisms → Bacteria → Acidobacteria762Open in IMG/M
3300005841|Ga0068863_101788462Not Available624Open in IMG/M
3300005993|Ga0080027_10477006All Organisms → cellular organisms → Bacteria → Acidobacteria506Open in IMG/M
3300006028|Ga0070717_10014943All Organisms → cellular organisms → Bacteria5979Open in IMG/M
3300006031|Ga0066651_10706499All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium542Open in IMG/M
3300006052|Ga0075029_100903318All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria606Open in IMG/M
3300006059|Ga0075017_100012932All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae5322Open in IMG/M
3300006173|Ga0070716_100651379All Organisms → cellular organisms → Bacteria799Open in IMG/M
3300006174|Ga0075014_100059929All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1664Open in IMG/M
3300006175|Ga0070712_100044740All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia3054Open in IMG/M
3300006176|Ga0070765_100139602All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2149Open in IMG/M
3300006791|Ga0066653_10364961All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium734Open in IMG/M
3300006800|Ga0066660_11008915All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia668Open in IMG/M
3300006854|Ga0075425_100491798All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium1413Open in IMG/M
3300007076|Ga0075435_100001019All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae17756Open in IMG/M
3300009500|Ga0116229_11641921All Organisms → cellular organisms → Bacteria504Open in IMG/M
3300009545|Ga0105237_11645914All Organisms → cellular organisms → Bacteria → Acidobacteria649Open in IMG/M
3300009661|Ga0105858_1283074All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes515Open in IMG/M
3300010043|Ga0126380_10150071All Organisms → cellular organisms → Bacteria1491Open in IMG/M
3300010048|Ga0126373_11892641All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium660Open in IMG/M
3300010339|Ga0074046_10534497All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium698Open in IMG/M
3300010366|Ga0126379_13781707All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium507Open in IMG/M
3300010379|Ga0136449_100707371All Organisms → cellular organisms → Bacteria → Acidobacteria1688Open in IMG/M
3300010868|Ga0124844_1095649All Organisms → cellular organisms → Bacteria → Acidobacteria1125Open in IMG/M
3300010868|Ga0124844_1295340All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium550Open in IMG/M
3300011269|Ga0137392_11370725All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium566Open in IMG/M
3300012198|Ga0137364_10794206All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium715Open in IMG/M
3300012205|Ga0137362_11631336All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium532Open in IMG/M
3300012210|Ga0137378_10133431All Organisms → cellular organisms → Bacteria2296Open in IMG/M
3300012357|Ga0137384_10501651All Organisms → cellular organisms → Bacteria996Open in IMG/M
3300012971|Ga0126369_10912207All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii964Open in IMG/M
3300013102|Ga0157371_10698103All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium759Open in IMG/M
3300014158|Ga0181521_10279667All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii866Open in IMG/M
3300014168|Ga0181534_10107057All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1404Open in IMG/M
3300014499|Ga0182012_10590642All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium715Open in IMG/M
3300015374|Ga0132255_105284212Not Available547Open in IMG/M
3300016371|Ga0182034_10268326All Organisms → cellular organisms → Bacteria → Acidobacteria1354Open in IMG/M
3300016387|Ga0182040_11855636All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium516Open in IMG/M
3300017935|Ga0187848_10314952All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium651Open in IMG/M
3300017959|Ga0187779_10078323All Organisms → cellular organisms → Bacteria → Acidobacteria1962Open in IMG/M
3300017959|Ga0187779_10606658All Organisms → cellular organisms → Bacteria733Open in IMG/M
3300017959|Ga0187779_11116707All Organisms → cellular organisms → Bacteria551Open in IMG/M
3300017961|Ga0187778_11139103All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium544Open in IMG/M
3300017970|Ga0187783_10300141All Organisms → cellular organisms → Bacteria1172Open in IMG/M
3300017972|Ga0187781_10392569All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium990Open in IMG/M
3300017972|Ga0187781_10999270All Organisms → cellular organisms → Bacteria → Acidobacteria611Open in IMG/M
3300017974|Ga0187777_10287021All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1123Open in IMG/M
3300017974|Ga0187777_10821783All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas lutea665Open in IMG/M
3300017975|Ga0187782_10630974All Organisms → cellular organisms → Bacteria → Acidobacteria824Open in IMG/M
3300017975|Ga0187782_10917703All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium679Open in IMG/M
3300018009|Ga0187884_10063842All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1680Open in IMG/M
3300018019|Ga0187874_10458516All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium513Open in IMG/M
3300018062|Ga0187784_10603032All Organisms → cellular organisms → Bacteria882Open in IMG/M
3300018062|Ga0187784_11190187All Organisms → cellular organisms → Bacteria → Acidobacteria605Open in IMG/M
3300018090|Ga0187770_11211825All Organisms → cellular organisms → Bacteria → Acidobacteria610Open in IMG/M
3300018090|Ga0187770_11333020All Organisms → cellular organisms → Bacteria → Proteobacteria582Open in IMG/M
3300020170|Ga0179594_10359678Not Available552Open in IMG/M
3300020579|Ga0210407_10312157All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1228Open in IMG/M
3300020580|Ga0210403_10173871All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1765Open in IMG/M
3300021170|Ga0210400_10647751All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium870Open in IMG/M
3300021401|Ga0210393_10139154All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1948Open in IMG/M
3300021404|Ga0210389_10157629All Organisms → cellular organisms → Bacteria1762Open in IMG/M
3300021406|Ga0210386_11414173All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium582Open in IMG/M
3300021432|Ga0210384_11288786All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium635Open in IMG/M
3300021477|Ga0210398_10285771Not Available1345Open in IMG/M
3300026041|Ga0207639_10740070All Organisms → cellular organisms → Bacteria914Open in IMG/M
3300026078|Ga0207702_11173621All Organisms → cellular organisms → Bacteria → Acidobacteria762Open in IMG/M
3300026215|Ga0209849_1017135All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1207Open in IMG/M
3300026297|Ga0209237_1278667All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium513Open in IMG/M
3300026317|Ga0209154_1223041All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium703Open in IMG/M
3300026467|Ga0257154_1033340All Organisms → cellular organisms → Bacteria777Open in IMG/M
3300026490|Ga0257153_1003333All Organisms → cellular organisms → Bacteria3106Open in IMG/M
3300026529|Ga0209806_1122554All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1050Open in IMG/M
3300026547|Ga0209156_10211157Not Available921Open in IMG/M
3300026698|Ga0208843_100618All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae631Open in IMG/M
3300027095|Ga0208606_107443All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium517Open in IMG/M
3300027535|Ga0209734_1013123All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1502Open in IMG/M
3300027842|Ga0209580_10514896All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium595Open in IMG/M
3300027862|Ga0209701_10698108All Organisms → cellular organisms → Bacteria523Open in IMG/M
3300027879|Ga0209169_10062803All Organisms → cellular organisms → Bacteria → Acidobacteria1922Open in IMG/M
3300027879|Ga0209169_10064833All Organisms → cellular organisms → Bacteria1889Open in IMG/M
3300029903|Ga0247271_132364All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7510Open in IMG/M
3300029913|Ga0311362_10551300All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1047Open in IMG/M
3300029943|Ga0311340_11292096All Organisms → cellular organisms → Bacteria582Open in IMG/M
3300030044|Ga0302281_10411170All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium520Open in IMG/M
3300030057|Ga0302176_10357782All Organisms → cellular organisms → Bacteria → Acidobacteria588Open in IMG/M
3300031232|Ga0302323_101800636Not Available693Open in IMG/M
3300031754|Ga0307475_10510341All Organisms → cellular organisms → Bacteria965Open in IMG/M
3300031754|Ga0307475_10894363All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium701Open in IMG/M
3300031833|Ga0310917_10833230All Organisms → cellular organisms → Bacteria622Open in IMG/M
3300031941|Ga0310912_10325755All Organisms → cellular organisms → Bacteria → Acidobacteria1191Open in IMG/M
3300031941|Ga0310912_10716541All Organisms → cellular organisms → Bacteria → Acidobacteria775Open in IMG/M
3300031954|Ga0306926_11692587All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium722Open in IMG/M
3300031962|Ga0307479_11400050All Organisms → cellular organisms → Bacteria658Open in IMG/M
3300032205|Ga0307472_100352460All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1209Open in IMG/M
3300032261|Ga0306920_102346839All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium738Open in IMG/M
3300032770|Ga0335085_11007161All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium900Open in IMG/M
3300032782|Ga0335082_10405118All Organisms → cellular organisms → Bacteria → Acidobacteria1228Open in IMG/M
3300032783|Ga0335079_11473915All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium673Open in IMG/M
3300032895|Ga0335074_10384889Not Available1534Open in IMG/M
3300032898|Ga0335072_10505290All Organisms → cellular organisms → Bacteria1251Open in IMG/M
3300033004|Ga0335084_10302797All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1652Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland13.16%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil11.40%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil7.89%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil6.14%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil5.26%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil5.26%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere4.39%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil3.51%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil3.51%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil3.51%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil3.51%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil3.51%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland2.63%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds2.63%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere2.63%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog1.75%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen1.75%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa1.75%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere1.75%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil0.88%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.88%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil0.88%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil0.88%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.88%
Bog Forest SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil0.88%
Permafrost SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil0.88%
BogEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Bog0.88%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Soil0.88%
Prmafrost SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil0.88%
BogEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Bog0.88%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.88%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.88%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.88%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.88%
Host-AssociatedHost-Associated → Plants → Peat Moss → Unclassified → Unclassified → Host-Associated0.88%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300001867Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705)EnvironmentalOpen in IMG/M
3300002245Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027)EnvironmentalOpen in IMG/M
3300004080Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3EnvironmentalOpen in IMG/M
3300004139Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF230 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004633Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBioEnvironmentalOpen in IMG/M
3300005178Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137EnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005436Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaGEnvironmentalOpen in IMG/M
3300005468Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaGEnvironmentalOpen in IMG/M
3300005586Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140EnvironmentalOpen in IMG/M
3300005598Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155EnvironmentalOpen in IMG/M
3300005614Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2Host-AssociatedOpen in IMG/M
3300005841Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2Host-AssociatedOpen in IMG/M
3300005993Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-046EnvironmentalOpen in IMG/M
3300006028Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaGEnvironmentalOpen in IMG/M
3300006031Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100EnvironmentalOpen in IMG/M
3300006052Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013EnvironmentalOpen in IMG/M
3300006059Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012EnvironmentalOpen in IMG/M
3300006173Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaGEnvironmentalOpen in IMG/M
3300006174Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014EnvironmentalOpen in IMG/M
3300006175Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaGEnvironmentalOpen in IMG/M
3300006176Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5EnvironmentalOpen in IMG/M
3300006791Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102EnvironmentalOpen in IMG/M
3300006800Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109EnvironmentalOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300007076Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4Host-AssociatedOpen in IMG/M
3300009500Host-associated microbial communities from peat moss isolated from Minnesota, USA - S1T2_Fc - Sphagnum magellanicum MGHost-AssociatedOpen in IMG/M
3300009545Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaGHost-AssociatedOpen in IMG/M
3300009661Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil DNA_2013-062EnvironmentalOpen in IMG/M
3300010043Tropical forest soil microbial communities from Panama - MetaG Plot_26EnvironmentalOpen in IMG/M
3300010048Tropical forest soil microbial communities from Panama - MetaG Plot_11EnvironmentalOpen in IMG/M
3300010339Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010379Sb_50d combined assemblyEnvironmentalOpen in IMG/M
3300010868Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (PacBio error correction)EnvironmentalOpen in IMG/M
3300011269Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaGEnvironmentalOpen in IMG/M
3300012198Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012205Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaGEnvironmentalOpen in IMG/M
3300012210Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012357Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaGEnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300013102Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaGHost-AssociatedOpen in IMG/M
3300014158Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_60_metaGEnvironmentalOpen in IMG/M
3300014168Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_10_metaGEnvironmentalOpen in IMG/M
3300014499Permafrost microbial communities from Stordalen Mire, Sweden - 612S2S metaGEnvironmentalOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300016371Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172EnvironmentalOpen in IMG/M
3300016387Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176EnvironmentalOpen in IMG/M
3300017935Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_40EnvironmentalOpen in IMG/M
3300017959Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MGEnvironmentalOpen in IMG/M
3300017961Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MGEnvironmentalOpen in IMG/M
3300017970Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300017972Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300017974Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MGEnvironmentalOpen in IMG/M
3300017975Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018009Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_40EnvironmentalOpen in IMG/M
3300018019Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_150EnvironmentalOpen in IMG/M
3300018062Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018090Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300020170Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300020579Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-MEnvironmentalOpen in IMG/M
3300020580Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-MEnvironmentalOpen in IMG/M
3300021170Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-MEnvironmentalOpen in IMG/M
3300021401Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-OEnvironmentalOpen in IMG/M
3300021404Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-OEnvironmentalOpen in IMG/M
3300021406Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-OEnvironmentalOpen in IMG/M
3300021432Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-MEnvironmentalOpen in IMG/M
3300021477Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-OEnvironmentalOpen in IMG/M
3300026041Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026078Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026215Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 2 DNA2013-048 (SPAdes)EnvironmentalOpen in IMG/M
3300026297Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_40cm (SPAdes)EnvironmentalOpen in IMG/M
3300026317Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 (SPAdes)EnvironmentalOpen in IMG/M
3300026467Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-16-AEnvironmentalOpen in IMG/M
3300026490Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-10-AEnvironmentalOpen in IMG/M
3300026529Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 (SPAdes)EnvironmentalOpen in IMG/M
3300026547Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes)EnvironmentalOpen in IMG/M
3300026698Forest soil microbial communities from Willamette National Forest, Oregon, USA, amended with Nitrogen - NN411 (SPAdes)EnvironmentalOpen in IMG/M
3300027095Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF020 (SPAdes)EnvironmentalOpen in IMG/M
3300027535Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M2 (SPAdes)EnvironmentalOpen in IMG/M
3300027842Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027862Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027879Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 (SPAdes)EnvironmentalOpen in IMG/M
3300029903Soil microbial communities from Marcell Experimental Forest, Minnesota, USA - Fen703EnvironmentalOpen in IMG/M
3300029913III_Bog_N3 coassemblyEnvironmentalOpen in IMG/M
3300029943I_Palsa_N3 coassemblyEnvironmentalOpen in IMG/M
3300030044Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_E1_2EnvironmentalOpen in IMG/M
3300030057Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_1EnvironmentalOpen in IMG/M
3300031232Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_3EnvironmentalOpen in IMG/M
3300031754Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515EnvironmentalOpen in IMG/M
3300031833Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178EnvironmentalOpen in IMG/M
3300031941Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080EnvironmentalOpen in IMG/M
3300031954Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2)EnvironmentalOpen in IMG/M
3300031962Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M
3300032770Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5EnvironmentalOpen in IMG/M
3300032782Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1EnvironmentalOpen in IMG/M
3300032783Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3EnvironmentalOpen in IMG/M
3300032895Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3EnvironmentalOpen in IMG/M
3300032898Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1EnvironmentalOpen in IMG/M
3300033004Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI12627J18819_1022078213300001867Forest SoilRDFNLISLKTDFLLNPLRSDPRFAELVSKVGLPQ*
JGIcombinedJ26739_10002431013300002245Forest SoilYEERDYQVESLRTDFRLDLMRSDPRFAELVRKVGLPQ*
JGIcombinedJ26739_10027118713300002245Forest SoilREHDWLLMALNTEFQLDPVRSDPRFAELVCKVGLPQ*
Ga0062385_1029051013300004080Bog Forest SoilWLNTAFQEHDIGLMGLKTDFMLDSLRYDPRLAELVRKVGLPQ*
Ga0058897_1100914223300004139Forest SoilDTAYQERDAGLLGLKTDYLLDSLRSDTRFPELVHNVGLPQ*
Ga0066395_1013156823300004633Tropical Forest SoilLDAAFEDRDIGLMRLKTDFLLDRLRSDPRFPELVRKVGLSQ*
Ga0066688_1061156113300005178SoilKAYQARDYRMTQLNVRNDLDSLRSDPRFTELVRKVGLPQ*
Ga0066388_10186205613300005332Tropical Forest SoilWLNTAYQERDSLSLLGLKTDFLLDPLRSDPRFAELVRKVGLPQ*
Ga0070713_10130559123300005436Corn, Switchgrass And Miscanthus RhizosphereDTAYQERDLYLLGLKVDFQFDPLRSDPPFAELVRKVGLPQ*
Ga0070707_10051706033300005468Corn, Switchgrass And Miscanthus RhizosphereNTAYNERDKWLEGLKTDFVLDPIRSDPRFLELVRNVGLPQ*
Ga0066691_1035497223300005586SoilQERYAQLPNLETDFLLDPIRSDPRLAELVRKVGLPQ*
Ga0066706_1103898113300005598SoilLNTAYDERDGRLVGLKTDFRLNRLHSDPRFAELVRKVGLPQ*
Ga0068856_10123899513300005614Corn RhizosphereTAYQERDWLLVSLKTNFLLDPLRSDPRFAELVRKVGLPQ*
Ga0068863_10178846213300005841Switchgrass RhizosphereYQEHDIGLIRLKTDFLLDPLRHDPRFAVMIRKVGLPE*
Ga0080027_1047700613300005993Prmafrost SoilLLIERELGLRGLRTDFLLVRSDPRFAELVGKMGLPH*
Ga0070717_1001494353300006028Corn, Switchgrass And Miscanthus RhizosphereMWFQTAYQERDRLLLDLKTDCGLDLVRSDPRFAELVRKVGLPQ*
Ga0066651_1070649913300006031SoilERDIGLLRLKTDFRLDSLRSDPRLAGLVRKVGLPH*
Ga0075029_10090331823300006052WatershedsIETAYRERDGIGLIDLKTDFLLDPIRSDSRFAEWMKKIGFPQ*
Ga0075017_10001293213300006059WatershedsNTAYKERDGWLVGLKTDFSLDPIRSDPRFAELVRKVGLPQ*
Ga0070716_10065137913300006173Corn, Switchgrass And Miscanthus RhizosphereWLDTARQERDYLLLGLKTDFSLDTIRSDPRFAELVRKVGLPQ*
Ga0075014_10005992943300006174WatershedsAYKERDGWLVGLKTDFSLDPIRSDPRFAELVRKVGLPQ*
Ga0070712_10004474013300006175Corn, Switchgrass And Miscanthus RhizosphereTAYQERDWLLVGLKTNFLLDPLRSDPRFAELVRKVGLPQ*
Ga0070765_10013960213300006176SoilEERDYQMESLRTDFRLDPVRSDPRFAELVRKVGLPQ*
Ga0066653_1036496123300006791SoilYQERDIGLLRLKTDFRLDSLRSDPRLAGLVRKVGLPH*
Ga0066660_1100891513300006800SoilNTAYQERDWLLVGLKTNFLLDPIRSDPRFAELVRKVGLPQ*
Ga0075425_10049179813300006854Populus RhizosphereRDLGLLSLKTDFLLDPLRPDPRLAEVVRKVGLPSW*
Ga0075435_10000101913300007076Populus RhizosphereSRGLTRHTQEHDQGLIALRTDYTLDSLRSDPRYTELVRKVGLPQ*
Ga0116229_1164192123300009500Host-AssociatedLDTAHQERDWLLTALKTDFLLDPLHSDPRFEQLARKIGLPGGK*
Ga0105237_1164591413300009545Corn RhizosphereNTAYQERDWLLIGLKTDFLLDPIRSDPRFAELVRKVGLPQ*
Ga0105858_128307413300009661Permafrost SoilRDLSLEGLKTDFLLDPLRSDPRFAELVRKVGLPQ*
Ga0126380_1015007123300010043Tropical Forest SoilAYQERGICLVGLKTNFLLDPIRSDPRFAELARKVGLPQ*
Ga0126373_1189264113300010048Tropical Forest SoilRDNHLEALKTDFLLDPLRSDIRFAELVRKVGLPQ*
Ga0074046_1053449713300010339Bog Forest SoilHDEELMGLKTDYSLDPVRSDPRFAELVRKVGLPQ*
Ga0126379_1378170713300010366Tropical Forest SoilAYQERDQGLLSLKTDLLLDPLRSDPRFAELVRKIRLPQ*
Ga0136449_10070737153300010379Peatlands SoilWLNTAYQERDNRLEGLKTDFLLDPLRSDIRFAELVRKVGLPQ*
Ga0124844_109564913300010868Tropical Forest SoilERDQQMSDLETDFFFDFDTIRSDPRFAELVRKVGLPQ*
Ga0124844_129534023300010868Tropical Forest SoilRDQQMSDLETDFFFDTIRSDPRFAELVRKVGLPQ*
Ga0137392_1137072513300011269Vadose Zone SoilQERDFNLIGLKNDFLLDPLRSDPRFAELVRKVGLPQ*
Ga0137364_1079420613300012198Vadose Zone SoilYQERDAQLPNLETDFLLDPIRSDPRLAELVRKVGLPQ*
Ga0137362_1163133613300012205Vadose Zone SoilYQEHDWLLGDLKTNLLLDPIRSDPRFAELVRKVGLQQ*
Ga0137378_1013343113300012210Vadose Zone SoilKWLDTAYQERDVGLEFLKTDFLLDPLRADSRFAELVSKVGLPQ*
Ga0137384_1050165113300012357Vadose Zone SoilKEHDWLLEGLKTDFLFDPIRSDPRFAELVRKVGLPQ*
Ga0126369_1091220713300012971Tropical Forest SoilQERDSLSLLGLKTDFLLDPLRSDPRFAELVRKVGLPQ*
Ga0157371_1069810323300013102Corn RhizosphereWLNTAYQERDWLLIGLKTDFLLDPIRSDPRFAELVRKVALPQ*
Ga0181521_1027966713300014158BogWLDTAYREHDFLLKELNTAFEVDSLRSDPRFAELVNTVGLPKLR*
Ga0181534_1010705723300014168BogDGPHQIESLRTDFRLDPVRSDPRFAELVRKVGLPQ*
Ga0182012_1059064223300014499BogDIAYREHDWTLIGLNSYFQFDPLRSDPRFAELVKKIGLPQISR*
Ga0132255_10528421213300015374Arabidopsis RhizosphereAYRERDALLEGLNTDFLLDPLRSDLRFIDLVHKVGLP*
Ga0182034_1026832623300016371SoilYQEHDWQLEGLNSDFYIDPLRSDPRFAELVRKVGLPQ
Ga0182040_1185563613300016387SoilIAYQDRDSALVGLKTDFALDPIRSDPRFAELVRKVGLPQ
Ga0187848_1031495223300017935PeatlandYQEHDWLLIGLKTFVPFDPLRSDPRYAAMVRKVGLP
Ga0187779_1007832333300017959Tropical PeatlandLNTAYQEHDGQLEGSKTDFLVDPLRSDPRFAELVRKVGLPQ
Ga0187779_1060665813300017959Tropical PeatlandFQEREIGMMGLRTDFLLDSLATDPRFAELVRKVGLPQ
Ga0187779_1111670713300017959Tropical PeatlandLNTAYQEHDWLLLSLKNNSELEAVRSDPRFAELVRQVGLPE
Ga0187778_1113910333300017961Tropical PeatlandERDWLLVDLKTDFLVDPLRSDPRFAELVRKVGLPQ
Ga0187783_1030014133300017970Tropical PeatlandWLNTAFQEHDWWLFGLKTDFALDPIRADPRFAELVRKVGLPQ
Ga0187781_1039256923300017972Tropical PeatlandLNTALQEHDWWLIRLKTDFALDPIRSDLRFAELVRKVGLPQ
Ga0187781_1099927023300017972Tropical PeatlandYQEHDMGLISLKIDYSLDSLRSDPRFAELVRKVGLP
Ga0187777_1028702113300017974Tropical PeatlandEHDEYLMGLKTDFLLDPLRSDPRFAELVRKMGLPQ
Ga0187777_1082178323300017974Tropical PeatlandRDPGLIGLRTDFLLDPLRSDPRYVDLVRKMNFPSPAK
Ga0187782_1063097423300017975Tropical PeatlandDWLLEGLNTLSQFDSLRADPRFGELVNKVGLPKLPR
Ga0187782_1091770313300017975Tropical PeatlandYQERDFFLLGLRTDFALDPLRSDPRFPELIRKVGLPQ
Ga0187884_1006384233300018009PeatlandFRWLNIAYQEHDWLLIGLKTFIPLAPLRSDPRFAELVHKVGLPQ
Ga0187874_1045851613300018019PeatlandTAYREHDWLLPGLNTYFQLDPLRSDPRFAELVHKVGLPQ
Ga0187784_1060303213300018062Tropical PeatlandFMWLNTAFQEHDWWLLGLKTDFALDPIRADPRFAELVRKVGLLP
Ga0187784_1119018723300018062Tropical PeatlandQEHDISLMDLKTDYTLDSLRSDPRFAELVRKVGLPQ
Ga0187770_1121182523300018090Tropical PeatlandAYREHDWLLKELNTAYQVDSLRSDPRFAELVKKVGLPKVR
Ga0187770_1133302013300018090Tropical PeatlandVEHDRLLIGLNTYFQLDPVRSDPRFAELVRKVGLPP
Ga0179594_1035967813300020170Vadose Zone SoilAYQEHDTELIGLRTDFRFDSLRSDWRYIELVRKVGLPRS
Ga0210407_1031215713300020579SoilYQEHDWLLMGLNTYFQLDPLRSDPRFTELVRKVGLPQ
Ga0210403_1017387113300020580SoilNAAYEERDYQIESLKTDFRLDSVRSDPRFVELVRKVGLPQ
Ga0210400_1064775113300021170SoilTAAYEERDYQMESLRTDFRLDPVRSDPRFAELVRKVGLPQS
Ga0210393_1013915433300021401SoilDTAYQEHDWLLMGLNTYFQLDPLRSDPRFTELVRKVGLPQ
Ga0210389_1015762913300021404SoilMAYQERESGMKMLKTDYLLDPLRSDPRFPELLRKVGLPQ
Ga0210386_1141417323300021406SoilDTAYREHDWLLIGLNTYFQLDPIRSDPRFAELVRKVGLPH
Ga0210384_1128878623300021432SoilYRERDLLLLGVKTDDSLDPIRSDPRFAELVRKVGLPL
Ga0210398_1028577113300021477SoilNLAYQEHDWLLITLNTHYALDPLRSDPRFAELVRKVGLPQ
Ga0207639_1074007013300026041Corn RhizosphereRGWEIRDSGLLNLKTDVLLDPLRSDGRFAALLAKVGFPA
Ga0207702_1117362113300026078Corn RhizosphereTAYQERDWLLVSLKTNFLLDPLRSDPRFAELVRKVGLPQ
Ga0209849_101713513300026215SoilERDFFLFGLKADFLLDQLHSDPRFAELVRKVGLPQ
Ga0209237_127866713300026297Grasslands SoilNTAYQERGAFMLGLKTDFLLDPLHSDPRFDELVRKVGLPI
Ga0209154_122304123300026317SoilKAYQGRDYQMTELNVRPELDSLRSDPRLAELARRVGLPQ
Ga0257154_103334023300026467SoilYREHDWLLEGLNTYAQLDSLRSDPRFAALVSKVGLPK
Ga0257153_100333323300026490SoilMRFETAYQERDRLLTDLKTDYGLDLVRSDPRFAELARKVGLPQ
Ga0209806_112255443300026529SoilQERDFNLIGLKTDFLLDPLRSDPRFAELVRKVGLPQ
Ga0209156_1021115713300026547SoilERDIGLLRLKTDFRLDSLRSDPRLAGLVRNVGLPH
Ga0208843_10061823300026698SoilRWLNTACQERDSSLEGLKTDFLLDPLRSDRRFAELVRKVGLPQ
Ga0208606_10744313300027095Forest SoilAYQEHDLGLLSLKTDFLLDPLRSDPRLAELVKKVGLP
Ga0209734_101312313300027535Forest SoilNTAYYERDRLMLGLKADFPLDSLRSDPRFAELVRKVGLPQ
Ga0209580_1051489623300027842Surface SoilRWLDVAYHERDREMIGLITDVQLESLRSDPRFAELVRKVGLPQ
Ga0209701_1069810823300027862Vadose Zone SoilYQERDANCTLIKNDFAMDRLRSDPRFAELVRKVGLPQKRKQFGLET
Ga0209169_1006280323300027879SoilDTAYREHDWLLMALNTEFQLDPVRSDPRFAELVRKVGLPQ
Ga0209169_1006483313300027879SoilDTAYREHDWLLMALNTEFQLDPVRSDPRFAELVCKVGLPQ
Ga0247271_13236423300029903SoilAYREHDWLLIGLKTFIPLAPLRSDPRFAELVRKVGLPQ
Ga0311362_1055130023300029913BogIAYQQHDWLLIGLNTYFQLDPLRSDPRFAELVRKVGLPQ
Ga0311340_1129209613300029943PalsaWLDTAYREHDFLLNGIRTEFQFDVLRSDPRFAELVSKVGLPKVQ
Ga0302281_1041117023300030044FenHDWTLIGLNSYFQFDPLRSDPRFAELVKKIGLPQISR
Ga0302176_1035778213300030057PalsaQEHDWLLIGLKTFIPFAPLRSDPRFAELAHKIGLPD
Ga0302323_10180063623300031232FenAYQEREWQMTSLKTDFLLDPLRSDSRLNQLVRKMGLPE
Ga0307475_1051034113300031754Hardwood Forest SoilNIAYQERDWWMENLKTDFLLDPIRSDPRFSELVRKVGLPQ
Ga0307475_1089436323300031754Hardwood Forest SoilVQMWFETAYQERDRLLTDLKTDYGLDVVRSDPRYAELVRKVGLPQ
Ga0310917_1083323023300031833SoilTAYQERDFWLLGLKTDYSLDPIRSDPRFAELVRKVGLPQ
Ga0310912_1032575513300031941SoilERDYPLTGLNTDFLLDSLRSDPRFAELARKVGLPL
Ga0310912_1071654113300031941SoilEHDLGLLSLNTDFLLDSLRADPRMSKLVRKVGLPQ
Ga0306926_1169258723300031954SoilAYSDRDIGLIRLKTDFLLDPLRSDPRLLELARKVGLSH
Ga0307479_1140005023300031962Hardwood Forest SoilMWFETAYQERDRLLTDLKTDYGLDVVRSDPRYAELVRKVGLPQ
Ga0307472_10035246033300032205Hardwood Forest SoilHAFEWLNVAYQERDDNLINLKTQFTLDSLRPDPRFAEMVRKVGLPQ
Ga0306920_10234683923300032261SoilALQEHDQGLIGLKTDYTLDSIRSDPRFAELVRKVGLPQ
Ga0335085_1100716113300032770SoilRAGFPVARHAYQERDWLLEGLDTDFVLDPLRSDSRFAELVRKVGLPQ
Ga0335082_1040511813300032782SoilQWLNTAYQERDWLLMGLKTDFLVDPLRSDARFAELVRKVGLPQ
Ga0335079_1147391533300032783SoilQEHDEGLEGLKTDFSLDPLRSDPRFAELVRKVGLPQ
Ga0335074_1038488923300032895SoilMGTAYRLHDSLYQLNTDFMLDPLRSDPRFATLAKKVGLPQ
Ga0335072_1050529043300032898SoilNTAYQEKDWLLTSLKTDYLLDPLRSDPRFEELVRKIGLP
Ga0335084_1030279733300033004SoilERDGKVAGLRVDFLLDPLHSDPHFAELVRKVGLPQ

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.