NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F082361

Metagenome Family F082361

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F082361
Family Type Metagenome
Number of Sequences 113
Average Sequence Length 49 residues
Representative Sequence MHIATFDTSTGVTQHLVQVEAQVKAETLVQPLLVLTHARPSAWPL
Number of Associated Samples 97
Number of Associated Scaffolds 113

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 96.46 %
% of genes from short scaffolds (< 2000 bps) 93.81 %
Associated GOLD sequencing projects 90
AlphaFold2 3D model prediction Yes
3D model pTM-score0.22

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (99.115 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(19.469 % of family members)
Environment Ontology (ENVO) Unclassified
(30.088 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(45.133 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 0.00%    β-sheet: 26.03%    Coil/Unstructured: 73.97%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.22
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 113 Family Scaffolds
PF01520Amidase_3 2.65
PF00041fn3 1.77
PF00933Glyco_hydro_3 0.88
PF13672PP2C_2 0.88
PF00313CSD 0.88
PF01547SBP_bac_1 0.88
PF01569PAP2 0.88
PF01019G_glu_transpept 0.88
PF02653BPD_transp_2 0.88

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 113 Family Scaffolds
COG0860N-acetylmuramoyl-L-alanine amidaseCell wall/membrane/envelope biogenesis [M] 2.65
COG0405Gamma-glutamyltranspeptidaseAmino acid transport and metabolism [E] 0.88
COG1472Periplasmic beta-glucosidase and related glycosidasesCarbohydrate transport and metabolism [G] 0.88

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms99.12 %
UnclassifiedrootN/A0.88 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2199352024|deeps__Contig_191281All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes1119Open in IMG/M
3300000956|JGI10216J12902_105408538All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes708Open in IMG/M
3300000956|JGI10216J12902_108737434All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes708Open in IMG/M
3300001139|JGI10220J13317_10021878All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes774Open in IMG/M
3300003321|soilH1_10132893All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes1404Open in IMG/M
3300003997|Ga0055466_10070470All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes905Open in IMG/M
3300003997|Ga0055466_10217289All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium568Open in IMG/M
3300003999|Ga0055469_10098533All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium838Open in IMG/M
3300003999|Ga0055469_10116748All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes783Open in IMG/M
3300004081|Ga0063454_100610869All Organisms → cellular organisms → Bacteria799Open in IMG/M
3300004081|Ga0063454_100847163All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes714Open in IMG/M
3300004081|Ga0063454_101343142All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes601Open in IMG/M
3300004114|Ga0062593_100775240All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium949Open in IMG/M
3300004153|Ga0063455_100708371All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium679Open in IMG/M
3300004157|Ga0062590_101897611All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium614Open in IMG/M
3300004778|Ga0062383_10271168All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes806Open in IMG/M
3300005329|Ga0070683_101754949All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes597Open in IMG/M
3300005344|Ga0070661_101798982All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium520Open in IMG/M
3300005347|Ga0070668_102015175All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes532Open in IMG/M
3300005455|Ga0070663_101819828All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes546Open in IMG/M
3300005458|Ga0070681_11578674All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes581Open in IMG/M
3300005468|Ga0070707_100185096All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes2030Open in IMG/M
3300005518|Ga0070699_101488557All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium621Open in IMG/M
3300005536|Ga0070697_100035321All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes4032Open in IMG/M
3300005545|Ga0070695_101634864All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium538Open in IMG/M
3300005844|Ga0068862_100308391All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes1458Open in IMG/M
3300005878|Ga0075297_1018816All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes726Open in IMG/M
3300005880|Ga0075298_1028108All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes561Open in IMG/M
3300005887|Ga0075292_1010948All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes1138Open in IMG/M
3300006804|Ga0079221_10636305All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium728Open in IMG/M
3300006853|Ga0075420_101807220All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium523Open in IMG/M
3300006876|Ga0079217_11315280All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium559Open in IMG/M
3300006954|Ga0079219_12124291All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes538Open in IMG/M
3300009147|Ga0114129_13367945All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium515Open in IMG/M
3300009148|Ga0105243_12978679All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium514Open in IMG/M
3300009153|Ga0105094_10273574All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium971Open in IMG/M
3300009156|Ga0111538_12301654All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium677Open in IMG/M
3300009156|Ga0111538_12770819All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium614Open in IMG/M
3300009162|Ga0075423_11277063All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes784Open in IMG/M
3300009553|Ga0105249_11285450All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes803Open in IMG/M
3300009840|Ga0126313_10611026All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium879Open in IMG/M
3300010036|Ga0126305_10160980All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium1402Open in IMG/M
3300010039|Ga0126309_11045300All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium551Open in IMG/M
3300010042|Ga0126314_10122585All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes1789Open in IMG/M
3300010044|Ga0126310_11876870All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes500Open in IMG/M
3300010166|Ga0126306_11738413All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes521Open in IMG/M
3300010375|Ga0105239_13475908All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium512Open in IMG/M
3300010399|Ga0134127_10488125All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes1240Open in IMG/M
3300012019|Ga0120139_1081053All Organisms → cellular organisms → Bacteria800Open in IMG/M
3300012093|Ga0136632_10521654All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes526Open in IMG/M
3300012212|Ga0150985_120969730All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes748Open in IMG/M
3300012360|Ga0137375_11241750All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium567Open in IMG/M
3300012684|Ga0136614_10696284All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium716Open in IMG/M
3300012914|Ga0157297_10379593All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium559Open in IMG/M
3300012984|Ga0164309_11131414All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium653Open in IMG/M
3300012986|Ga0164304_10869136All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes702Open in IMG/M
3300012986|Ga0164304_10956867All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium674Open in IMG/M
3300012986|Ga0164304_11357630All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes582Open in IMG/M
3300013102|Ga0157371_10840647All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes694Open in IMG/M
3300014263|Ga0075324_1039542All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes892Open in IMG/M
3300014497|Ga0182008_10091749All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium1498Open in IMG/M
3300015077|Ga0173483_10292538All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes794Open in IMG/M
3300015371|Ga0132258_11255330All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes1873Open in IMG/M
3300017789|Ga0136617_11057402All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium614Open in IMG/M
3300018422|Ga0190265_11364510All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium824Open in IMG/M
3300018429|Ga0190272_11167207All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes753Open in IMG/M
3300019888|Ga0193751_1190192All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium698Open in IMG/M
3300024430|Ga0196962_10043116All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes1360Open in IMG/M
3300025795|Ga0210114_1028467All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes1180Open in IMG/M
3300025915|Ga0207693_10437251All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes1023Open in IMG/M
3300025944|Ga0207661_10613938All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes999Open in IMG/M
3300025945|Ga0207679_10426500All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes1171Open in IMG/M
3300025961|Ga0207712_10649851All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes916Open in IMG/M
3300025972|Ga0207668_11459591All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes617Open in IMG/M
3300026020|Ga0208531_1005448All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes1102Open in IMG/M
3300026045|Ga0208535_1021552All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes608Open in IMG/M
3300026088|Ga0207641_12313515All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium537Open in IMG/M
3300027725|Ga0209178_1218229All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes680Open in IMG/M
3300027843|Ga0209798_10002069All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae11908Open in IMG/M
3300027964|Ga0256864_1070564All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium964Open in IMG/M
3300028587|Ga0247828_10441659All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes759Open in IMG/M
3300028592|Ga0247822_10901550All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes726Open in IMG/M
3300028597|Ga0247820_10076720All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes1992Open in IMG/M
3300028597|Ga0247820_11212882All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes545Open in IMG/M
3300028715|Ga0307313_10221367All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium588Open in IMG/M
3300028784|Ga0307282_10502236All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium589Open in IMG/M
3300028799|Ga0307284_10167421All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium854Open in IMG/M
3300028799|Ga0307284_10343082All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes604Open in IMG/M
3300028812|Ga0247825_10388681All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes984Open in IMG/M
3300028824|Ga0307310_10000660All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis11920Open in IMG/M
3300028824|Ga0307310_10200142All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes943Open in IMG/M
3300028828|Ga0307312_10932030All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes575Open in IMG/M
3300028872|Ga0307314_10139615All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes693Open in IMG/M
3300028878|Ga0307278_10542856All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes507Open in IMG/M
3300028881|Ga0307277_10459620All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes571Open in IMG/M
3300028884|Ga0307308_10234825All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes879Open in IMG/M
3300030619|Ga0268386_10962682All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium529Open in IMG/M
3300031548|Ga0307408_100065381All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes2667Open in IMG/M
3300031548|Ga0307408_101914438All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes569Open in IMG/M
3300031548|Ga0307408_101928958All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium567Open in IMG/M
3300031824|Ga0307413_10171682All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes1535Open in IMG/M
3300031824|Ga0307413_10187273All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium1482Open in IMG/M
3300031824|Ga0307413_10247464All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes1320Open in IMG/M
3300031852|Ga0307410_10221718All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes1455Open in IMG/M
3300031852|Ga0307410_11310891All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes633Open in IMG/M
3300031903|Ga0307407_10004328All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium6005Open in IMG/M
3300031911|Ga0307412_10432281All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes1080Open in IMG/M
3300031938|Ga0308175_102777578All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes547Open in IMG/M
3300031995|Ga0307409_100364517All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes1368Open in IMG/M
3300032126|Ga0307415_101241051All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes704Open in IMG/M
3300032179|Ga0310889_10641605All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium551Open in IMG/M
3300033513|Ga0316628_100467309All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes1620Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil19.47%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere10.62%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil6.19%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil5.31%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere5.31%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands4.42%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere4.42%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil3.54%
Rice Paddy SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil3.54%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil3.54%
Polar Desert SandEnvironmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand2.65%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil2.65%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere2.65%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere2.65%
Wetland SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment1.77%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil1.77%
Natural And Restored WetlandsEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands1.77%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.77%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere1.77%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere1.77%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment0.89%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.89%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil0.89%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.89%
Sugarcane Root And Bulk SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil0.89%
PermafrostEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost0.89%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil0.89%
SoilEnvironmental → Terrestrial → Soil → Sand → Desert → Soil0.89%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.89%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere0.89%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.89%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.89%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.89%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.89%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2199352024Bare-fallow DEEP SOILEnvironmentalOpen in IMG/M
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300001139Soil microbial communities from Great Prairies - Wisconsin, Switchgrass soilEnvironmentalOpen in IMG/M
3300003321Sugarcane bulk soil Sample H1EnvironmentalOpen in IMG/M
3300003997Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailC_D1EnvironmentalOpen in IMG/M
3300003999Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleA_D2EnvironmentalOpen in IMG/M
3300004081Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2)EnvironmentalOpen in IMG/M
3300004114Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5EnvironmentalOpen in IMG/M
3300004153Grasslands soil microbial communities from Hopland, California, USA (version 2)EnvironmentalOpen in IMG/M
3300004157Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2EnvironmentalOpen in IMG/M
3300004778Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare3FreshEnvironmentalOpen in IMG/M
3300005329Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaGEnvironmentalOpen in IMG/M
3300005344Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaGHost-AssociatedOpen in IMG/M
3300005345Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaGEnvironmentalOpen in IMG/M
3300005347Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaGHost-AssociatedOpen in IMG/M
3300005455Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaGHost-AssociatedOpen in IMG/M
3300005458Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaGEnvironmentalOpen in IMG/M
3300005468Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaGEnvironmentalOpen in IMG/M
3300005518Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaGEnvironmentalOpen in IMG/M
3300005536Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaGEnvironmentalOpen in IMG/M
3300005545Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaGEnvironmentalOpen in IMG/M
3300005844Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2Host-AssociatedOpen in IMG/M
3300005878Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_25C_80N_104EnvironmentalOpen in IMG/M
3300005880Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_25C_80N_201EnvironmentalOpen in IMG/M
3300005887Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_80N_403EnvironmentalOpen in IMG/M
3300006804Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200EnvironmentalOpen in IMG/M
3300006853Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4Host-AssociatedOpen in IMG/M
3300006876Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200EnvironmentalOpen in IMG/M
3300006954Agricultural soil microbial communities from Georgia to study Nitrogen management - GA ControlEnvironmentalOpen in IMG/M
3300009147Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)Host-AssociatedOpen in IMG/M
3300009148Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaGHost-AssociatedOpen in IMG/M
3300009153Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 10-12cm March2015EnvironmentalOpen in IMG/M
3300009156Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300009553Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaGHost-AssociatedOpen in IMG/M
3300009840Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105AEnvironmentalOpen in IMG/M
3300010036Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot26EnvironmentalOpen in IMG/M
3300010039Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot56EnvironmentalOpen in IMG/M
3300010042Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105BEnvironmentalOpen in IMG/M
3300010044Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60EnvironmentalOpen in IMG/M
3300010166Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27EnvironmentalOpen in IMG/M
3300010375Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaGHost-AssociatedOpen in IMG/M
3300010399Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3EnvironmentalOpen in IMG/M
3300012019Permafrost microbial communities from Nunavut, Canada - A7_5cm_12MEnvironmentalOpen in IMG/M
3300012093Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ611 (21.06)EnvironmentalOpen in IMG/M
3300012212Combined assembly of Hopland grassland soilHost-AssociatedOpen in IMG/M
3300012360Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaGEnvironmentalOpen in IMG/M
3300012684Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ279 (21.06)EnvironmentalOpen in IMG/M
3300012914Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S028-104C-2EnvironmentalOpen in IMG/M
3300012984Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MGEnvironmentalOpen in IMG/M
3300012986Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MGEnvironmentalOpen in IMG/M
3300013102Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaGHost-AssociatedOpen in IMG/M
3300014263Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleC_D1EnvironmentalOpen in IMG/M
3300014497Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaGHost-AssociatedOpen in IMG/M
3300015077Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 (version 2)EnvironmentalOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300017789Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ322 (21.06)EnvironmentalOpen in IMG/M
3300018422Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 TEnvironmentalOpen in IMG/M
3300018429Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 TEnvironmentalOpen in IMG/M
3300019888Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1c2EnvironmentalOpen in IMG/M
3300024430Soil microbial communities from Anza Borrego desert, Southern California, United States - S3+v_20EnvironmentalOpen in IMG/M
3300025795Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleA_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300025915Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025944Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025945Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025961Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025972Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026020Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_80N_403 (SPAdes)EnvironmentalOpen in IMG/M
3300026045Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_CattailC_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300026088Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300027725Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 (SPAdes)EnvironmentalOpen in IMG/M
3300027843Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare3Fresh (SPAdes)EnvironmentalOpen in IMG/M
3300027964Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT147D111 HiSeqEnvironmentalOpen in IMG/M
3300028587Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day3EnvironmentalOpen in IMG/M
3300028592Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Cellulose_Day30EnvironmentalOpen in IMG/M
3300028597Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glucose_Day14EnvironmentalOpen in IMG/M
3300028715Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_203EnvironmentalOpen in IMG/M
3300028784Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121EnvironmentalOpen in IMG/M
3300028799Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_123EnvironmentalOpen in IMG/M
3300028812Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Vanillin_Day48EnvironmentalOpen in IMG/M
3300028824Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_197EnvironmentalOpen in IMG/M
3300028828Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202EnvironmentalOpen in IMG/M
3300028872Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_204EnvironmentalOpen in IMG/M
3300028878Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117EnvironmentalOpen in IMG/M
3300028881Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116EnvironmentalOpen in IMG/M
3300028884Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195EnvironmentalOpen in IMG/M
3300030619Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT150D86 (Novaseq)EnvironmentalOpen in IMG/M
3300031548Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3Host-AssociatedOpen in IMG/M
3300031824Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2Host-AssociatedOpen in IMG/M
3300031852Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3Host-AssociatedOpen in IMG/M
3300031903Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1Host-AssociatedOpen in IMG/M
3300031911Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1Host-AssociatedOpen in IMG/M
3300031938Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1EnvironmentalOpen in IMG/M
3300031995Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2Host-AssociatedOpen in IMG/M
3300032126Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2Host-AssociatedOpen in IMG/M
3300032179Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D2EnvironmentalOpen in IMG/M
3300033513Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D5_CEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
deeps_036348502199352024SoilAGVTQHLVQVEAQVKADTLVQPLLVLTHARPNAWPL
JGI10216J12902_10540853813300000956SoilSGTPILGTDDSRADPLDRPLASLLMHIATFDTSTGVTQNMVQVEAQVKAETLVQPLLVLTHARPNAWPL*
JGI10216J12902_10873743423300000956SoilSGTPILGTDDSRADPLDRPLASLLMHIATFDTSAGVTQNMVQVEAQVKAETLVQPLLVLTHARPNAWPL*
JGI10220J13317_1002187813300001139SoilGLTQHLVQVEALVKAETLVQPLLVLTHQRPEAWPL*
soilH1_1013289323300003321Sugarcane Root And Bulk SoilVDRPLASLLMHIATFDTSTGVTQHLVQVEAQVKAETLVQPLLVLTHVRPAAWPL*
Ga0055466_1007047013300003997Natural And Restored WetlandsADLRPLTSLVMHISTFDTSSGITQHLVQVEALVKAESLVQPLIVLTHERPGTWPL*
Ga0055466_1021728913300003997Natural And Restored WetlandsLASLLMHIATFDTSTGVTQHLVQVEAQVRAETLVQPLLVLTHARPSAWPL*
Ga0055469_1009853323300003999Natural And Restored WetlandsTFDTSTGVTQHLVQVEAVVKAESLVQPLLILAPSRPAAWPL*
Ga0055469_1011674813300003999Natural And Restored WetlandsAADVPLGQLVMHIATFDASAGITQNLVQVEAAIRADTLVQPLLVLTHARPDTWPA*
Ga0063454_10061086933300004081SoilTFDTTSGVTQHLVQVEAQVKAETLVQPLLVLTHARPSAWPL*
Ga0063454_10084716313300004081SoilQRPLASLVMHIATFDTTTGLTQHLVQVEALVKAEALVQPLLVLTPQRPEAWPL*
Ga0063454_10134314213300004081SoilPLDRPLASLLMHIATFDTSTGVTQHMVQVEAQVKAETLVQPLLVLTHARPNAWPL*
Ga0062593_10077524023300004114SoilPLASMLMHIATFDTSTGVTQHLVQVEAVVKAESLVQPLLILTPSRPPAWPL*
Ga0063455_10070837113300004153SoilADRPLSSLLMHIATFDTSTGITQHLVQVEAQVKAETLVQPLLVLTHARPYAWPL*
Ga0062590_10189761123300004157SoilSMLMNIATFDTSTGVTQHLVQVEAVVKAESLVQPLLILTPTRPAAWPM*
Ga0062383_1027116813300004778Wetland SedimentERKTAPADRPLSSLVMQIATFDTSAGVTQHLVQVEALVKAETLVQPLLVLTHERPAPWPL
Ga0070683_10175494913300005329Corn RhizosphereVMHIATFDTTTGLTQHLVQVEALVKAETLVQPLLVLTHQRPGAWPL*
Ga0070661_10179898213300005344Corn RhizosphereVMHIATFDTTTGLTQHLVQVEALVKAETLVQPLLVLTHQRPAAWPL*
Ga0070692_1037671913300005345Corn, Switchgrass And Miscanthus RhizosphereRLDAAECPLSSLLMHIATFDASTGVTQHLVQVEATVKAEALVQPMLILTQQRPPTWPM*
Ga0070668_10201517523300005347Switchgrass RhizosphereSLVMHIATFDTTTGLTQHLVQVEALVKAETLVQPLLVLTHQRPGAWPL*
Ga0070663_10181982823300005455Corn RhizosphereDTTTGLTQHLVQVEALVKAETLVQPLLVLTHQRPAAWPL*
Ga0070681_1157867413300005458Corn RhizosphereKADPLDRPLSSLLMHIATFDTNAGVTQHLVQVEAQVKAETLVQPLLVLTHARPNAWPL*
Ga0070707_10018509613300005468Corn, Switchgrass And Miscanthus RhizosphereRPLVSLLMHIATFDTSAGVTQHLVQVEAQVKAETLVQPLLVLTHARPNAWPL*
Ga0070699_10148855713300005518Corn, Switchgrass And Miscanthus RhizosphereSLLMHIATFDTTAGITQNLVQVEAQVKAETLVQPLLVLTHARPNAWPL*
Ga0070697_10003532133300005536Corn, Switchgrass And Miscanthus RhizosphereEAPDWGHADPLDRPLASLVMHISTFDHSAGVTQHLVQVEAMVKADTLVQPLLVLTPYRPSAWPM*
Ga0070695_10163486413300005545Corn, Switchgrass And Miscanthus RhizosphereMNIATFDTSTGVTQHLVQVEAVVKAESLVQPLLILTPSRPPAWPL*
Ga0068862_10030839113300005844Switchgrass RhizospherePDQRPLASLVMHIATFDTTTGLTQHLVQVEALVKAETLVQPLLVLTHQRPGAWPL*
Ga0075297_101881613300005878Rice Paddy SoilSLVMHIATFDASSGVTQHLVQVEAQVKADTLVQPLLVLTHTRPEAWPL*
Ga0075298_102810813300005880Rice Paddy SoilSSLVMHIATFDASSGVTQHLVQVEAQVKADTLVQPLPVLTHTRPEAWPL*
Ga0075292_101094813300005887Rice Paddy SoilQRPLASLVMHIATFDTTTGLTQHLVQVEALVKAETLVQPLLVLTHQRPAAWPL*
Ga0079221_1063630523300006804Agricultural SoilSAGITQHLVQVEAQVKAETLVQPLLVLTHSRPTAWPL*
Ga0075420_10180722013300006853Populus RhizosphereLASLLMHIATFDTSTGVTQHLVQVEAVVKAESLVQPLLILTPTRPAAWPL*
Ga0079217_1131528013300006876Agricultural SoilDPTDADTPTAMQRPLASLVMHISTFDTSAGVTQHLVQVEALVKAETLVQPLLVLTHERPGAWPL*
Ga0079219_1212429113300006954Agricultural SoilLMHIATFDTSAGITQHLVQVEAQVKAETLVQPLLVLTHGRPSAWPL*
Ga0114129_1336794523300009147Populus RhizosphereAGSEHSKADPLDRPLSSLLMHIATFDTSGGITQHLVQVEAQVKAETLVQPLLVLTHARPDAWPL*
Ga0105243_1297867923300009148Miscanthus RhizosphereDTSTGVTQHLVQVEAVVKAESLVQPLLILTPSRPAAWPM*
Ga0105094_1027357413300009153Freshwater SedimentIATFDTSTGVTQHLVQVEAVVKAESLVQPLLILTPARPAAWPM*
Ga0111538_1230165423300009156Populus RhizosphereTFDTSTGVTQHLVQVEAVVKAESLVQPLLILTPSRPAAWPM*
Ga0111538_1277081923300009156Populus RhizosphereMHIATFDTSTGVTQHLVQVEAQVKAETLVQPLLVLTHARPSAWPL*
Ga0075423_1127706323300009162Populus RhizosphereEEDVDLQPLSSLLMHIATFDASAGVTQHLVQVEAQVKADTLVQLLLVLTHTRPESWPL*
Ga0105249_1128545013300009553Switchgrass RhizosphereIATFDTTTGLTQHLVQVEALVKAETLVQPLLVLTHQRPGAWPL*
Ga0126313_1061102623300009840Serpentine SoilFDTSTGVTQHLVQVEAVVKAESLVQPLLILAPTRPAAWPL*
Ga0126305_1016098013300010036Serpentine SoilMLMHIATFDTSTGVTQHLVQVEAVVKAESLVQPLLILAPTRPAAWPL*
Ga0126309_1104530013300010039Serpentine SoilSTGVTQHLVQVEAVVKAESLVQPLLILAPTRPTAWPL*
Ga0126314_1012258523300010042Serpentine SoilLMHIATFDTSTGVTQHLVQVEAVVKAESLVQPLLVLTPARPAAWPM*
Ga0126310_1187687013300010044Serpentine SoilTFDTSTGVTQHLVQVEAQVKAETLVQPLLVLTHVRPNAWPL*
Ga0126306_1173841323300010166Serpentine SoilAGFPMEKLHIATFDTSTGITQHLVQVEAQVKAETLVQPLLVLTHARPNAWPL*
Ga0105239_1347590813300010375Corn RhizosphereKAEPDQRPLASLVMHIATFDTTTGLTQHLVQVEALVKAETLVQPLLVLTHQRPGAWPL*
Ga0134127_1048812513300010399Terrestrial SoilLRPLTTLVMHISTFDTSSGLTQHLVQVEALVKAESLVQPLIVLTHERPGTWPL*
Ga0120139_108105323300012019PermafrostMASLLMHIATFDTSTGVTQHLVQVEAQVRAETLVQPLLVLTHARPDAWPL*
Ga0136632_1052165413300012093Polar Desert SandVMHISTFDATAGVTQHLVQVEALVKAETLVQPLLVLAHERPSAWPL*
Ga0150985_12096973023300012212Avena Fatua RhizosphereHIATFDTSTGITQHLVQVEAQVKAETLVQPLLVLAHARPGAWPL*
Ga0137375_1124175013300012360Vadose Zone SoilTTTGVTQHLVQVEAQVKAETLVQPLLVLTHTRPNAWPL*
Ga0136614_1069628413300012684Polar Desert SandTFDTSTGVTQHLVQVEAIVKAESLVQPLLILTPSRPAAWPL*
Ga0157297_1037959323300012914SoilGSKAEPDQRPLASLVMHIATFDTTTGLTQHLVQVEALVKAETLVQPLLVLTHQRPEAWPL
Ga0164309_1113141423300012984SoilGITQHLVQVEAQVKAETLVQPLLVLTHARPDAWPL*
Ga0164304_1086913623300012986SoilPLDRPLSSLLMHIATFDTSAGITQHLVQVEAQVKAETLVQPLLVLTHARPDAWPL*
Ga0164304_1095686713300012986SoilPLSSLLMHIATFDASTGVTQHLVQVEATVKAEALVQPMLVLTQTRPPTWPM*
Ga0164304_1135763013300012986SoilPLASLLMHIATFDTSAGVTQHLVQVEAQVKAETLVQPLLVLTHTRPEAWPL*
Ga0157371_1084064713300013102Corn RhizosphereMHIATFDTTTGLTQHLVQVEALVKAETLVQPLLVLTHQRPGAWPL*
Ga0075324_103954213300014263Natural And Restored WetlandsPGKTNADLRPLTSLVMHISTFDTSSGITQHLVQVEALVKAESLVQPLIVLTHERPGTWPL
Ga0182008_1009174913300014497RhizosphereRPLASMLMNIATFDTSTGVTQHLVQVEAVVKAESLVQPLLILTPSRPPAWPL*
Ga0173483_1029253813300015077SoilEPDQRPLASLVMHIATFDTTTGLTQHLVQVEALVKAETLVQPLLVLTHQRPEAWPL*
Ga0132258_1125533023300015371Arabidopsis RhizosphereMHIATFDTSAGVTQHLVQVEAQVKAETLVQPLLVLTHSRPAAWPL*
Ga0136617_1105740213300017789Polar Desert SandTFDTSTGVTQHLVQVEAVVKAESLVQPLLILAPTRPAAWPL
Ga0190265_1136451013300018422SoilSTGVTQHLVQVEAVVKADSLVQPLLILAPTRPAAWPM
Ga0190272_1116720713300018429SoilILGTDDSRADPMDRPLSCLLMHIATFDTSTGVTQHLVQVEAQVKAETLVQPLLVLTHARPNAWPL
Ga0193751_119019223300019888SoilSSMLMHIATFDTSTGVTQHLVQVEAVVRAESLVQPLLILTPSRPAAWPM
Ga0196962_1004311613300024430SoilRPLTSLVMHISTFDTTAGLTQHLVQVEALVKAETLVQPLIVLTHERPAAWPL
Ga0210114_102846723300025795Natural And Restored WetlandsPDQRPLASLVMHIATFDTTTGLTQHLVQVEALVKAETLVQPLLVLTHQRPGAWPL
Ga0207693_1043725123300025915Corn, Switchgrass And Miscanthus RhizosphereSPLLGSENSKADPLDRPLASLLMHIATFDTSAGVTQHLVQVEAQVKAETLVQPLLVLTHTRPEAWPL
Ga0207661_1061393813300025944Corn RhizosphereDASTGVTQHLVQVEATVKAEALVQPMLVLTQQRPPTWPM
Ga0207679_1042650013300025945Corn RhizosphereGLTQNLVQVEALVKAETLVQPLLVLTHQRPGAWPL
Ga0207712_1064985113300025961Switchgrass RhizospherePLASLVMHIATFDTTTGLTQHLVQVEALVKAETLVQPLLVLTHQRPGAWPL
Ga0207668_1145959123300025972Switchgrass RhizosphereKPDQRPLTSLVMHIATFDTTTGLTQHLVQVEALVKAETLVQPLLVLTHQRPGAWPL
Ga0208531_100544813300026020Rice Paddy SoilQRPLASLVMHIATFDTTTGLTQHLVQVEALVKAETLVQPLLVLTHQRPAAWPL
Ga0208535_102155223300026045Natural And Restored WetlandsADLRPLTSLVMHISTFDTSSGITQHLVQVEALVKAESLVQPLIVLTHERPGTWPL
Ga0207641_1231351523300026088Switchgrass RhizosphereGSENSKADPLDRPLSSLLMHIATFDTSAGITQHLVQVEAQVKAETLVQPLLVLTHARPDAWPL
Ga0209178_121822913300027725Agricultural SoilPVAGSENSKADPLDRPLSSLLMHIATFDTSAGITQHLVQVEAQVKAETLVQPLLVLTHSRPGAWPL
Ga0209798_1000206993300027843Wetland SedimentDTNAGITQHLVQVEAQVKAETLVQPLLILTHTRPSAWPL
Ga0256864_107056423300027964SoilFDTTTGVTQHLVQVEAVVKAESLVQPLLILTPSRPAAWPM
Ga0247828_1044165913300028587SoilHIATFDTTTGLTQHLVQVEALVKAETLVQPLLVLTHQRPGAWPL
Ga0247822_1090155013300028592SoilTGLTQHLVQVEALVKAETLVQPLLVLTHQRPGAWPL
Ga0247820_1007672023300028597SoilMHISTFDTSSGLTQHLVQVEALVKAESLVQPLIVLTHERPGTWPL
Ga0247820_1121288223300028597SoilLVMHIATFDTTTGLTQHLVQVEALVKAETLVQPLLVLTHQRPGAWPL
Ga0307313_1022136713300028715SoilMLMHIATFDTSTGVTQHLVQVEAVVRAESLVQPLLILTPSRPAAWPM
Ga0307282_1050223613300028784SoilSTGVTQHLVQVEAVVRAESLVQPLLILTPTRPAAWPM
Ga0307284_1016742123300028799SoilTTGVTQHLVQVEAVVRAESLVQPLLILTPTRPAAWPM
Ga0307284_1034308213300028799SoilATFDTTTGITQHLVQVEAMVKAETLVQPLLVLTHARPAAWPL
Ga0247825_1038868113300028812SoilVEGAPDDPAKADDVPVGQLVMHIATFDASAGITQNLVQVEAAIRADTLVQPLLILTHARPEAWPA
Ga0307310_1000066093300028824SoilMHIATFDTSTGVTQHLVQVEAVVRAESLVQPLLILTPTRPAAWPM
Ga0307310_1020014213300028824SoilDPLDRPLASLLMHIATFDTSTGVTQNMVQVEAQVKAETLVQPLLVLTHARPNAWPL
Ga0307312_1093203013300028828SoilPLPGTDDNRADPMDRPLASLLMHIATFDTSSGVTQHLVQVEAQVKAETLVQPLLVLTHARPNAWPL
Ga0307314_1013961513300028872SoilTPVLGTEDSRADPMDRPLSCLLMHIATFDTSTGVTQHLVQVEAQVKAETLVQPLLVLTHARPNAWPL
Ga0307278_1054285613300028878SoilPLDRPLASLLMHIATFDTSTGVTQNMVQVEAQVKAETLVQPLLVLTHARPNAWPL
Ga0307277_1045962013300028881SoilSTGVTQHLVQVEAQVKAETLVQPLLVLTHARPNAWPL
Ga0307308_1023482523300028884SoilDSRADPMDRPLSCLLMHIATFDTSTGVTQHLVQVEAQVKAETLVQPLLVLTHARPNAWPL
Ga0268386_1096268223300030619SoilTFDTSAGVTQHLVQVEALVKAETLVQPLLVLTHERPGAWPL
Ga0307408_10006538113300031548RhizosphereSMLMHIATFDTSTGVTQHLVQVEAVVKAESLVQPLLILAPSRPAAWPL
Ga0307408_10191443813300031548RhizosphereAGVTQHLVQVEALVKAESLVQPLIVLTHERPGAWPL
Ga0307408_10192895813300031548RhizosphereANVDRPLSSLVMQIATFDTSAGVTQHLVQVEALVKAETLVQPLLVLTQERPAPWPM
Ga0307413_1017168223300031824RhizosphereQMQIATFDAQTGVTKHLVQVEAVVKAETLVQPLVVLTTQRPSSWPL
Ga0307413_1018727323300031824RhizosphereLASMLMHIATFDTSTGVTQHLVQVEAVVKAESLVQPLLILAPSRPAAWPL
Ga0307413_1024746423300031824RhizosphereSLLMHIATFDTTTGVTQHLVQVEAQVKAETLVQPLLVLTHTRPGAWPL
Ga0307410_1022171813300031852RhizosphereGVTQHLVQVEALVKAETLVQPLLVLTQERPAPWPM
Ga0307410_1131089113300031852RhizosphereATFDTSTGVTQHLVQVEAQVKAETLVQPLLVLTHVRPNAWPL
Ga0307407_1000432813300031903RhizosphereMNIATFDTSTGITQHLVQVEAVVKAESLVQPLLILTPSRPAAWPM
Ga0307412_1043228113300031911RhizosphereGTDNSKADPLDRPLASLLMHIATFDTSTGVTQHLVQVEAQVKAETLVQPLLVLTHVRPNAWPL
Ga0308175_10277757823300031938SoilLMHIATFDANTGVTQNLVQVEAVVKAETLVQPLLILTPGRPGTWPY
Ga0307409_10036451723300031995RhizosphereTFDTSTGVTQHLVQVEAQVKAETLVQPLLVLTHVRPNAWPL
Ga0307415_10124105113300032126RhizosphereVIGTDNSKADPLDRPLASLLMHIATFDTSTGVTQHLVQVEAQVKAETLVQPLLVLTHVRPNAWPL
Ga0310889_1064160513300032179SoilTLEAAEGSKAEPDQRPLASLVMHIATFDTTTGLTQHLVQVEALVKAETLVQPLLVLTHQRPGAWPL
Ga0316628_10046730923300033513SoilFDTCTGVTQHLVQVEAQVKAETLVQPLLVLTHSRPGPWPL

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.