NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F082105

Metagenome / Metatranscriptome Family F082105

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F082105
Family Type Metagenome / Metatranscriptome
Number of Sequences 113
Average Sequence Length 45 residues
Representative Sequence MAAPLMHEPPRCAGQPNATVQPAVAGTVMPIDSVGSGRVNEKK
Number of Associated Samples 90
Number of Associated Scaffolds 113

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 22.12 %
% of genes from short scaffolds (< 2000 bps) 89.38 %
Associated GOLD sequencing projects 87
AlphaFold2 3D model prediction Yes
3D model pTM-score0.13

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (96.460 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands
(19.469 % of family members)
Environment Ontology (ENVO) Unclassified
(32.743 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(43.363 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Fibrous Signal Peptide: No Secondary Structure distribution: α-helix: 0.00%    β-sheet: 0.00%    Coil/Unstructured: 100.00%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.13
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 113 Family Scaffolds
PF00665rve 10.62
PF01695IstB_IS21 2.65
PF02899Phage_int_SAM_1 1.77
PF05280FlhC 0.88
PF00072Response_reg 0.88
PF13565HTH_32 0.88
PF01609DDE_Tnp_1 0.88
PF13384HTH_23 0.88
PF00078RVT_1 0.88
PF12161HsdM_N 0.88
PF13683rve_3 0.88

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 113 Family Scaffolds
COG2801Transposase InsO and inactivated derivativesMobilome: prophages, transposons [X] 10.62
COG2826Transposase and inactivated derivatives, IS30 familyMobilome: prophages, transposons [X] 10.62
COG3316Transposase (or an inactivated derivative), DDE domainMobilome: prophages, transposons [X] 10.62
COG4584TransposaseMobilome: prophages, transposons [X] 10.62
COG1484DNA replication protein DnaCReplication, recombination and repair [L] 2.65
COG4973Site-specific recombinase XerCReplication, recombination and repair [L] 1.77
COG4974Site-specific recombinase XerDReplication, recombination and repair [L] 1.77
COG3039Transposase and inactivated derivatives, IS5 familyMobilome: prophages, transposons [X] 0.88
COG3293TransposaseMobilome: prophages, transposons [X] 0.88
COG3385IS4 transposase InsGMobilome: prophages, transposons [X] 0.88
COG5421TransposaseMobilome: prophages, transposons [X] 0.88
COG5433Predicted transposase YbfD/YdcC associated with H repeatsMobilome: prophages, transposons [X] 0.88
COG5659SRSO17 transposaseMobilome: prophages, transposons [X] 0.88

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms96.46 %
UnclassifiedrootN/A3.54 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000121|TDF_OR_ARG04_113mDRAFT_c1036339All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium581Open in IMG/M
3300000122|TDF_OR_ARG04_123mDRAFT_c1000202All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales4600Open in IMG/M
3300000130|SA_S2_NOR15_50mDRAFT_c10075557All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1290Open in IMG/M
3300000241|BS_KBA_SWE21_205mDRAFT_10090556All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium665Open in IMG/M
3300000242|TDF_OR_ARG05_123mDRAFT_1021326All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1535Open in IMG/M
3300001750|JGI24023J19991_10152385All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium655Open in IMG/M
3300002495|BRMGV_1033187All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1124Open in IMG/M
3300002988|FeGlu_10137760All Organisms → cellular organisms → Bacteria → Proteobacteria3308Open in IMG/M
3300004005|Ga0055448_10101626All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1081Open in IMG/M
3300004022|Ga0055432_10025025All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1280Open in IMG/M
3300004058|Ga0055498_10014452All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1089Open in IMG/M
3300004070|Ga0055488_10132837All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium634Open in IMG/M
3300005590|Ga0070727_10280351All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria929Open in IMG/M
3300005600|Ga0070726_10292509All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium822Open in IMG/M
3300005612|Ga0070723_10256042All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium814Open in IMG/M
3300005821|Ga0078746_1030544All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1131Open in IMG/M
3300005832|Ga0074469_10674332All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1296Open in IMG/M
3300005836|Ga0074470_10207367All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales1660Open in IMG/M
3300008465|Ga0115360_10002174All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium2236Open in IMG/M
3300009035|Ga0102958_1180090All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium697Open in IMG/M
3300009515|Ga0129286_10312847All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium570Open in IMG/M
3300009702|Ga0114931_10057415All Organisms → cellular organisms → Bacteria → Proteobacteria3726Open in IMG/M
3300010392|Ga0118731_109110813All Organisms → cellular organisms → Bacteria → Proteobacteria2143Open in IMG/M
3300010392|Ga0118731_110097853All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium501Open in IMG/M
3300010392|Ga0118731_112671057All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria1107Open in IMG/M
3300010392|Ga0118731_114236286All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1518Open in IMG/M
3300010430|Ga0118733_102651900All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium989Open in IMG/M
3300010430|Ga0118733_103778935All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium817Open in IMG/M
3300010969|Ga0139246_1096775All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1224Open in IMG/M
3300010997|Ga0139324_1147841All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria632Open in IMG/M
3300011262|Ga0151668_1060573All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium579Open in IMG/M
3300014260|Ga0075307_1036421Not Available908Open in IMG/M
3300014264|Ga0075308_1013837All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1412Open in IMG/M
3300014264|Ga0075308_1026093All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1063Open in IMG/M
3300014295|Ga0075305_1030256All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium944Open in IMG/M
3300014295|Ga0075305_1082741All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium628Open in IMG/M
3300014296|Ga0075344_1049219All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium754Open in IMG/M
3300014296|Ga0075344_1059097All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium708Open in IMG/M
3300014297|Ga0075306_1060254All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium664Open in IMG/M
3300014299|Ga0075303_1046194All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium728Open in IMG/M
3300014874|Ga0180084_1069030All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium720Open in IMG/M
3300019696|Ga0194017_1001961All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1545Open in IMG/M
3300019713|Ga0193987_1009664All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium SG8_30943Open in IMG/M
3300019714|Ga0193975_1027037All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium658Open in IMG/M
3300019718|Ga0193999_1007348All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1047Open in IMG/M
3300019732|Ga0194014_1000506All Organisms → cellular organisms → Bacteria → Proteobacteria3350Open in IMG/M
3300019738|Ga0193994_1040611All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium628Open in IMG/M
3300019739|Ga0194012_1032994All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium658Open in IMG/M
3300022206|Ga0224499_10205314All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium671Open in IMG/M
3300022306|Ga0224509_10284442All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium600Open in IMG/M
(restricted) 3300022938|Ga0233409_10018358All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1795Open in IMG/M
(restricted) 3300022938|Ga0233409_10227405All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium636Open in IMG/M
(restricted) 3300024057|Ga0255051_10147622All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium836Open in IMG/M
3300025521|Ga0210083_1019083All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium952Open in IMG/M
3300025550|Ga0210098_1040226All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium744Open in IMG/M
3300025551|Ga0210131_1046254All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium698Open in IMG/M
3300025558|Ga0210139_1083654All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium653Open in IMG/M
3300025560|Ga0210108_1053224All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium777Open in IMG/M
3300025563|Ga0210112_1099455All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium598Open in IMG/M
3300025565|Ga0210110_1002676All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria5125Open in IMG/M
3300025565|Ga0210110_1033677All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1284Open in IMG/M
3300025565|Ga0210110_1058548All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium935Open in IMG/M
3300025797|Ga0210062_1024043All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1522Open in IMG/M
3300025801|Ga0210097_1018877All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1517Open in IMG/M
3300025801|Ga0210097_1026927All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1281Open in IMG/M
3300025813|Ga0210064_1001992Not Available7989Open in IMG/M
3300025823|Ga0210123_1033855Not Available1753Open in IMG/M
3300025883|Ga0209456_10222174All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium800Open in IMG/M
3300025895|Ga0209567_10415346All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium648Open in IMG/M
3300025895|Ga0209567_10469701All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium609Open in IMG/M
3300025947|Ga0210067_1007932All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1300Open in IMG/M
3300025954|Ga0210135_1025499All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium619Open in IMG/M
3300025977|Ga0210072_1048323All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium569Open in IMG/M
3300026007|Ga0210124_1142939All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium761Open in IMG/M
3300026012|Ga0208653_1005146All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1094Open in IMG/M
3300027612|Ga0209037_1119630All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium640Open in IMG/M
3300027790|Ga0209273_10313951All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium635Open in IMG/M
3300027822|Ga0209633_10446327All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium594Open in IMG/M
(restricted) 3300027865|Ga0255052_10170684All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1062Open in IMG/M
(restricted) 3300027881|Ga0255055_10243473All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium976Open in IMG/M
3300028598|Ga0265306_10190053All Organisms → cellular organisms → Bacteria → Proteobacteria1086Open in IMG/M
3300028598|Ga0265306_10206045All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1043Open in IMG/M
3300028598|Ga0265306_10416515All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium731Open in IMG/M
3300028598|Ga0265306_10587175All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium613Open in IMG/M
3300028598|Ga0265306_10625321All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium594Open in IMG/M
3300028599|Ga0265309_10665628All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium704Open in IMG/M
3300028600|Ga0265303_10795565All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium776Open in IMG/M
3300031371|Ga0307423_1081403All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1001Open in IMG/M
3300031539|Ga0307380_10108034All Organisms → cellular organisms → Bacteria → Proteobacteria2851Open in IMG/M
3300031553|Ga0315547_1052725All Organisms → cellular organisms → Bacteria → Proteobacteria1541Open in IMG/M
3300031565|Ga0307379_10077810All Organisms → cellular organisms → Bacteria → Proteobacteria3674Open in IMG/M
3300031665|Ga0316575_10102314All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1165Open in IMG/M
3300031727|Ga0316576_10435724All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium969Open in IMG/M
3300031728|Ga0316578_10387330All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium829Open in IMG/M
3300032061|Ga0315540_10218236All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium819Open in IMG/M
3300032136|Ga0316201_10940648All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium728Open in IMG/M
3300032168|Ga0316593_10162210All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium817Open in IMG/M
3300032231|Ga0316187_10028793All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales4541Open in IMG/M
3300032231|Ga0316187_10448868All Organisms → cellular organisms → Bacteria → Proteobacteria970Open in IMG/M
3300032231|Ga0316187_10476015All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium938Open in IMG/M
3300032231|Ga0316187_10667563All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium771Open in IMG/M
3300032251|Ga0316198_10540543All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium636Open in IMG/M
3300032252|Ga0316196_10385423All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium601Open in IMG/M
3300032258|Ga0316191_10644356All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium769Open in IMG/M
3300032259|Ga0316190_10226893Not Available1290Open in IMG/M
3300032259|Ga0316190_10629520All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium715Open in IMG/M
3300032259|Ga0316190_10793590All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium625Open in IMG/M
3300032260|Ga0316192_10442357All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium887Open in IMG/M
3300032260|Ga0316192_10452317All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium876Open in IMG/M
3300032260|Ga0316192_10746040All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium659Open in IMG/M
3300032262|Ga0316194_10632986All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium673Open in IMG/M
3300032272|Ga0316189_10121149All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → Sedimenticola → Sedimenticola selenatireducens2113Open in IMG/M
3300032273|Ga0316197_10463403All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium677Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands19.47%
Worm BurrowEnvironmental → Aquatic → Marine → Coastal → Sediment → Worm Burrow11.50%
Natural And Restored WetlandsEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands8.85%
SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment6.19%
Marine SedimentEnvironmental → Aquatic → Marine → Coastal → Sediment → Marine Sediment6.19%
SedimentEnvironmental → Aquatic → Marine → Subtidal Zone → Sediment → Sediment6.19%
SeawaterEnvironmental → Aquatic → Marine → Inlet → Unclassified → Seawater4.42%
MarineEnvironmental → Aquatic → Marine → Coastal → Sediment → Marine3.54%
SedimentEnvironmental → Aquatic → Marine → Coastal → Sediment → Sediment3.54%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere3.54%
MarineEnvironmental → Aquatic → Marine → Intertidal Zone → Sediment → Marine2.65%
Pelagic MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine2.65%
Salt Marsh SedimentEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh Sediment1.77%
SedimentEnvironmental → Aquatic → Marine → Sediment → Unclassified → Sediment1.77%
MarineEnvironmental → Aquatic → Marine → Oil Seeps → Unclassified → Marine1.77%
Sediment (Intertidal)Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal)1.77%
SoilEnvironmental → Terrestrial → Soil → Clay → Unclassified → Soil1.77%
SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Sediment0.89%
Mangrove SoilEnvironmental → Aquatic → Marine → Oceanic → Oil-Contaminated Sediment → Mangrove Soil0.89%
MarineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Marine0.89%
MarineEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine0.89%
MarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Marine0.89%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh0.89%
MarineEnvironmental → Aquatic → Marine → Wetlands → Sediment → Marine0.89%
Hydrothermal Chimney Microbial MatEnvironmental → Aquatic → Marine → Hydrothermal Vents → Microbial Mats → Hydrothermal Chimney Microbial Mat0.89%
Deep SubsurfaceEnvironmental → Aquatic → Marine → Volcanic → Unclassified → Deep Subsurface0.89%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil0.89%
SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment0.89%
SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment0.89%
Wetland SedimentEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Wetland Sediment0.89%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil0.89%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000121Marine microbial communities from chronically polluted sediments in Tierra del Fuego - site MC sample ARG 03_11.3mEnvironmentalOpen in IMG/M
3300000122Marine microbial communities from chronically polluted sediments in Tierra del Fuego - site OR sample ARG 04_12.3mEnvironmentalOpen in IMG/M
3300000130Marine microbial communities from chronically polluted sediments in Adventfjord, Norway - Svalbard Archipelago station 2 sample NOR 15_50mEnvironmentalOpen in IMG/M
3300000241Marine microbial communities from chronically polluted sediments in the Baltic Sea - site KBB sample SWE 21_20.5mEnvironmentalOpen in IMG/M
3300000242Marine microbial communities from chronically polluted sediments in Tierra del Fuego: Site OR sample ARG 05_12.3mEnvironmentalOpen in IMG/M
3300001750Oil polluted marine microbial communities from Coal Oil Point, Santa Barbara, California, USA - Sample 1EnvironmentalOpen in IMG/M
3300002495454 Fosmid SequenceEnvironmentalOpen in IMG/M
3300002988Fe-reducing enrichment culture from wetland sample 1EnvironmentalOpen in IMG/M
3300004005Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - China_Galinas_PWA_D2EnvironmentalOpen in IMG/M
3300004022Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqA_D1EnvironmentalOpen in IMG/M
3300004058Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqB_D1EnvironmentalOpen in IMG/M
3300004070Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqA_D2EnvironmentalOpen in IMG/M
3300005590Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd47.2EnvironmentalOpen in IMG/M
3300005600Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd47.1EnvironmentalOpen in IMG/M
3300005612Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd00.2EnvironmentalOpen in IMG/M
3300005821Marine sediment microbial communities from Aarhus Bay station M5, Denmark - 25 cmbsf, PM1EnvironmentalOpen in IMG/M
3300005832Microbial communities from Baker Bay sediment, Columbia River estuary, Washington - S.41_BBBEnvironmentalOpen in IMG/M
3300005836Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.42_YBBEnvironmentalOpen in IMG/M
3300008465Sea floor sediment microbial communities from Gulf of Mexico Methane Seep - MPC5BEnvironmentalOpen in IMG/M
3300009035Salt pond soil microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_B_D1_MGEnvironmentalOpen in IMG/M
3300009515Microbial community of beach aquifer sediment core from Cape Shores, Lewes, Delaware, USA - CF-2EnvironmentalOpen in IMG/M
3300009702Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 2SBTROV14_V59a metaGEnvironmentalOpen in IMG/M
3300010392Coastal sediment microbial communities from Rhode Island, USA. Combined Assembly of Gp0121717, Gp0123912, Gp0123935, Gp0139423, Gp0139424, Gp0139388, Gp0139387, Gp0139386, Gp0139385EnvironmentalOpen in IMG/M
3300010430Marine sediment microbial communities from Gulf of Thailand under amendment with organic carbon and nitrate - JGI co-assembly of 8 samplesEnvironmentalOpen in IMG/M
3300010969Microbial communities from the outside layer of the microbial mat covering an inactive hydrothermal chimney from the Kolumbo submarine volcano, Santorini, Greece - V16_c.outEnvironmentalOpen in IMG/M
3300010997ECM15MPS05_Aassembled -- Sediment microbial communities from coastal marsh in Port Sulphur, LA sequencing method A (2X250bp)EnvironmentalOpen in IMG/M
3300011262Marine sediment microbial communities from Japan Sea near Toyama Prefecture, Japan - 2015_5, totalEnvironmentalOpen in IMG/M
3300014260Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Joice_ThreeSqA_D1_rdEnvironmentalOpen in IMG/M
3300014264Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Joice_ThreeSqA_D2_rdEnvironmentalOpen in IMG/M
3300014295Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Joice_CattailNLB_D1EnvironmentalOpen in IMG/M
3300014296Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqC_D1EnvironmentalOpen in IMG/M
3300014297Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Joice_CattailNLC_D1EnvironmentalOpen in IMG/M
3300014299Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleC_D1EnvironmentalOpen in IMG/M
3300014874Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT660_2_16_10DEnvironmentalOpen in IMG/M
3300019696Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? BRC_3-4_MGEnvironmentalOpen in IMG/M
3300019713Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? FRC_3-4_MGEnvironmentalOpen in IMG/M
3300019714Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? FRT_2-3_MGEnvironmentalOpen in IMG/M
3300019718Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? FLT_5-6_MGEnvironmentalOpen in IMG/M
3300019732Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? BRC_0-1_MGEnvironmentalOpen in IMG/M
3300019738Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? FLT_0-1_MGEnvironmentalOpen in IMG/M
3300019739Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? FLC_8-9_MGEnvironmentalOpen in IMG/M
3300022206Sediment microbial communities from San Francisco Bay, California, United States - SF_Jul11_sed_USGS_24EnvironmentalOpen in IMG/M
3300022306Sediment microbial communities from San Francisco Bay, California, United States - SF_Jan12_sed_USGS_24EnvironmentalOpen in IMG/M
3300022938 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_oxic_13_MGEnvironmentalOpen in IMG/M
3300024057 (restricted)Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_9EnvironmentalOpen in IMG/M
3300025521Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqB_D1 (SPAdes)EnvironmentalOpen in IMG/M
3300025550Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Joice_ThreeSqA_D1 (SPAdes)EnvironmentalOpen in IMG/M
3300025551Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqA_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300025558Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleB_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300025560Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqB_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300025563Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Joice_ThreeSqC_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300025565Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - China_Galinas_PWB_D1 (SPAdes)EnvironmentalOpen in IMG/M
3300025797Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Muzzi_CordA_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300025801Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Joice_CattailNLA_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300025813Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Muzzi_CordC_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300025823Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Muzzi_PWB_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300025883Pelagic marine sediment microbial communities from the LTER site Helgoland, North Sea, for post-phytoplankton bloom and carbon turnover studies - COGITO 998_met_11 (SPAdes)EnvironmentalOpen in IMG/M
3300025895Pelagic marine sediment microbial communities from the LTER site Helgoland, North Sea, for post-phytoplankton bloom and carbon turnover studies - COGITO 998_met_12 (SPAdes)EnvironmentalOpen in IMG/M
3300025947Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushMan_ThreeSqB_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300025954Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqC_D1 (SPAdes)EnvironmentalOpen in IMG/M
3300025977Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - White_ThreeSqB_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300026007Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Muzzi_PWC_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300026012Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Joice_CattailNLB_D1 (SPAdes)EnvironmentalOpen in IMG/M
3300027612Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_125SG_5_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300027790Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd47.1 (SPAdes)EnvironmentalOpen in IMG/M
3300027822Oil polluted marine microbial communities from Coal Oil Point, Santa Barbara, California, USA - Sample 1 (SPAdes)EnvironmentalOpen in IMG/M
3300027865 (restricted)Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_21EnvironmentalOpen in IMG/M
3300027881 (restricted)Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_27EnvironmentalOpen in IMG/M
3300028598Marine sediment microbial communities from subtidal zone of North Sea - Hel_20160420 (Illumina Assembly)EnvironmentalOpen in IMG/M
3300028599Marine sediment microbial communities from subtidal zone of North Sea - Hel_20160524 (Illumina Assembly)EnvironmentalOpen in IMG/M
3300028600Marine sediment microbial communities from subtidal zone of North Sea - Hel_20160317 (Illumina Assembly)EnvironmentalOpen in IMG/M
3300031371Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - WE1603-10EnvironmentalOpen in IMG/M
3300031539Soil microbial communities from Risofladan, Vaasa, Finland - UN-3EnvironmentalOpen in IMG/M
3300031553Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - Salt Marsh Sediment SW1601-240EnvironmentalOpen in IMG/M
3300031565Soil microbial communities from Risofladan, Vaasa, Finland - UN-2EnvironmentalOpen in IMG/M
3300031665Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3Host-AssociatedOpen in IMG/M
3300031727Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5Host-AssociatedOpen in IMG/M
3300031728Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrCHost-AssociatedOpen in IMG/M
3300032061Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - Salt Marsh Sediment SW1601-10EnvironmentalOpen in IMG/M
3300032136Coastal sediment microbial communities from Delaware Bay, Delaware, United States - CS-6 worm burrowEnvironmentalOpen in IMG/M
3300032168Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032231Coastal sediment microbial communities from Maine, United States - Cross River worm burrow 1EnvironmentalOpen in IMG/M
3300032251Coastal sediment microbial communities from Oude Bieten Haven, Netherlands - site A anoxicEnvironmentalOpen in IMG/M
3300032252Coastal sediment microbial communities from Maine, United States - Eddy sediment 2 cmEnvironmentalOpen in IMG/M
3300032258Coastal sediment microbial communities from Maine, United States - Eddy worm burrow 2 cmEnvironmentalOpen in IMG/M
3300032259Coastal sediment microbial communities from Maine, United States - Eddy worm burrow 2EnvironmentalOpen in IMG/M
3300032260Coastal sediment microbial communities from Maine, United States - Merrow Island worm burrowEnvironmentalOpen in IMG/M
3300032262Coastal sediment microbial communities from Maine, United States - Cross River sediment 1EnvironmentalOpen in IMG/M
3300032272Coastal sediment microbial communities from Maine, United States - Lowes Cove worm burrowEnvironmentalOpen in IMG/M
3300032273Coastal sediment microbial communities from Oude Bieten Haven, Netherlands - site A oxicEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
TDF_OR_ARG04_113mDRAFT_103633923300000121MarineMAAPLMHESPRCAGQPYATAQPAVAGTITRIDSVDSARVSEKKYKK*
TDF_OR_ARG04_123mDRAFT_100020263300000122MarineMAAPLMHEPPRCAGQLNATAQRAVAGTVMRIDSADSGRDNEKKYQK*
SA_S2_NOR15_50mDRAFT_1007555723300000130MarineMAAPLMREPTRCTVQPNVTVQRAVASTIMRIDSVDSGRVNKKK*
BS_KBA_SWE21_205mDRAFT_1009055613300000241MarineMAALIWRDPPRCAEQPYATVQRAVASTIMRIDSVDSGRVKEKKHKK*
TDF_OR_ARG05_123mDRAFT_102132613300000242MarineMFTALMAAPLMHEPPRCAGQLNATAQRAVAGTVMRIDSADSGRDNEKKYQK*
JGI24023J19991_1015238513300001750MarineMFIAPMAAPLMHEPPRCAGQPYATAQPAVAGTIMRIDSVDSGRVNEKK*
BRMGV_103318723300002495Mangrove SoilVLIGRDPPRCAGQPNATVQPAVAGTVMPIDSVGSGRVNEKK*
FeGlu_1013776053300002988Wetland SedimentMAALIWRDPPRCTGQPNVTVQRAVASTIMRIDSVGSGRANEKK*
Ga0055448_1010162613300004005Natural And Restored WetlandsMFIARMAAPTMHEPLRCAEQPNATAQLAVAGTVMRIDSVDSGRVNEKK*
Ga0055432_1002502513300004022Natural And Restored WetlandsMAAPLMREPTRCTVQPNVTVQRAVASTLMRIDSVDSGRVNEKK*
Ga0055498_1001445223300004058Natural And Restored WetlandsMAAPLMREPTRCTVQPNVTVQRAVAGTVMRIDSVDSGRVKEKKYKK*
Ga0055488_1013283723300004070Natural And Restored WetlandsIAPMAAPTMHEPPRCAARPNATVQRAVAGTVMRIDSAGSGRANEKK*
Ga0070727_1028035123300005590Marine SedimentMVALIWRDPPRCAGQPNATVQPAVAGTVMPIDSVGSGRVNEKK*
Ga0070726_1029250923300005600Marine SedimentALIWRDPPRCTVQPNVTVQRAVASTIMRIDSVDSGRVNEKK*
Ga0070723_1025604213300005612Marine SedimentMVVLIWRDPPRCAGQPNATVQPAVAGTVMPIDSVGSGRVNEKK*
Ga0078746_103054423300005821Marine SedimentMVVLIWRDPPRCAGQPNATVQPAVAGTVMPIDSVGSGRVNEKKYQK*
Ga0074469_1067433223300005832Sediment (Intertidal)MAAPLMHEPPRCAGQPNVTVQRAVAGTIMPIDSVDSARVNEKKYKK*
Ga0074470_1020736723300005836Sediment (Intertidal)MSIAPMAAPTMHEPPRCAEQPNVTVQRAVASTVMRIDSVGSGRVSEKK*
Ga0115360_1000217423300008465SedimentMTALIWRDQTRCTVQPNXTVQRAVASTIMRIDSAGSGRVNDKK*
Ga0102958_118009013300009035SoilMVVLIWRDPPRCAGQPNATVQPAVAGTRMRIDSAASGRVNEKK*
Ga0129286_1031284713300009515SedimentVLIWRDPPRCAGQPNATVQPAVAGTVMPIDSVGSGRVNEKK*
Ga0114931_1005741513300009702Deep SubsurfaceMAVLIWRDQTRCNEQPNVTVQHAVASTIMRIDSADSGRANDKK*
Ga0118731_10911081313300010392MarineMSIALTAALISRDPPRCAERPNATVQRAVAGTVMRTDSVGSGRVNEKKYQK*
Ga0118731_11009785313300010392MarineMAALIWHDPIRCTAQPNATVQLAVVSTVMRLDSIGSGRVNEKK*
Ga0118731_11267105723300010392MarineMVVLIWRDPPRCVGHLNATVQPAVAGTRMRIDSTDSGRVNEKK*
Ga0118731_11423628643300010392MarineMFIALMAAPLMREPPRCAGPPNATVQPAVAGTIMRIDSTDSGRANEKKHQK*
Ga0118733_10265190023300010430Marine SedimentMSIALTAALISREPPRCAEWPNATVQRAMAGTVMRIDSVGSGRVNEKKYQK*
Ga0118733_10377893513300010430Marine SedimentMFTALMAAPLMHEPPRCTGQLNATAQRAVAGTVMRIDSADSGRDNEKK*
Ga0139246_109677523300010969Hydrothermal Chimney Microbial MatMFIAPMAVLIWRDPHRCAEPPSVTVQRVVAGTIMRIDSAASGRANEKKYQK*
Ga0139324_114784113300010997SedimentMSIALLAVPIRHDPIRCAERPNATVQLAVAGTIMRIDSADSGRVNEKK*
Ga0151668_106057313300011262MarineMAVLILRDPPRCAGQPNATVQPAVAGTVMRIDSAGSGRVNEKK*
Ga0075307_103642123300014260Natural And Restored WetlandsALTAAPIWREPPRCTVQPNVTVQPVAAGTVMRIDSVDSGRVKDKKYKK*
Ga0075308_101383713300014264Natural And Restored WetlandsMFIALTAAPIWREPPRCTVQPNVTVQPVAAGTVMRIDSVDSGRVNEKKYKK*
Ga0075308_102609313300014264Natural And Restored WetlandsMFIAPMAAPTMHEPPRCAARPNATVQRAVAGTVMRIDSAGSGRANEKK*
Ga0075305_103025623300014295Natural And Restored WetlandsMFIALTAAPIWREPPRCTVQPNVTVQPVAAGTVMRIDSVDSGRVNEKK*
Ga0075305_108274113300014295Natural And Restored WetlandsMFIAPMAAPLMRAPPHCAEPPYATVQPAVAGTVMRIDSVGSGRVSEKK*
Ga0075344_104921913300014296Natural And Restored WetlandsMFIAPMAAPTMHEPPRCAERPNATVQRAVAGTVMRIDSAGSGRANEKK*
Ga0075344_105909723300014296Natural And Restored WetlandsMAAPLMREPTRCTVQPNVTVQRAVASTVMRIDSVDSGRVNEKK*
Ga0075306_106025423300014297Natural And Restored WetlandsMSIAPMAAPTMHEPPRCAARPNATVQRAVAGTVMRIDSAGSGRANEKK*
Ga0075303_104619413300014299Natural And Restored WetlandsMFIVPMAAPTMHEPPHCAEQPNVTVQRAVAGTVMRIDSVDSGRVKEKKYKK*
Ga0180084_106903023300014874SoilMFIAPMAAPLMRAPPHCAEPPYATVQPAVAGTVMRIDSVGSGRASEKK*
Ga0194017_100196133300019696SedimentMVVLIWRDPPRCAGQPNATVQPAVAGTVMPIDSVGSGRVNEKK
Ga0193987_100966423300019713SedimentMVVLIWRDPPRCAGQPNATVQPAVAGTVMPIDSVGSGR
Ga0193975_102703723300019714SedimentSIVRMVVLIWRDPPRCAGQPNATVQPAVAGTVMPIDSVGSGRVNEKK
Ga0193999_100734823300019718SedimentVLIWRDPPRCAGQPNATVQPAVAGTVMPIDSVGSGRVNEKK
Ga0194014_100050613300019732SedimentMAAPLMHEPPRCAGQPNATVQPAVAGTVMPIDSDGSGRVNEKK
Ga0193994_104061123300019738SedimentMAAPLMHEPPRCAGQPNATAQRAVAGTLMRIDSADSGRDNEKK
Ga0194012_103299423300019739SedimentMAAPLMHEPPRCAGQPNATVQPAVAGTVMPIDSVGSGRVNEKK
Ga0224499_1020531413300022206SedimentMVVLIWRAPPRCAGQPNATVQPAVAGTVMPIDSVGSGRVNEKK
Ga0224509_1028444213300022306SedimentPPRCAGQPNATAQRAVAGTVMRIDSADSGRDNEKK
(restricted) Ga0233409_1001835823300022938SeawaterMVVLIWRDPPRCTVQPNVTVQRAVASTIMRIDSVGSGRVNEKK
(restricted) Ga0233409_1022740523300022938SeawaterMAAPLMHEPPRCAGQPNATAQRAVAGTVMRIDSADSGRDNEKK
(restricted) Ga0255051_1014762223300024057SeawaterMAVLIWHDPIRCTAQPNATVQPAVAGTVMRIDSIGSERVNEKK
Ga0210083_101908323300025521Natural And Restored WetlandsMAAPLMREPTRCTVQPNVTVQRAVASTLMRIDSVDSGRVNEKK
Ga0210098_104022623300025550Natural And Restored WetlandsMAAPLMREPTRCTVQPNVTVQRAVAGTVMRIDSVDSGRVKEKKYKK
Ga0210131_104625423300025551Natural And Restored WetlandsVTAVMSIARMAAPIWRDPPRCAGQPYATVQRAVASTIMRIDSVDSGRVKEKKHKK
Ga0210139_108365413300025558Natural And Restored WetlandsTAAMFIVPMAAPTMHEPPHCAEQPNVTVQRAVAGTVMRIDSVDSGRVNEKK
Ga0210108_105322413300025560Natural And Restored WetlandsMFIVPMAAPTMHEPPHCAEQPNVTVQRAVAGTVMRIDSVDSGRVNEKK
Ga0210112_109945513300025563Natural And Restored WetlandsAVTSIALTTALIWRDPPRCTEQPNVTVQRAVAGTVMRIDSAGSGRVNEKK
Ga0210110_100267663300025565Natural And Restored WetlandsMFIVPMAAPTMHELPHCAEQPNVTVQRAVAGTVMRIDSVGSGRVNEKK
Ga0210110_103367713300025565Natural And Restored WetlandsMFIARMAAPTMHEPLRCAEQPNATAQLAVAGTVMRIDSVDSGRVNEKK
Ga0210110_105854823300025565Natural And Restored WetlandsMAAPFMREPPRFVGQPNATVQHAVVGTVMRVDSVDSERVNEKK
Ga0210062_102404323300025797Natural And Restored WetlandsMAAPLMREPTRYTVQPNVTVQRAVASTLMRIDSVDSGRVNEKK
Ga0210097_101887723300025801Natural And Restored WetlandsMFIVPMAAPTMHEPPHYAEQPNVTVQRAVAGTVMRIDSVGSGRVNEKK
Ga0210097_102692723300025801Natural And Restored WetlandsMSIALTAALIWRDPPRCAERPNATVQRAVAGTVMRIDSAGSGRVSEKK
Ga0210064_100199253300025813Natural And Restored WetlandsMVALIWRDPPRCAGQPNATVQPVVAGTVMPIDSVGSGRVNEKKYQK
Ga0210123_103385523300025823Natural And Restored WetlandsMREPTRYTVQPNVTVQRAVASTLMRIDSVDSGRVNEKK
Ga0209456_1022217413300025883Pelagic MarineMSIALTAVRIWRDPPRCAERPNATVQRAVAGTVMRIDSVASGRVNEKK
Ga0209567_1041534623300025895Pelagic MarineMAAPLMHESPRCAGQPNATAQRAVAGTVMRIDSADSGRDNEKK
Ga0209567_1046970123300025895Pelagic MarineVLSWRDPPRCAGQPNATVQPAVAGTVMPIDSVGSGRVNEKK
Ga0210067_100793213300025947Natural And Restored WetlandsMFIAPMAAPTMHEPPRCAARPNATVQRAVAGTVMRIDSAGSGRANEKK
Ga0210135_102549913300025954Natural And Restored WetlandsTSIVRMAAPLMREPTRCTVQPNVTVQRAVASTLMRIDSVDSGRVNEKK
Ga0210072_104832313300025977Natural And Restored WetlandsAAPLMHEPPRYAGQPNVTVQRAVASTIMRIDSAGSGRVNEKKYKK
Ga0210124_114293913300026007Natural And Restored WetlandsMFIARMAAPTMHEPLRCAEQPNATAQLAVAGTVMRIDSADSGRVNEKK
Ga0208653_100514623300026012Natural And Restored WetlandsMSIAPMAAPTMHEPPRCAARPNATVQRAVAGTVMRIDSAGSGRANEKK
Ga0209037_111963023300027612MarineSIALTAARIWHDQPRCTEQPNVTVQPAVASTIMRIDSVDSGRVNEKK
Ga0209273_1031395123300027790Marine SedimentMAAPLMHEPPRCTGQLNATAQRAVAGTVMRIDSADSGRDNEKK
Ga0209633_1044632713300027822MarineMFIAPMAAPLMHEPPRCAGQPYATAQPAVAGTIMRIDSVDSGRVNEKK
(restricted) Ga0255052_1017068423300027865SeawaterTLTAATSIVRMAVLIWHDPIRCTAQPNATVQPAVAGTVMRIDSIGSERVNEKK
(restricted) Ga0255055_1024347323300027881SeawaterMAVLIWHDPIRCTAQPNATVQPAVVSTVMRLDRFGSERVNEKK
Ga0265306_1019005323300028598SedimentAPLMHEPPRCAGQLNATAQRAVAGTVMRIDSADSGRDNEKK
Ga0265306_1020604523300028598SedimentMSIARTAALIWRDRPRCAERPNATVQPAVAGTLMRIDSVGSGRVNEKK
Ga0265306_1041651523300028598SedimentMAAPLMHEPPRCAGQPNATAQHAVAGTVMRIDSADSGRDNEKK
Ga0265306_1058717513300028598SedimentMAAPLMREPTRCTVQPNVTVQRAVASTIMRIDSVDSGLVNEKKYQK
Ga0265306_1062532113300028598SedimentPIRHVPPRCAERPNAIVQLAKAGTAMRPDNASSERIKNKK
Ga0265309_1066562813300028599SedimentMVVLIWRDPPRCVGQPNATVQPAVAGTVMPIDSVGSGRVNEKK
Ga0265303_1079556513300028600SedimentMFIALMAAPFMREPPRCAERPNATVPLAVAGTVMRIDSADSGRVNEKK
Ga0307423_108140323300031371Salt MarshMFIVPMAAPTMHEPPHCAEQPNVTVQRAVAGTVMRIDSVGSGRVNEKK
Ga0307380_1010803413300031539SoilVRMAAPIWRDPPRCTGQPNVTVQRAVASTLMRIDSVDSGRVSEKK
Ga0315547_105272533300031553Salt Marsh SedimentSIVRMAAPLMREPTRCTVQPNVTVQRAVASTLMRIDSVDSGRVNEKK
Ga0307379_1007781013300031565SoilMAAPIWRDPPRCTGQPNVTVQRAVASTLMRIDSVDSGRVSEKK
Ga0316575_1010231413300031665RhizosphereMFIVPMAAPTMHEPPHCAEQPNVTVQRAVAGTVMRIDSVGSGCVNEKK
Ga0316576_1043572413300031727RhizosphereMAAPIRPDPPRCAEPPNATVQRAVAGTVMRTDSGGSGRVNEKK
Ga0316578_1038733013300031728RhizosphereMFIALTAAPIWHDPPRCAGQPYATVQRAAAGTVMRIDSVDSGRVKEKKYKK
Ga0315540_1021823623300032061Salt Marsh SedimentSVVTATTAMFIARMAAPTMHEPLRCAEQPNATAQLAVAGTVMRIDSVDSGRVNEKK
Ga0316201_1094064823300032136Worm BurrowMSIALLAAPVMRDPPHCAERPNATVHLAVVGIAMRIDSVGSGRVNEKK
Ga0316593_1016221023300032168RhizosphereAVLIWRDPPRCAGQPNATVQPAVAGTVMPIDSVGSGRVNEKK
Ga0316187_1002879373300032231Worm BurrowMAAPLMREPTRCTVQPNVTVQRAVASTIMRIDSVDSGRVNKKK
Ga0316187_1044886823300032231Worm BurrowMAAPLMHEPPRYAGQPNVTVQRAVAGTIMPIDSVDSARVNEKKYKK
Ga0316187_1047601523300032231Worm BurrowMVVLIWRDPPRCAGQPNATAQRAVAGTVMPIDSADSGRDNEKK
Ga0316187_1066756313300032231Worm BurrowMAALIWHDPIRCTAQPNATVQLAVVSTVMRLDSIGSVRVNEKK
Ga0316198_1054054323300032251SedimentTALMAAPLMHEPPRCAGQPNATAQRAVAGTVMRIDSADSGRDNEKK
Ga0316196_1038542323300032252SedimentTVRMAAPIWRDPPRCTVQPNVTVQRAVASTIMRIDSVGSGRVNEKK
Ga0316191_1064435623300032258Worm BurrowMAAPLMHEPPRCAGQLNATAQRAVAGTVMRIDSADSGRDNEKKYQK
Ga0316190_1022689323300032259Worm BurrowAPLMHEPPRCAGQLNATAQRALAGTVMRIDSADSGRDNEKKYQK
Ga0316190_1062952013300032259Worm BurrowMAAPLMHEPPRCAGQPNATVQPAVAGTVMPIDSVGSGRVNEKKYQK
Ga0316190_1079359023300032259Worm BurrowMAAPLMHEPPRCAGQLNATAQRAVAGTVMRIDSADSGRDNEKK
Ga0316192_1044235723300032260Worm BurrowMAAPIWRDPPRCTVQPNVTVQRAVASTIMRIDSVGSGRVNEKK
Ga0316192_1045231713300032260Worm BurrowMAAPLMHEPPRYAGQPNVIVQHAVAGTIMPIDSVDSARVNEKKYKK
Ga0316192_1074604023300032260Worm BurrowMFIVRTAAPLMRELPRCTEQPYATVQRAVAGTVMPIDSVDSGRVNEKK
Ga0316194_1063298613300032262SedimentMFTALMAAPLMHEPPRCAGQLNATAQRAVAGTRMRIDSTDSGRVNEKK
Ga0316189_1012114943300032272Worm BurrowDPPRCAGQPNATVQPAVAGTVMPIDSVGSGRVNEKK
Ga0316197_1046340313300032273SedimentTVRMAAPIWRDPPRCAEQPCATAQHVVAGTVMRIDSVDSGRVNEKK

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.