NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F082319

Metagenome / Metatranscriptome Family F082319

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F082319
Family Type Metagenome / Metatranscriptome
Number of Sequences 113
Average Sequence Length 49 residues
Representative Sequence MIPQLSIQERDRRYKIVRAEMAKRGIDVLLLPANTGRWEQLQGDSRYL
Number of Associated Samples 107
Number of Associated Scaffolds 113

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 98.21 %
% of genes near scaffold ends (potentially truncated) 98.23 %
% of genes from short scaffolds (< 2000 bps) 97.35 %
Associated GOLD sequencing projects 104
AlphaFold2 3D model prediction Yes
3D model pTM-score0.54

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (99.115 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere
(12.389 % of family members)
Environment Ontology (ENVO) Unclassified
(33.628 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(35.398 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 23.68%    β-sheet: 13.16%    Coil/Unstructured: 63.16%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.54
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 113 Family Scaffolds
PF00903Glyoxalase 6.19
PF04392ABC_sub_bind 4.42
PF12681Glyoxalase_2 4.42
PF13416SBP_bac_8 1.77
PF03401TctC 0.88
PF13531SBP_bac_11 0.88
PF14294DUF4372 0.88
PF00557Peptidase_M24 0.88
PF02371Transposase_20 0.88
PF13343SBP_bac_6 0.88
PF07878RHH_5 0.88

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 113 Family Scaffolds
COG2984ABC-type uncharacterized transport system, periplasmic componentGeneral function prediction only [R] 4.42
COG3181Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctCEnergy production and conversion [C] 0.88
COG3547TransposaseMobilome: prophages, transposons [X] 0.88

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms99.12 %
UnclassifiedrootN/A0.88 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000559|F14TC_101762312All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium940Open in IMG/M
3300000953|JGI11615J12901_10001259All Organisms → cellular organisms → Bacteria521Open in IMG/M
3300000956|JGI10216J12902_100850292All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1517Open in IMG/M
3300000956|JGI10216J12902_104045010All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium756Open in IMG/M
3300003987|Ga0055471_10247335All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium565Open in IMG/M
3300004011|Ga0055460_10059175All Organisms → cellular organisms → Bacteria → Proteobacteria1007Open in IMG/M
3300004157|Ga0062590_101742695All Organisms → cellular organisms → Bacteria636Open in IMG/M
3300004480|Ga0062592_101638573All Organisms → cellular organisms → Bacteria623Open in IMG/M
3300005294|Ga0065705_11028146All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium540Open in IMG/M
3300005295|Ga0065707_10176192All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1449Open in IMG/M
3300005345|Ga0070692_10378957All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium887Open in IMG/M
3300005354|Ga0070675_101214521All Organisms → cellular organisms → Bacteria → Proteobacteria694Open in IMG/M
3300005445|Ga0070708_100773188All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium903Open in IMG/M
3300005471|Ga0070698_101089843All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium747Open in IMG/M
3300005518|Ga0070699_101617641All Organisms → cellular organisms → Bacteria593Open in IMG/M
3300005558|Ga0066698_10595654All Organisms → cellular organisms → Bacteria746Open in IMG/M
3300005561|Ga0066699_11138048All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium537Open in IMG/M
3300005598|Ga0066706_10537609All Organisms → cellular organisms → Bacteria930Open in IMG/M
3300005713|Ga0066905_100770794All Organisms → cellular organisms → Bacteria832Open in IMG/M
3300005713|Ga0066905_100953078All Organisms → cellular organisms → Bacteria754Open in IMG/M
3300005843|Ga0068860_100868541All Organisms → cellular organisms → Bacteria917Open in IMG/M
3300005843|Ga0068860_102572636All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria528Open in IMG/M
3300006844|Ga0075428_100503774All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1295Open in IMG/M
3300006845|Ga0075421_102051701All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium608Open in IMG/M
3300006845|Ga0075421_102068340All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium605Open in IMG/M
3300006847|Ga0075431_101737353All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium580Open in IMG/M
3300006852|Ga0075433_11067236All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium703Open in IMG/M
3300006853|Ga0075420_101071504All Organisms → cellular organisms → Bacteria693Open in IMG/M
3300006854|Ga0075425_102590426All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium560Open in IMG/M
3300006871|Ga0075434_102117632All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium567Open in IMG/M
3300006880|Ga0075429_101557911All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium575Open in IMG/M
3300006903|Ga0075426_11301548All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium552Open in IMG/M
3300006904|Ga0075424_102313929All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium564Open in IMG/M
3300006914|Ga0075436_101013894All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium623Open in IMG/M
3300006918|Ga0079216_11956153All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium508Open in IMG/M
3300006954|Ga0079219_12481789All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium504Open in IMG/M
3300009100|Ga0075418_11266238All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium799Open in IMG/M
3300009101|Ga0105247_11487787All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium552Open in IMG/M
3300009162|Ga0075423_11566759All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium708Open in IMG/M
3300009609|Ga0105347_1253830All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium724Open in IMG/M
3300010043|Ga0126380_11792327All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium555Open in IMG/M
3300010047|Ga0126382_12186903All Organisms → cellular organisms → Bacteria532Open in IMG/M
3300010304|Ga0134088_10627645All Organisms → cellular organisms → Bacteria536Open in IMG/M
3300010359|Ga0126376_12562084All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium558Open in IMG/M
3300011405|Ga0137340_1115095All Organisms → cellular organisms → Bacteria516Open in IMG/M
3300011417|Ga0137326_1084915All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium714Open in IMG/M
3300011427|Ga0137448_1131199All Organisms → cellular organisms → Bacteria689Open in IMG/M
3300011441|Ga0137452_1126293All Organisms → cellular organisms → Bacteria853Open in IMG/M
3300012022|Ga0120191_10012280All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1090Open in IMG/M
3300012035|Ga0137445_1018804All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1261Open in IMG/M
3300012039|Ga0137421_1133133All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium728Open in IMG/M
3300012198|Ga0137364_10457558All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium958Open in IMG/M
3300012349|Ga0137387_11195823All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium537Open in IMG/M
3300012354|Ga0137366_10799083All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium670Open in IMG/M
3300012498|Ga0157345_1049592All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium530Open in IMG/M
3300012519|Ga0157352_1039119All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium664Open in IMG/M
3300012884|Ga0157300_1108732All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium521Open in IMG/M
3300012984|Ga0164309_11725503All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium537Open in IMG/M
3300012988|Ga0164306_11317800All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium611Open in IMG/M
3300014326|Ga0157380_10999487All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium870Open in IMG/M
3300014865|Ga0180078_1081983All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium560Open in IMG/M
3300015053|Ga0137405_1094386All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1347Open in IMG/M
3300015259|Ga0180085_1031918All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1483Open in IMG/M
3300015262|Ga0182007_10341032All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium560Open in IMG/M
3300015371|Ga0132258_12094515All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1422Open in IMG/M
3300015373|Ga0132257_100280491All Organisms → cellular organisms → Bacteria → Proteobacteria1997Open in IMG/M
3300017656|Ga0134112_10309466All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium637Open in IMG/M
3300017792|Ga0163161_10259254All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1357Open in IMG/M
3300017966|Ga0187776_10819942All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium669Open in IMG/M
3300018000|Ga0184604_10106365All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium876Open in IMG/M
3300018028|Ga0184608_10134635All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1056Open in IMG/M
3300018073|Ga0184624_10340995All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium671Open in IMG/M
3300018076|Ga0184609_10458840All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium585Open in IMG/M
3300018081|Ga0184625_10080460All Organisms → cellular organisms → Bacteria1666Open in IMG/M
3300018081|Ga0184625_10372097All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium740Open in IMG/M
3300019356|Ga0173481_10023545All Organisms → cellular organisms → Bacteria1900Open in IMG/M
3300019789|Ga0137408_1281784All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1035Open in IMG/M
3300020003|Ga0193739_1029211All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1432Open in IMG/M
3300020004|Ga0193755_1006630All Organisms → cellular organisms → Bacteria3753Open in IMG/M
3300020006|Ga0193735_1001488All Organisms → cellular organisms → Bacteria7529Open in IMG/M
3300020022|Ga0193733_1017996All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1996Open in IMG/M
3300020195|Ga0163150_10141198All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1403Open in IMG/M
3300021412|Ga0193736_1044787All Organisms → cellular organisms → Bacteria611Open in IMG/M
3300021560|Ga0126371_10289040All Organisms → cellular organisms → Bacteria1763Open in IMG/M
3300022214|Ga0224505_10103844All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1115Open in IMG/M
3300022385|Ga0210376_1062250All Organisms → cellular organisms → Bacteria609Open in IMG/M
3300022694|Ga0222623_10294574All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium623Open in IMG/M
3300022756|Ga0222622_10863059All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium663Open in IMG/M
3300025926|Ga0207659_10995729All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium721Open in IMG/M
3300025934|Ga0207686_10717724All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium796Open in IMG/M
3300025951|Ga0210066_1046489All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium729Open in IMG/M
3300025966|Ga0210105_1077594All Organisms → cellular organisms → Bacteria510Open in IMG/M
3300025971|Ga0210102_1039464All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium1020Open in IMG/M
3300026095|Ga0207676_11151832All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium768Open in IMG/M
3300026118|Ga0207675_102066733All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium586Open in IMG/M
3300026320|Ga0209131_1312934All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium584Open in IMG/M
3300026324|Ga0209470_1345263All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium535Open in IMG/M
3300026332|Ga0209803_1149800All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium904Open in IMG/M
3300026540|Ga0209376_1346801All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium562Open in IMG/M
3300026548|Ga0209161_10479957All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium548Open in IMG/M
3300027787|Ga0209074_10231541All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium709Open in IMG/M
3300027874|Ga0209465_10192705All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1017Open in IMG/M
3300028293|Ga0247662_1074948All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium603Open in IMG/M
3300028828|Ga0307312_11050122All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium539Open in IMG/M
3300028884|Ga0307308_10222399All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium905Open in IMG/M
3300031820|Ga0307473_10297499All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1014Open in IMG/M
3300032163|Ga0315281_10893759All Organisms → cellular organisms → Bacteria → Proteobacteria909Open in IMG/M
3300032205|Ga0307472_100143725All Organisms → cellular organisms → Bacteria1730Open in IMG/M
3300033480|Ga0316620_11332216All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium706Open in IMG/M
3300033513|Ga0316628_104388098All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium500Open in IMG/M
3300034150|Ga0364933_089775All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium774Open in IMG/M
3300034819|Ga0373958_0186190All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium537Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere12.39%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil9.73%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil8.85%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil7.96%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment5.31%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands4.42%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil4.42%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil4.42%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere3.54%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere3.54%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil2.65%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil2.65%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment1.77%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil1.77%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere1.77%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil1.77%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil1.77%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil1.77%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere1.77%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere1.77%
Freshwater Microbial MatEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Microbial Mat0.89%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment0.89%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine0.89%
SedimentEnvironmental → Aquatic → Marine → Sediment → Unclassified → Sediment0.89%
TerrestrialEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial0.89%
Unplanted SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil0.89%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.89%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.89%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland0.89%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.89%
SedimentEnvironmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment0.89%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere0.89%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.89%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.89%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.89%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.89%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.89%
Rhizosphere SoilHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil0.89%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000559Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemlyEnvironmentalOpen in IMG/M
3300000953Soil microbial communities from Great Prairies - Kansas Corn soilEnvironmentalOpen in IMG/M
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300003987Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleB_D2EnvironmentalOpen in IMG/M
3300004011Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Joice_ThreeSqA_D2EnvironmentalOpen in IMG/M
3300004157Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2EnvironmentalOpen in IMG/M
3300004480Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4EnvironmentalOpen in IMG/M
3300005294Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk SoilEnvironmentalOpen in IMG/M
3300005295Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3EnvironmentalOpen in IMG/M
3300005345Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaGEnvironmentalOpen in IMG/M
3300005354Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaGHost-AssociatedOpen in IMG/M
3300005445Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaGEnvironmentalOpen in IMG/M
3300005471Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaGEnvironmentalOpen in IMG/M
3300005518Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaGEnvironmentalOpen in IMG/M
3300005558Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147EnvironmentalOpen in IMG/M
3300005561Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148EnvironmentalOpen in IMG/M
3300005598Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155EnvironmentalOpen in IMG/M
3300005713Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)EnvironmentalOpen in IMG/M
3300005843Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2Host-AssociatedOpen in IMG/M
3300006844Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2Host-AssociatedOpen in IMG/M
3300006845Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5Host-AssociatedOpen in IMG/M
3300006847Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5Host-AssociatedOpen in IMG/M
3300006852Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2Host-AssociatedOpen in IMG/M
3300006853Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4Host-AssociatedOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006871Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3Host-AssociatedOpen in IMG/M
3300006880Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3Host-AssociatedOpen in IMG/M
3300006903Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5Host-AssociatedOpen in IMG/M
3300006904Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3Host-AssociatedOpen in IMG/M
3300006914Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5Host-AssociatedOpen in IMG/M
3300006918Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100EnvironmentalOpen in IMG/M
3300006954Agricultural soil microbial communities from Georgia to study Nitrogen management - GA ControlEnvironmentalOpen in IMG/M
3300009100Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2Host-AssociatedOpen in IMG/M
3300009101Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaGHost-AssociatedOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300009609Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT890EnvironmentalOpen in IMG/M
3300010043Tropical forest soil microbial communities from Panama - MetaG Plot_26EnvironmentalOpen in IMG/M
3300010047Tropical forest soil microbial communities from Panama - MetaG Plot_30EnvironmentalOpen in IMG/M
3300010304Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015EnvironmentalOpen in IMG/M
3300010359Tropical forest soil microbial communities from Panama - MetaG Plot_15EnvironmentalOpen in IMG/M
3300011405Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT400_2EnvironmentalOpen in IMG/M
3300011417Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT500_2EnvironmentalOpen in IMG/M
3300011427Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT418_2EnvironmentalOpen in IMG/M
3300011441Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT513_2EnvironmentalOpen in IMG/M
3300012022Terrestrial microbial communites from a soil warming plot in Okalahoma, USA - C6EnvironmentalOpen in IMG/M
3300012035Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT338_2EnvironmentalOpen in IMG/M
3300012039Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT534_2EnvironmentalOpen in IMG/M
3300012198Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012349Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaGEnvironmentalOpen in IMG/M
3300012354Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012498Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410Host-AssociatedOpen in IMG/M
3300012519Unplanted soil (control) microbial communities from North Carolina - M.Soil.7.yng.070610EnvironmentalOpen in IMG/M
3300012884Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2EnvironmentalOpen in IMG/M
3300012984Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MGEnvironmentalOpen in IMG/M
3300012988Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MGEnvironmentalOpen in IMG/M
3300014326Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaGHost-AssociatedOpen in IMG/M
3300014865Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT499_16_10DEnvironmentalOpen in IMG/M
3300015053Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300015259Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT730_16_10DEnvironmentalOpen in IMG/M
3300015262Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaGHost-AssociatedOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300017656Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_11112015EnvironmentalOpen in IMG/M
3300017792Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaGHost-AssociatedOpen in IMG/M
3300017966Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MGEnvironmentalOpen in IMG/M
3300018000Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_coexEnvironmentalOpen in IMG/M
3300018028Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coexEnvironmentalOpen in IMG/M
3300018073Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_b1EnvironmentalOpen in IMG/M
3300018076Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coexEnvironmentalOpen in IMG/M
3300018081Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1EnvironmentalOpen in IMG/M
3300019356Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2)EnvironmentalOpen in IMG/M
3300019789Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300020003Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2a2EnvironmentalOpen in IMG/M
3300020004Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1a2EnvironmentalOpen in IMG/M
3300020006Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1m2EnvironmentalOpen in IMG/M
3300020022Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1s2EnvironmentalOpen in IMG/M
3300020195Freshwater microbial mat bacterial communities from Lake Vanda, McMurdo Dry Valleys, Antarctica - Oligotrophic Lake LV.19.P2.IBEnvironmentalOpen in IMG/M
3300021412Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2m1EnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300022214Sediment microbial communities from San Francisco Bay, California, United States - SF_Jan12_sed_USGS_4_1EnvironmentalOpen in IMG/M
3300022385Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Oregon, United States ? S771 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300022694Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_coexEnvironmentalOpen in IMG/M
3300022756Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1EnvironmentalOpen in IMG/M
3300025926Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025934Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025951Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushMan_ThreeSqA_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300025966Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_TuleC_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300025971Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqC_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300026095Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026118Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026320Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cm (SPAdes)EnvironmentalOpen in IMG/M
3300026324Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 (SPAdes)EnvironmentalOpen in IMG/M
3300026332Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 (SPAdes)EnvironmentalOpen in IMG/M
3300026540Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 (SPAdes)EnvironmentalOpen in IMG/M
3300026548Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes)EnvironmentalOpen in IMG/M
3300027787Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes)EnvironmentalOpen in IMG/M
3300027874Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes)EnvironmentalOpen in IMG/M
3300028293Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK03EnvironmentalOpen in IMG/M
3300028828Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202EnvironmentalOpen in IMG/M
3300028884Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195EnvironmentalOpen in IMG/M
3300031820Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515EnvironmentalOpen in IMG/M
3300032163Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G07_0EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300033480Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D5_BEnvironmentalOpen in IMG/M
3300033513Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D5_CEnvironmentalOpen in IMG/M
3300034150Sediment microbial communities from East River floodplain, Colorado, United States - 25_j17EnvironmentalOpen in IMG/M
3300034819Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1Host-AssociatedOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
F14TC_10176231213300000559SoilMIPQLSIEERDRRYKIVRGEMAKRGIDCLLLPANTGRWEQLQGDSRYLTTIGGFATE
JGI11615J12901_1000125913300000953SoilMIPQLSIQERDRRYQLVRAEMAKRGIDVLLLPANTGRWEQLQGDSRY
JGI10216J12902_10085029223300000956SoilMIPQLSVEERDRRYQLVRAEMAKRGVDVLLLPANTGRWEQLQGDSRYLTNIGGFATEMFTVFPA
JGI10216J12902_10404501023300000956SoilMIPQLSIQERDRRYQIVRAEMAKRGIDVLLLPANTGRWEQLQGDSRYLTNI
Ga0055471_1024733513300003987Natural And Restored WetlandsMIPQLSIEERDRRYQVVRAEMSKRNIDVLLLPANTGRWEQLQGDSRYLTTIG
Ga0055460_1005917523300004011Natural And Restored WetlandsMIPQLSIQERDRRYQLVRAEMVKRGIDVLLLPANTGRWEQLQGDSRYLTNIGG
Ga0062590_10174269523300004157SoilMIPQLSIQERDRRYQLVRAEMAERGIDVLLLPANTGRWEQLQGDSRYLTNIGGFATEMFT
Ga0062592_10163857323300004480SoilMIPQLSIQERDRRYQLVRAEMAKRGIDVLLLPANTGRWEQLQGDSRYLTNIG
Ga0065705_1102814613300005294Switchgrass RhizosphereMIPQLSIEERDRRYKIVRAEMAKRGIDVLLLPANTGRWEQ
Ga0065707_1017619213300005295Switchgrass RhizosphereMIPQLSIQERDRRYKIVRAEMAKHGIDCLLLPANTGRWEQLQGDSRYLTTIG
Ga0070692_1037895713300005345Corn, Switchgrass And Miscanthus RhizosphereMIPQLSIEERDRRYKIVRAEMVQRNIDVLLLPANTGRWEQLQGDSRYLT
Ga0070675_10121452113300005354Miscanthus RhizosphereMIPQLSIQERDRRYKLVRAEMAKRGIDVLLLPANTGRWEQLQGDSRYLTNIGGFATEMF
Ga0070708_10077318823300005445Corn, Switchgrass And Miscanthus RhizosphereMIPQLSLQERDRRYDKVRAEMARQGIDCLLLPANTGRWEQLQGDSRYLTTIGGFATEVF
Ga0070698_10108984313300005471Corn, Switchgrass And Miscanthus RhizosphereMIPQLSIEERDRRYKIVRGEMAKRGIDCLLLPANTGRWEQLQGDSRYLTTIGGFATEVF
Ga0070699_10161764123300005518Corn, Switchgrass And Miscanthus RhizosphereMSETELIPQLSLEERDRRYRNVRREMARRGIECLLLPANSGRW
Ga0066698_1059565413300005558SoilMASDILIPQLTLEERDRRYRKAREAMAAAGIDCFLLPANSGRWEQ
Ga0066699_1113804823300005561SoilMNIMIPQLSIQERDRRYQIVRAEMGKRGIDCLLLPANTGRWEQLQGDSRY
Ga0066706_1053760923300005598SoilMQIPQLSLEERDRRYKKVRTEMARSNIDCLLLPANTGRWEQLQADS
Ga0066905_10077079413300005713Tropical Forest SoilMIPQLSIQERDRRYKIVRAEMAKRGIDVLLLPANTGRWEQLQGDSRYL
Ga0066905_10095307813300005713Tropical Forest SoilMIPQLSIEERDRRYKNVRREMAKRGIDCLLLPANTGRWEQLQG
Ga0068860_10086854123300005843Switchgrass RhizosphereMNIPQLSIQERDRRYKIVRAEMVKRGIDCLLLPANTGRWEQLQGDSRYL
Ga0068860_10257263613300005843Switchgrass RhizosphereMIPQLSIQERDRRYQKVRAEMTRRGVDVLLLPANTGRW
Ga0075428_10050377413300006844Populus RhizosphereMIPQLSIEERDRRYKIVRAEMATRGIDCLLLPANTGRWEQLQGDSR
Ga0075421_10205170113300006845Populus RhizosphereMIPQLTLQERDRRYKIVRDEMVKRSIDVLILPANTGRWEQLQGDSRYLTSIG
Ga0075421_10206834023300006845Populus RhizosphereMIPQLSIQERDRRYKTVRAEMAKLGIDVLLLPANTGRWEQL
Ga0075431_10173735313300006847Populus RhizosphereMIPQLSIQERDRRYKIVKAEMAKRGIDCLLLPANTGRWEQLQ
Ga0075433_1106723623300006852Populus RhizosphereMIPQLSIQERDRRYQNVRAEMAKLGIDCLLLPANTGRWEQLQGDSRYLTTIGGFATE
Ga0075420_10107150423300006853Populus RhizosphereMIPQLSIEERDRRYRIVRTEMAQRNIDVLLLPANTGRWEQLQGDSRYLTSIGGFSTEVF
Ga0075425_10259042623300006854Populus RhizosphereMIPQLSIKERDRRYKIVRAEMATRGIDCLLLPANTGRWE
Ga0075434_10211763213300006871Populus RhizosphereMIPQLSIQERDRRYKTVRAEMAKLGIDVLLLPANTGRWEQLQG
Ga0075429_10155791123300006880Populus RhizosphereMIPQLSIQERDRRYKIVRAEMAKHGIDCLLLPANTG
Ga0075426_1130154823300006903Populus RhizosphereMIPQLSIEERDRRYKIVRAEMATRGIDCLLLPANTGRWEQLQGDSRYLTTI
Ga0075424_10231392913300006904Populus RhizosphereMIPQLSIKERDRRYKIVRAEMATRGIDCLLLPANT
Ga0075436_10101389413300006914Populus RhizosphereMIPQLSLQERDRRYDKVRAEMARQGIDCLLLPANTGRWE
Ga0079216_1195615313300006918Agricultural SoilMIPQLSIQERDRRYKLVRAEMAKRGIDVLLLPANTGRWEQLQGDSRYLT
Ga0079219_1248178923300006954Agricultural SoilMSIPQLSIEERDRRYKKVRAEMAQSNIDVLLLPANTG
Ga0075418_1126623813300009100Populus RhizosphereMIPQLSIEERDRRYKIVRAEMVQRNIDVLLLPANTGRWEQLQGDSRYLTSIGG
Ga0105247_1148778713300009101Switchgrass RhizosphereMGIPQLSIEERDRRYKVVRAEMAQRNIDVLLLPANTGRWEQLQGDSRYL
Ga0075423_1156675923300009162Populus RhizosphereMIPQLSIQERDRRYKLVRAEMAKRGIDVLLLPANTGRWEQLQGDSRYLTNIGGFATEMFTIFP
Ga0105347_125383013300009609SoilMIPQLSIQERDRRYKIVRAEMAKRGIDVLLAPANTGRWEQLQGDS
Ga0126380_1121167623300010043Tropical Forest SoilMETDLIPQLSLEERDRRYKKVREEMLQRGIDVLLLPANSGRWEQL
Ga0126380_1179232723300010043Tropical Forest SoilMIPQLSIQERDRRYKIVRAEMAKRGIDVLLLPANTGRWEQLQGDSRYLTTIGGFA
Ga0126382_1218690323300010047Tropical Forest SoilMIPELSIEERDRRYKIVRAEMAQRGIDCLLLPANTGRWEQLQGDSRYLTTIGGFATEVFTVF
Ga0134088_1062764513300010304Grasslands SoilMASDILIPQLNLEERDRRYRKAREAMAAAGIDYFLLPANSGRWEQLQA
Ga0126376_1256208413300010359Tropical Forest SoilMIPQLSIQERDRRYKIVRAEMAKRNIDVLLLPANTG
Ga0137340_111509523300011405SoilMIPQLSIQERDRRYQLVRAEMAKRGIDVLLLPANT
Ga0137326_108491523300011417SoilMIPQLSIQERDRRYKVVRAEMAQHGIDCLLLPANTGRWE
Ga0137448_113119913300011427SoilMLIPQLSIEERDRRYKIVRAEMAKRGIDCLVLPANTGRWEQMQGDSRYLTSIGGFATEVFTVFP
Ga0137452_112629313300011441SoilMIPQLSIQERDRRYKIVRAEMAKRGIDVLLLPANTGRWEQLQGDSRYLT
Ga0120191_1001228023300012022TerrestrialMIPQLSIQERDRRYKIVRTEMAQCGIDCLLLPANTGRWEQLQGDSRYLTTIGGFATQVFPVF
Ga0137445_101880413300012035SoilMMIPQLSIQERDRRYKIVRAEMAKRGIDVLLLPANTGRWEQLQGDSRYLTSIG
Ga0137421_113313313300012039SoilMIPQLSIQERDRRYQLVRAEMAKRGIDVLLLPANTGRWEQLQGDSRYLTSIGGFATE
Ga0137364_1045755823300012198Vadose Zone SoilMNIMIPQLSIQERDRRYQIVRAEMATRGIDCMLLPANTG
Ga0137387_1119582323300012349Vadose Zone SoilMIPQLSIEERDRRYKIVRAEMAERGIDCLLLPANTGRWEQLQGDSRYLTTIGGFATEVFTVFPRE
Ga0137366_1079908313300012354Vadose Zone SoilMIPQLSIQERDRRYRKVREEMARRSIDCLLLPANTGRWEQLQADSRYLTSIGGFATEV
Ga0157345_104959213300012498Arabidopsis RhizosphereMNIPQLSIQERDRRYKIVRAEMVKRSIDCLLLPANT
Ga0157352_103911913300012519Unplanted SoilMNIPQLSIQERDRRYKIVRAEMVKRGIDCLLLPANTGRWEQLQGDSRY
Ga0157300_110873213300012884SoilMGIPQLSIEERDRRYKVVRAEMAQRKIDVLLLPANTG
Ga0164309_1172550323300012984SoilMNIPQLSIQERDRRYKIVRAEMVKRGIDCLLLPANTGRWEQLQ
Ga0164306_1131780013300012988SoilMIPQLSIEERDRRYKIVRAEMVQRNIDVLLLPANTGRWEQLQGDSRYLTSIGGFATEVFTVF
Ga0157380_1099948723300014326Switchgrass RhizosphereMIPQLSIQERDRRYKLVRAEMAKRGIDVLLLPANTGRWEQLQGDSRYLTNIGGFATE
Ga0180078_108198313300014865SoilMMPQLSIQERDRRYKIVRAEMAGRGIDCLLLPANTGRWEQMQADS
Ga0137405_109438633300015053Vadose Zone SoilMIPQLSIQERDRRYKIVRAEMARRGIDCLLLPANTGRWEQLQGDSRYL
Ga0180085_103191813300015259SoilMIPLLSIQERDRRYKIVRAEMAKRGIDCLVLPANTGRWEQMQGDSRY
Ga0182007_1034103213300015262RhizosphereMGIPQLSIEERDRRYKVVRAEMAQRNIDVLLLPANTGRWEQLQGDSR
Ga0132258_1209451533300015371Arabidopsis RhizosphereMIPQLSIEERDRRYKIVRAEMAQRNIDVLLLPANTGRWEQLQGDSRYLTSIGGFATE
Ga0132257_10028049143300015373Arabidopsis RhizosphereMIPQLSIQERDRRYQKVRAEMTRRGVDVLLLPANTGRWEQLQGDSRYLTNIGGFATEMFT
Ga0134112_1030946623300017656Grasslands SoilMIPQLSIQERDRRYKIVRAEMARRGIDCLLLPANTG
Ga0163161_1025925433300017792Switchgrass RhizosphereMGIPQLSIEERDRRYKVVRAEMAQRNIDVLLLPANTGRWEQL
Ga0187776_1081994223300017966Tropical PeatlandMIPQLSIEERDRRYKIVRAEMAKRNIDVLLLPANTGRWEQ
Ga0184604_1010636523300018000Groundwater SedimentMIPQLSLQERDRRYQIVRAEMAKRGIDVLILPANTGRWEQLQG
Ga0184608_1013463513300018028Groundwater SedimentMIPQLSIQERDRRYRIVRAEMAKRGIDVLILPANTGRWEQLQGDSRYVTSIGG
Ga0184624_1034099513300018073Groundwater SedimentMIPQLSIEERDRRYKIVRAQMAQRGIDCLLLPANTGRWEQMQADSRYIS
Ga0184609_1045884023300018076Groundwater SedimentMSIPQLSIEERDRRYQNVRAEMARRGIDCLLLPANTGRWEQLQGDSRYITTIGGFATEVF
Ga0184625_1008046013300018081Groundwater SedimentMIPQLSIEERDRRYKIVRAQMAQRGIDCLLLPANTGRWEQMQADSR
Ga0184625_1037209713300018081Groundwater SedimentMSPQLAIEERDRRYKIVRAQMAQRGIDCLLLPANTGRWEQMQADSR
Ga0173481_1002354513300019356SoilMGIPQLSIEERDRRYKVVRAEMAQRKIDVLLLPANTGRWEQLQGD
Ga0137408_128178423300019789Vadose Zone SoilMIPQLSIQERDRRYKIVKAEMAKRGIDCLLLPANTGRWEQLQGDSRYLTTIGGFATEV
Ga0193739_102921133300020003SoilMIPQLSIEERDRRYKIVRTEMAKRGIDCLLLPANTGRWEQLQGDSRYLTTI
Ga0193755_100663043300020004SoilMIPQLSIQERDRRYQMVRAEMAKRGIDVLILPANTGRWEQLQGVKAT
Ga0193735_100148813300020006SoilMIPQLSIQERDRRYQMVRAEMAKRGIDVLILPANTGRWEQLQGDSRYL
Ga0193733_101799613300020022SoilMIPQLSIQERDRRYQMVRAEMAKRGIDVLILPANTGRWEQLQGDSRYLTSIGGFATEVFTVFLR
Ga0163150_1014119813300020195Freshwater Microbial MatMIPQLSIQERDRRYQLVRAEMAKRGIDVLLLPANTGRWEQLQGDSRYLTNIGGFAT
Ga0193736_104478713300021412SoilMIPQLSIEERDRRYQLVRAEMAKRGIDVLLLPANTGRWEQLQGDSRYLTNIGGFA
Ga0126371_1028904013300021560Tropical Forest SoilMSIPQLSLQERDRRYQKVRAEMKRQGIDCLLLPANTG
Ga0224505_1010384413300022214SedimentMIPQLSIQERDRRYQLVRAEMAKRGIDVLLLPANTGRWEQLQGDSRYLTNIGGFATEMFTVF
Ga0210376_106225023300022385EstuarineMIPQLSIQERDRRYQLVRGQMAKRGIDVLLLPANTGRWEQLQGDSRYLTNIGGFA
Ga0222623_1029457423300022694Groundwater SedimentMIPQLSIQERDRRYRIVRAEMAKRGIDVLILPANTGRWEQLQGDSRYVTSIGGFATEVFTVF
Ga0222622_1086305923300022756Groundwater SedimentMIPQLSIQERDRRYKIVRAEMAKRGIDVLLAPANTGRWEQLQG
Ga0207659_1099572913300025926Miscanthus RhizosphereMIPQLSIQERDRRYKLVRAEMAKRGIDVLLLPANTGRWEQLQGDSRYLTNIGGFATEMFTVFP
Ga0207686_1071772413300025934Miscanthus RhizosphereMIPQLSIQERDRRYQKVRAEMTRRGVDVLLLPANTGRWEQLQGDSRYLTNIGG
Ga0210066_104648923300025951Natural And Restored WetlandsMVPQLSIQERDRRYQIVRAEMAKRGIDVLLLPANTGRWEQLQGDSR
Ga0210105_107759423300025966Natural And Restored WetlandsMVPQLSIQERDRRYQLVRGEMAKRGIDVLLLPANTGRWEQLQ
Ga0210102_103946423300025971Natural And Restored WetlandsMVPQLSIQERDRRYQIVRAEMAKRGIDVLLLPANTGRWEQLQGDSRYLTNIGGFATEMFT
Ga0207676_1115183213300026095Switchgrass RhizosphereMGIPQLSIEERDRRYKVVRAEMAQRKIDVLLLPANTGRWEQLQGDSRYLTSIGGFATE
Ga0207675_10206673323300026118Switchgrass RhizosphereMGIPQLSIEERDRRYKVVRAEMAQSKIDVLLLPANTGR
Ga0209131_131293413300026320Grasslands SoilMIPQLSIQERDRRYKNVRAEMAKRGIDVLLLPANTGRWEQLQGDSRYLTNIGGFATE
Ga0209470_134526323300026324SoilMIPQLSIQERDRRYRKVREEMARRGIDCLLLPANTGRW
Ga0209803_114980013300026332SoilMQIPQLSLEERDRRYKKVRTEMARSNIDCLLLPANTGRWEQLQADSRYLTSIGG
Ga0209376_134680113300026540SoilMIPQLSIQERDRRYRKVREEMARSNIDCLLLPANTG
Ga0209161_1047995713300026548SoilMQIPQLSLEERDRRYKKVRTEMARSNIDCLLLPANTGR
Ga0209074_1023154123300027787Agricultural SoilMIPQLSIEERDRRYKIVRAEMAQRNIDVLLLPANTGRWEQLQGDSRYLTSIGGFATEV
Ga0209465_1019270513300027874Tropical Forest SoilMIPQLSLQERDRRYRVVRAEMAQRGIDCLLLPANTGRWEQLQG
Ga0247662_107494813300028293SoilMIPQLSIQERDRRYKIVRAEMVKRGIDVLLLPANTGRWEQLQGD
Ga0307312_1105012223300028828SoilMIPQLSIQERDRRYQMVRAEMAKRGIDVLILPANTGRWEQLQGDSRYLTSIGGFAT
Ga0307308_1022239923300028884SoilMIPQLSIQERDRRYQMVRAEMAKRGIDVLILPANTGRWEQLQGD
Ga0307473_1029749923300031820Hardwood Forest SoilMIPQLSLQERDRRYDKVRAEMARQGIDCLLLPANTGRWEQLQGDSRYLTTIGGFAT
Ga0315281_1089375913300032163SedimentMIPQLSIEERDRRYKIVRAEMAKRGIDVLLLPANTGRWEQLQGDSRYLTSIGGFATE
Ga0307472_10014372513300032205Hardwood Forest SoilMIPQLSIQERDRRYKIVKAEMAKRGIDCLLLPANTG
Ga0316620_1133221623300033480SoilMIPQISIQERDRRYQIVRAEMAKRGMDCLLLPANTGRWEQLQGDSRYLTTIGGFATEVF
Ga0316628_10438809813300033513SoilMIPQLSIEERDRRYKSVRAEMAKRGMDCLLLPANTGRWEQLQGD
Ga0364933_089775_612_7733300034150SedimentMIPQLSIEERDRRYKIVRAQMAQRGIDCLLLPANTGRWEQMQADSRYISSIGGF
Ga0373958_0186190_365_5353300034819Rhizosphere SoilMIPQLSIEERDRRYKIVRAEMVQRNIDVLLLPANTGRWEQLQGDSRYLTSIGGFATE

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.