 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| Family ID | F081712 |
| Family Type | Metagenome |
| Number of Sequences | 114 |
| Average Sequence Length | 42 residues |
| Representative Sequence | MSAVLLAVFGQYGDAERVRTKLVSDGFPTDRVELTASAEPGR |
| Number of Associated Samples | 108 |
| Number of Associated Scaffolds | 114 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 0.00 % |
| % of genes from short scaffolds (< 2000 bps) | 0.00 % |
| Associated GOLD sequencing projects | 101 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.48 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (100.000 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (28.947 % of family members) |
| Environment Ontology (ENVO) | Unclassified (27.193 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (35.965 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 18.57% β-sheet: 2.86% Coil/Unstructured: 78.57% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.48 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 114 Family Scaffolds |
|---|---|---|
| PF00196 | GerE | 18.42 |
| PF00903 | Glyoxalase | 14.04 |
| PF14238 | DUF4340 | 8.77 |
| PF00593 | TonB_dep_Rec | 4.39 |
| PF12681 | Glyoxalase_2 | 3.51 |
| PF07726 | AAA_3 | 2.63 |
| PF08002 | DUF1697 | 2.63 |
| PF10003 | DUF2244 | 1.75 |
| PF13531 | SBP_bac_11 | 0.88 |
| PF00149 | Metallophos | 0.88 |
| PF00075 | RNase_H | 0.88 |
| PF08857 | ParBc_2 | 0.88 |
| PF07715 | Plug | 0.88 |
| PF05960 | DUF885 | 0.88 |
| PF00221 | Lyase_aromatic | 0.88 |
| PF13283 | NfrA_C | 0.88 |
| PF00144 | Beta-lactamase | 0.88 |
| PF12679 | ABC2_membrane_2 | 0.88 |
| COG ID | Name | Functional Category | % Frequency in 114 Family Scaffolds |
|---|---|---|---|
| COG3797 | Uncharacterized conserved protein, DUF1697 family | Function unknown [S] | 2.63 |
| COG1680 | CubicO group peptidase, beta-lactamase class C family | Defense mechanisms [V] | 0.88 |
| COG1686 | D-alanyl-D-alanine carboxypeptidase | Cell wall/membrane/envelope biogenesis [M] | 0.88 |
| COG2367 | Beta-lactamase class A | Defense mechanisms [V] | 0.88 |
| COG2986 | Histidine ammonia-lyase | Amino acid transport and metabolism [E] | 0.88 |
| COG4318 | Uncharacterized conserved protein | Function unknown [S] | 0.88 |
| COG4805 | Uncharacterized conserved protein, DUF885 family | Function unknown [S] | 0.88 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 100.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 28.95% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 7.89% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 5.26% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 5.26% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 5.26% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 4.39% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.51% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 3.51% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 3.51% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.63% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 2.63% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 2.63% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.63% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 2.63% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 2.63% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.75% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.75% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.75% |
| Compost | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Compost | 0.88% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.88% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.88% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.88% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.88% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.88% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.88% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.88% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.88% |
| Plant Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots | 0.88% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.88% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.88% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.88% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2228664022 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300001661 | Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly) | Environmental | Open in IMG/M |
| 3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
| 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
| 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
| 3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
| 3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
| 3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
| 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
| 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
| 3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006172 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014 | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006791 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 | Environmental | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010303 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012975 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015 | Environmental | Open in IMG/M |
| 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
| 3300014150 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300014322 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - WestPond_CattailA_D1 | Environmental | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
| 3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300020170 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020593 | Enriched Miracle-Growth compost microbial communities from Emeryville, California, USA - eDNA 5th pass 37_C Kraft MG (version 2) | Environmental | Open in IMG/M |
| 3300021086 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Host-Associated | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300024283 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK11 | Environmental | Open in IMG/M |
| 3300024330 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 (SPAdes) | Environmental | Open in IMG/M |
| 3300027330 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 35 (SPAdes) | Environmental | Open in IMG/M |
| 3300027502 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027648 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027706 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen15_06102014_R2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027748 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 (SPAdes) | Environmental | Open in IMG/M |
| 3300027853 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027965 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen12_06102014_R2 (SPAdes) | Environmental | Open in IMG/M |
| 3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
| 3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
| 3300031549 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24 | Environmental | Open in IMG/M |
| 3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
| 3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031748 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22 | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031764 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27 | Environmental | Open in IMG/M |
| 3300031777 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24 | Environmental | Open in IMG/M |
| 3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
| 3300031796 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24 | Environmental | Open in IMG/M |
| 3300031798 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19 | Environmental | Open in IMG/M |
| 3300031821 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031831 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f20 | Environmental | Open in IMG/M |
| 3300031860 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f25 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032010 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22 | Environmental | Open in IMG/M |
| 3300032051 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f26 | Environmental | Open in IMG/M |
| 3300032060 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18 | Environmental | Open in IMG/M |
| 3300032089 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23 | Environmental | Open in IMG/M |
| 3300032090 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032421 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NN3 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300032893 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1 | Environmental | Open in IMG/M |
| 3300033134 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| INPgaii200_08945672 | 2228664022 | Soil | MSAVLLAVFGQYGDAERVRTQLVRDGFPTDRVELTSATEPGRAGVHP |
| JGI12635J15846_103721621 | 3300001593 | Forest Soil | MSAVLLAVFNEYGVADRVRTRLVGDGFPTDRVELTASCEP |
| JGI12053J15887_100427483 | 3300001661 | Forest Soil | MSAILLAVFNDYEAADRMRVMLVRDGFPTDRVHLTASC |
| Ga0066684_105281301 | 3300005179 | Soil | MSAVLLAVFNEYDVADRVRTKLVGDGFPTDRVELTASCEPGRAGLH |
| Ga0070683_1007385821 | 3300005329 | Corn Rhizosphere | MSAVLLAVFNDYETADRVRLELVRDGFPTDRVELTAACEPGRA |
| Ga0070705_1000933361 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | MSAVLLAVFGKFSEAEKVRTELVRDGFPTDRVELTARHEQ |
| Ga0070731_109944982 | 3300005538 | Surface Soil | MSAILLAVFEGHPVAERVRVSLVRDGFPTDRVELTARCE |
| Ga0066707_102301233 | 3300005556 | Soil | MSAVLLAVFNEYDVADRVRTKLVGDGFPTDRVELTA |
| Ga0066699_109404851 | 3300005561 | Soil | MSAVLLAVFNDYEAAQRVRVELVRDGFPTDRVELTAGCEPGRAG |
| Ga0068857_1012908401 | 3300005577 | Corn Rhizosphere | MSAVLLAVFNEYENAQGVRLELVRDGFPTDRVELTAACEPG |
| Ga0068866_101395913 | 3300005718 | Miscanthus Rhizosphere | MSAVLLAVFGKFSEAEKVRTELVRDGFPTDRVELTARHEQGR |
| Ga0066903_1046737062 | 3300005764 | Tropical Forest Soil | MSAVILAVFNEYAAADRVRTRLVSDGFPTDRVELTAACEPG |
| Ga0068858_1001683701 | 3300005842 | Switchgrass Rhizosphere | MSAVLLAVFDRFGDAQRVRTRLVRDGFPTDRVELTAREECGRAGLQPATSV |
| Ga0066651_104249021 | 3300006031 | Soil | MSAVLLAVFDEYGVAERVRTRLVRDGFPTDRVELTASCEPGRA |
| Ga0075017_1014444391 | 3300006059 | Watersheds | MSAVLLAVFSRFSDAQRVRTLLVSDGFPTDRVELTSC |
| Ga0075018_105227221 | 3300006172 | Watersheds | MSAILLAVFTDYADAERVRTQLVHDGFPTDRVELTAI |
| Ga0070716_1018452681 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MSAVLLAVFNRFADAERARTRLVRDGFPTDRVELTARAEPGRAGEQPGSAR |
| Ga0070712_1007509101 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MSAVLLAVFGQYGDAERVRTQLVRDGFPTDRVELTSATEPGRAGVHPADSRRARF |
| Ga0066653_103803152 | 3300006791 | Soil | MSAVLLAVFNDYEAAERVRVMLVLDGFPTDRVELTASC |
| Ga0075424_1001516041 | 3300006904 | Populus Rhizosphere | MSAVLLAVFGNSGDAERVRTTLVSDGFPTDRVELT |
| Ga0105240_100347021 | 3300009093 | Corn Rhizosphere | MSAVLLAVFNDYETADRVRVELVRDGFPTDRVELT |
| Ga0105241_102462373 | 3300009174 | Corn Rhizosphere | MSAVLLAVFDRFGDAQRVRTRLVRDGFPTDRVELTAREESGRAGLQ |
| Ga0105248_101462543 | 3300009177 | Switchgrass Rhizosphere | MSAVLLAVFDRFGDAQRVRTRLVRDGFPTDRVELTAREE |
| Ga0105237_126157062 | 3300009545 | Corn Rhizosphere | MSAVLLAVFNDYDAAERVRIDLFRDGFPTDRVELTACCEPGRAGCE |
| Ga0105249_115745782 | 3300009553 | Switchgrass Rhizosphere | MSAVLLAVFGKFSEAEKVRTELVRDGFPTDRVELT |
| Ga0126373_127448072 | 3300010048 | Tropical Forest Soil | MSAVLLAVFNDYEAADRVRVQLVRDGFPTDRVELTASCEPGRAGLQ |
| Ga0134082_103228191 | 3300010303 | Grasslands Soil | MSAVLLAVFNEYGVADRVRTRLVGDGFPTDRVELTASCEPGRA |
| Ga0126381_1012249851 | 3300010376 | Tropical Forest Soil | MDMSAVLLAVFNDLGSADRVRTRLVSDGFPTDRVELTSAAEPGRAG |
| Ga0137389_110226141 | 3300012096 | Vadose Zone Soil | MSAVLLAVFNEYGVADRVRTKLVGDGFPTDRVELTASC |
| Ga0150985_1162662111 | 3300012212 | Avena Fatua Rhizosphere | MSAVLLAVFNDYESAQRTRLELVRDGFPTDRVELTAACEPGRAACF |
| Ga0134110_103612691 | 3300012975 | Grasslands Soil | MSAVLLAVFNEYGVADRVRTRLVGDGFPTDRVELT |
| Ga0157374_112306581 | 3300013296 | Miscanthus Rhizosphere | MSAVLLAVFGKFSEAEKVRTELVRDGFPTDRVELTA |
| Ga0134081_102656341 | 3300014150 | Grasslands Soil | MSAVLLAVFNDYETAERVRVILVRDGFPTDRVELTASCELGRAGFE |
| Ga0075355_10843861 | 3300014322 | Natural And Restored Wetlands | MSAVLLAVFTDYSDAERVRTQLVHDGFPTDRVELT |
| Ga0132257_1029563903 | 3300015373 | Arabidopsis Rhizosphere | MSAVLLAVFDRFGDAQRVRTRLVRDGFPTDRVELTA |
| Ga0182041_104938092 | 3300016294 | Soil | MSAVLLAVFGEYGDAERVRTQLVRDGFPTDRVELT |
| Ga0182040_107353032 | 3300016387 | Soil | MSAVLLAVFGEYGDAERVRTQLVRDGFPTDRVELTSAT |
| Ga0187778_113009482 | 3300017961 | Tropical Peatland | MSAVILAVFNEYSAADRVRTRLVSDGFPTDRVELT |
| Ga0187783_108560961 | 3300017970 | Tropical Peatland | MSAVLLAVFNQYEIADRVRTRLVRDGFPTDRVELTASVEPGRAGLHPAGTTRAKF |
| Ga0187781_114283131 | 3300017972 | Tropical Peatland | MSAVLLAVFNEYGAADRVRTRLVSDGFPTDRVELTACCEP |
| Ga0066669_103915421 | 3300018482 | Grasslands Soil | MSAVLLAVFNEYGVADRVRTRLVGDGFPTDRVELTA |
| Ga0179594_103661021 | 3300020170 | Vadose Zone Soil | MSAVLLAVFNDYETAERVRVLLVRDGFPTDRVELTASCELGRAAF |
| Ga0180221_10981551 | 3300020593 | Compost | MSAVLLAVFDDYDAADRVRSALVRDGFPTDRVDLTASREPG |
| Ga0179596_103100732 | 3300021086 | Vadose Zone Soil | MSAVILAVFNDYEAAERVRVMLVRDGFPTDRVELTASCELGRAGCE |
| Ga0210400_108338352 | 3300021170 | Soil | MSAVLLAVFNDYEAADRVRVELVRDGFPTDRVELTAACE |
| Ga0210405_109326611 | 3300021171 | Soil | MSAVILAVFSEYGDAERVRTELVSDGFPTDRVELTAASEPGRAGSL |
| Ga0213876_104645652 | 3300021384 | Plant Roots | MSAVLLAVFNDFGTADQVRTRLVRDGFPTDRVELTARGEPGRAGLQPG |
| Ga0210394_104963743 | 3300021420 | Soil | MSAVLLAVFKEYGDADRVRTRLVGDGFPTDRVELTESHR |
| Ga0210384_110960951 | 3300021432 | Soil | MSAVLLAVFNEYGVADRVRTRLVGDGFPTDRVELTASC |
| Ga0210409_113584322 | 3300021559 | Soil | MSAVLLAVFNRFADAERARTRLVRDGFPTDRVELTARAEPGRAGETPGSAR |
| Ga0126371_138978681 | 3300021560 | Tropical Forest Soil | MSAVLLAVFGQYRDAERVRTKLVSDGFPTDRVELTSS |
| Ga0247670_10111523 | 3300024283 | Soil | MSAVLLAVFGQYGDAERVRTQLVRDGFPTDRVELTSATEP |
| Ga0137417_14511466 | 3300024330 | Vadose Zone Soil | MSAVLLAVFNDYETADRMRVTLVKDGFPTDRVHLTASAIWAVRA |
| Ga0207692_104723021 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | MSAVLLAVFGKFSEAEKVRTELVRDGFPTDRVELTARHEQG |
| Ga0207710_100743331 | 3300025900 | Switchgrass Rhizosphere | MSAVLLAVFDRFGDAQRVRTRLVRDGFPTDRVELTAREECGRAGLQ |
| Ga0207654_104947371 | 3300025911 | Corn Rhizosphere | MSAVLLAVFDRFGDAQRVRTRLVRDGFPTDRVELTAREESG |
| Ga0207695_100478711 | 3300025913 | Corn Rhizosphere | MSAVLLAVFNDYETADRVRVELVRDGFPTDRVELTA |
| Ga0207671_105210632 | 3300025914 | Corn Rhizosphere | MSAVILAVFNDFETADRVRTSLVRDGFPTDRVELTAS |
| Ga0207693_100201633 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | MSAVLLAVFGQYGDAERVRTQLVRDGFPTDRVELTSATEPGRGLW |
| Ga0207663_101541752 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | MSAVLLAVYTSHEAAERARTDLVRDGFPTDRVELTDC |
| Ga0207660_101780564 | 3300025917 | Corn Rhizosphere | MSAVLLAVFTEYGAADRVRTRLVSDGFPTDRVELTAVAEPGR |
| Ga0207690_117006511 | 3300025932 | Corn Rhizosphere | MSAVLLAVFNEYENAQGVRLELVRDGFPTDRVELTAACEPGRAACFPAEE |
| Ga0207711_104083143 | 3300025941 | Switchgrass Rhizosphere | MSAVLLAVFDRFGDAQRVRTRLVRDGFPTDRVELTAREESGRAGLQPATS |
| Ga0207661_119165122 | 3300025944 | Corn Rhizosphere | MSAVLLAVFNDYETADRVRLELVRDGFPTDRVELTAACEPG |
| Ga0209158_11066442 | 3300026333 | Soil | MSAVLLAVFNDYEAAERVRVALVRDGFPTDRVELTACCEPGR |
| Ga0207777_10944001 | 3300027330 | Tropical Forest Soil | MSAVLLAVFGQYGDAERVRTKLVSDGFPTDRVELTASAEPGR |
| Ga0209622_10464201 | 3300027502 | Forest Soil | MSAVILAVFDEFSAAERVRTRLVSDGFPTDRVELTASCEPGRAG |
| Ga0209420_10828511 | 3300027648 | Forest Soil | MSAVILAVFSEYGAADRVRTRLVSDGFPTDRVELTAASEPG |
| Ga0209581_11592432 | 3300027706 | Surface Soil | MSAVLLAVFSDFETAERARLALFRDGFPTDRVELTAQHEPGRAVAASEPGRS |
| Ga0209689_11172531 | 3300027748 | Soil | MSAVLLAVFNEYGVADRVRTRLVGDGFPTDRVELTASCEPGRAG |
| Ga0209689_13192921 | 3300027748 | Soil | MSAVLLAVFNDYEAAERVRVALVRDGFPTDRVELTACCEPGRAG |
| Ga0209274_101843731 | 3300027853 | Soil | MSAVLLAVFNDYPTADRVRTRLVSDGFPTDRVNLTASA |
| Ga0209488_100372331 | 3300027903 | Vadose Zone Soil | MSAVLLAVFDEYQVAERVRVELVRHGFPTDRIELTAGCEPGRAG |
| Ga0209062_10503683 | 3300027965 | Surface Soil | MSAVLLAVFSDFETAERARLALFRDGFPTDRVELTAQHEP |
| Ga0318541_103244382 | 3300031545 | Soil | MSAVLLAVFGQYGDAERVRTKLVSDGFPTDRVELTSSTEPGRAGL |
| Ga0318538_103253941 | 3300031546 | Soil | MSAVLLAVFGQHGDAERVRTRLVRDGFPTDRVELTSSAEPGRAGLH |
| Ga0318571_102553801 | 3300031549 | Soil | MSAVLLAVFGQYGDAERVRTKLVSDGFPTDRVELTS |
| Ga0318555_107961292 | 3300031640 | Soil | MSAVILAVFGQYGDADRVRTKLVSDGFPTDRVELTSATEP |
| Ga0318561_103399042 | 3300031679 | Soil | MSAVLLAVFGNPADAERVRTRLVRDGFPTDRVELTSQHE |
| Ga0318561_104683301 | 3300031679 | Soil | MSAVLLAVFGQYRDAERVRIKLVSDGFPTDRVELTSS |
| Ga0310686_1174493101 | 3300031708 | Soil | MSAVLLAVFNDYDAADRVRTELVRDGFPTDRVEVT |
| Ga0318492_102293992 | 3300031748 | Soil | MSAVLLAVFGQYGDAERVRTKLVSDGFPTDRVELTSSTEPGRAGIHPAGSR |
| Ga0307477_103166891 | 3300031753 | Hardwood Forest Soil | MSAILLAVFDDHPVAERVRVSLVRDGFPTDRVELTASCEPGRAGLGP |
| Ga0307475_107725672 | 3300031754 | Hardwood Forest Soil | MSAVLLAVFDEYDVADRVRTKLVGDGFPTDRVELTAACE |
| Ga0318535_102444942 | 3300031764 | Soil | MSAVLLAVFGQHGDAERVRTRLVRDGFPTDRVELTSSAEPGRAGLHPAG |
| Ga0318535_103033542 | 3300031764 | Soil | MSAVILAVFGQYGDADRVRTKLVTDGFPTDRVELTSATEPGRAGVHPAR |
| Ga0318543_102638522 | 3300031777 | Soil | MSAVLLAVFGQHGDAERVRTRLVSDGFPTDRVELTSSAEPGRAGRHP |
| Ga0318547_104993081 | 3300031781 | Soil | MSAVLLAVFGQHGDAERVRTKLVADGFPTDRVELTAADEPGRAGLHP |
| Ga0318576_104356982 | 3300031796 | Soil | MSAVLLAVFGQYRDAERVRIKLVSDGFPTDRVELTSSAEPGRAGLHPA |
| Ga0318523_100972131 | 3300031798 | Soil | MSAVLLAVFGEYGDAERVRTQLVRDGFPTDRVELTSATEPGRAG |
| Ga0318567_102937331 | 3300031821 | Soil | MSAVLLAVFGQYRDAERVRIKLVSDGFPTDRVELTSSAEPGRAGLHPAG |
| Ga0307478_105500651 | 3300031823 | Hardwood Forest Soil | MSAVLLAVFDEYDVADRVRTKLVGDGFPTDRVELTAAC |
| Ga0318564_101966742 | 3300031831 | Soil | MSAVLLAVFGQHGDAERVRTKLVADGFPTDRVELTAADEPGRAGLHPAAS |
| Ga0318495_100388133 | 3300031860 | Soil | MSAVLLAVFGQYGDAERVRIKLVSDGFPTDRVELTA |
| Ga0318495_101693202 | 3300031860 | Soil | MSAVLLAVFGEYGDAERVRTQLVRDGFPTDRVELTSATEPGRAGVHPAGSR |
| Ga0306925_114206251 | 3300031890 | Soil | MSAVLLAVFGQYRDAERVRTRLVSDGFPTDRVELTSST |
| Ga0318520_106489941 | 3300031897 | Soil | MSAVILAVFGQYGDADRVRTKLVSDGFPTDRVELTSATEPGRAGVHPA |
| Ga0306923_112004511 | 3300031910 | Soil | MSAVLLAVFGQHGDAERVRTRLVRDGFPTDRVELTSSAEPGRARVDPAGSKRA |
| Ga0310913_105790351 | 3300031945 | Soil | MSAVLLAVFGQYGDAERVRTKLVSDGFPTDRVELTSSTEPGRAGIHPAGSRRAK |
| Ga0310913_110831971 | 3300031945 | Soil | MSAVLLAVFGQYRDAERVRIKLVSDGFPTDRVELTSSA |
| Ga0310909_101927831 | 3300031947 | Soil | MSAVLLAVFGEYGDAERVRTQLVRDGFPTDRVELTSATEPGRAGVHPAG |
| Ga0307479_108201921 | 3300031962 | Hardwood Forest Soil | MRAILLAVFDDHSVAERVRVSLVRAGFPTDRVEQTA |
| Ga0318569_100717281 | 3300032010 | Soil | MSAVLLAVFGQYGDAERVRIKLVSDGFPTDRVELTAAAEPGRAG |
| Ga0318532_101127301 | 3300032051 | Soil | MSAVLLAVFGQYGDAERVRIKLVSDGFPTDRVELTAAAEPGRAGLQPADSR |
| Ga0318532_102908202 | 3300032051 | Soil | MSAVLLAVFGQFRDAERVRTRLVSDGFPTDRVELTSATEPGRAGLH |
| Ga0318505_105627002 | 3300032060 | Soil | MSAVLLAVFNEYGVADRVRTKLVRDGFPSDRVELTASV |
| Ga0318525_103241681 | 3300032089 | Soil | MSAVLLAVFGQYRDAERVRIKLVSDGFPTDRVELTS |
| Ga0318518_102982873 | 3300032090 | Soil | MSAVLLAVFGQYRDAERVRTRLVSDGFPTDRVELTSSTEPGRAG |
| Ga0307471_1022974401 | 3300032180 | Hardwood Forest Soil | MSAVLLAVFNRFADAERVRTRLVRDGFPTDRVELTAR |
| Ga0307472_1018558852 | 3300032205 | Hardwood Forest Soil | MSAVLLAVFSEYGDADRVRTRLVRDGFPTDRVELTAQSDRGRA |
| Ga0310812_100357531 | 3300032421 | Soil | MSAVLLAVFGQYGDAERVRTKLVSDGFPTDRVELTSQGEPGR |
| Ga0335080_123126152 | 3300032828 | Soil | MSAVILAVFNEYSAADRVRTRLVSDGFPTDRVELTAS |
| Ga0335069_122046542 | 3300032893 | Soil | MSAVLLAVFNHYDDAERVRTHLVSDGFPTDRVELTGVREPGRAGE |
| Ga0335073_106193712 | 3300033134 | Soil | MSAVLLAVFSDFDTAERARLALFRDGFPTDRIELTARGEPGRAGRGA |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |