NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F082833

Metagenome Family F082833

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F082833
Family Type Metagenome
Number of Sequences 113
Average Sequence Length 37 residues
Representative Sequence MTRIASRVSQLTGEGALAVFSRAKELERQGRSIIHL
Number of Associated Samples 103
Number of Associated Scaffolds 113

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 64.60 %
% of genes near scaffold ends (potentially truncated) 99.12 %
% of genes from short scaffolds (< 2000 bps) 89.38 %
Associated GOLD sequencing projects 99
AlphaFold2 3D model prediction Yes
3D model pTM-score0.35

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (95.575 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(19.469 % of family members)
Environment Ontology (ENVO) Unclassified
(26.549 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(52.212 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 35.94%    β-sheet: 0.00%    Coil/Unstructured: 64.06%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.35
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 113 Family Scaffolds
PF02627CMD 30.97
PF13561adh_short_C2 14.16
PF01053Cys_Met_Meta_PP 2.65
PF02545Maf 2.65
PF13620CarboxypepD_reg 1.77
PF13193AMP-binding_C 1.77
PF01642MM_CoA_mutase 0.88
PF01966HD 0.88
PF13302Acetyltransf_3 0.88
PF01035DNA_binding_1 0.88
PF00491Arginase 0.88
PF13602ADH_zinc_N_2 0.88
PF01850PIN 0.88
PF13435Cytochrome_C554 0.88

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 113 Family Scaffolds
COG0599Uncharacterized conserved protein YurZ, alkylhydroperoxidase/carboxymuconolactone decarboxylase familyGeneral function prediction only [R] 30.97
COG2128Alkylhydroperoxidase family enzyme, contains CxxC motifInorganic ion transport and metabolism [P] 30.97
COG0075Archaeal aspartate aminotransferase or a related aminotransferase, includes purine catabolism protein PucGAmino acid transport and metabolism [E] 2.65
COG01567-keto-8-aminopelargonate synthetase or related enzymeCoenzyme transport and metabolism [H] 2.65
COG0399dTDP-4-amino-4,6-dideoxygalactose transaminaseCell wall/membrane/envelope biogenesis [M] 2.65
COG04247-methyl-GTP pyrophosphatase and related NTP pyrophosphatases, Maf/HAM1 superfamilySecondary metabolites biosynthesis, transport and catabolism [Q] 2.65
COG0436Aspartate/methionine/tyrosine aminotransferaseAmino acid transport and metabolism [E] 2.65
COG0520Selenocysteine lyase/Cysteine desulfuraseAmino acid transport and metabolism [E] 2.65
COG0626Cystathionine beta-lyase/cystathionine gamma-synthaseAmino acid transport and metabolism [E] 2.65
COG1921Seryl-tRNA(Sec) selenium transferaseTranslation, ribosomal structure and biogenesis [J] 2.65
COG1982Arginine/lysine/ornithine decarboxylaseAmino acid transport and metabolism [E] 2.65
COG2008Threonine aldolaseAmino acid transport and metabolism [E] 2.65
COG2873O-acetylhomoserine/O-acetylserine sulfhydrylase, pyridoxal phosphate-dependentAmino acid transport and metabolism [E] 2.65
COG4100Cystathionine beta-lyase family protein involved in aluminum resistanceInorganic ion transport and metabolism [P] 2.65
COG0010Arginase/agmatinase family enzymeAmino acid transport and metabolism [E] 0.88
COG0350DNA repair enzyme Ada (O6-methylguanine-DNA--protein-cysteine methyltransferase)Replication, recombination and repair [L] 0.88
COG1884Methylmalonyl-CoA mutase, N-terminal domain/subunitLipid transport and metabolism [I] 0.88
COG3695Alkylated DNA nucleotide flippase Atl1, participates in nucleotide excision repair, Ada-like DNA-binding domainTranscription [K] 0.88

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms95.58 %
UnclassifiedrootN/A4.42 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000156|NODE_c0332649All Organisms → cellular organisms → Bacteria635Open in IMG/M
3300000953|JGI11615J12901_10266843All Organisms → cellular organisms → Bacteria → Acidobacteria1630Open in IMG/M
3300004082|Ga0062384_100213573All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1147Open in IMG/M
3300004092|Ga0062389_102975698All Organisms → cellular organisms → Bacteria633Open in IMG/M
3300005446|Ga0066686_10727164All Organisms → cellular organisms → Bacteria667Open in IMG/M
3300005537|Ga0070730_10299259All Organisms → cellular organisms → Bacteria1054Open in IMG/M
3300005543|Ga0070672_101168222All Organisms → cellular organisms → Bacteria685Open in IMG/M
3300005557|Ga0066704_10895082All Organisms → cellular organisms → Bacteria549Open in IMG/M
3300005610|Ga0070763_10014233All Organisms → cellular organisms → Bacteria3367Open in IMG/M
3300005896|Ga0075282_1022608All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae818Open in IMG/M
3300005993|Ga0080027_10043904All Organisms → cellular organisms → Bacteria1612Open in IMG/M
3300006059|Ga0075017_100814041All Organisms → cellular organisms → Bacteria722Open in IMG/M
3300006237|Ga0097621_101675485All Organisms → cellular organisms → Bacteria605Open in IMG/M
3300006794|Ga0066658_10394796All Organisms → cellular organisms → Bacteria749Open in IMG/M
3300006804|Ga0079221_11411754All Organisms → cellular organisms → Bacteria554Open in IMG/M
3300006903|Ga0075426_11094230All Organisms → cellular organisms → Bacteria603Open in IMG/M
3300006903|Ga0075426_11541252All Organisms → cellular organisms → Bacteria505Open in IMG/M
3300007255|Ga0099791_10047270All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1922Open in IMG/M
3300009038|Ga0099829_10116749All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2096Open in IMG/M
3300009038|Ga0099829_10873741All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae746Open in IMG/M
3300009038|Ga0099829_11700665All Organisms → cellular organisms → Bacteria519Open in IMG/M
3300009089|Ga0099828_10692917All Organisms → cellular organisms → Bacteria915Open in IMG/M
3300009522|Ga0116218_1521809Not Available529Open in IMG/M
3300010046|Ga0126384_10569259All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium987Open in IMG/M
3300010358|Ga0126370_10629694All Organisms → cellular organisms → Bacteria931Open in IMG/M
3300010359|Ga0126376_11864309All Organisms → cellular organisms → Bacteria640Open in IMG/M
3300010360|Ga0126372_12531032All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis564Open in IMG/M
3300010361|Ga0126378_12130236All Organisms → cellular organisms → Bacteria640Open in IMG/M
3300010376|Ga0126381_103619970All Organisms → cellular organisms → Bacteria606Open in IMG/M
3300010376|Ga0126381_103816573All Organisms → cellular organisms → Bacteria588Open in IMG/M
3300010398|Ga0126383_10863433All Organisms → cellular organisms → Bacteria990Open in IMG/M
3300012096|Ga0137389_10513040All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1029Open in IMG/M
3300012203|Ga0137399_10591801All Organisms → cellular organisms → Bacteria932Open in IMG/M
3300012683|Ga0137398_10534717All Organisms → cellular organisms → Bacteria808Open in IMG/M
3300012685|Ga0137397_10036508All Organisms → cellular organisms → Bacteria3515Open in IMG/M
3300012923|Ga0137359_11613136All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium536Open in IMG/M
3300012925|Ga0137419_11612521All Organisms → cellular organisms → Bacteria552Open in IMG/M
3300012957|Ga0164303_10103492All Organisms → cellular organisms → Bacteria → Acidobacteria1416Open in IMG/M
3300012971|Ga0126369_12703044Not Available580Open in IMG/M
3300015052|Ga0137411_1284213All Organisms → cellular organisms → Bacteria → Acidobacteria5255Open in IMG/M
3300015054|Ga0137420_1118203All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium903Open in IMG/M
3300015262|Ga0182007_10109413All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae919Open in IMG/M
3300016341|Ga0182035_10310277All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1297Open in IMG/M
3300016357|Ga0182032_11520940All Organisms → cellular organisms → Bacteria → Acidobacteria581Open in IMG/M
3300017933|Ga0187801_10163139All Organisms → cellular organisms → Bacteria872Open in IMG/M
3300017961|Ga0187778_10390868All Organisms → cellular organisms → Bacteria → Acidobacteria911Open in IMG/M
3300017973|Ga0187780_10180289All Organisms → cellular organisms → Bacteria → Acidobacteria1470Open in IMG/M
3300018047|Ga0187859_10040379All Organisms → cellular organisms → Bacteria2496Open in IMG/M
3300018058|Ga0187766_10188127All Organisms → cellular organisms → Bacteria1299Open in IMG/M
3300018085|Ga0187772_10769625All Organisms → cellular organisms → Bacteria693Open in IMG/M
3300018433|Ga0066667_10896311All Organisms → cellular organisms → Bacteria762Open in IMG/M
3300020001|Ga0193731_1007918All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2710Open in IMG/M
3300020199|Ga0179592_10063906All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1681Open in IMG/M
3300020579|Ga0210407_11262657All Organisms → cellular organisms → Bacteria → Acidobacteria553Open in IMG/M
3300020580|Ga0210403_10413624All Organisms → cellular organisms → Bacteria1100Open in IMG/M
3300020580|Ga0210403_11313255All Organisms → cellular organisms → Bacteria552Open in IMG/M
3300020582|Ga0210395_10569957All Organisms → cellular organisms → Bacteria851Open in IMG/M
3300020582|Ga0210395_11021117All Organisms → cellular organisms → Bacteria612Open in IMG/M
3300021171|Ga0210405_10748238All Organisms → cellular organisms → Bacteria752Open in IMG/M
3300021401|Ga0210393_11582577All Organisms → cellular organisms → Bacteria520Open in IMG/M
3300021407|Ga0210383_10730170All Organisms → cellular organisms → Bacteria850Open in IMG/M
3300021407|Ga0210383_11716152All Organisms → cellular organisms → Bacteria514Open in IMG/M
3300021420|Ga0210394_10685751All Organisms → cellular organisms → Bacteria898Open in IMG/M
3300021432|Ga0210384_10019969All Organisms → cellular organisms → Bacteria → Acidobacteria6473Open in IMG/M
3300021475|Ga0210392_10414064All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae984Open in IMG/M
3300021478|Ga0210402_11024779All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis752Open in IMG/M
3300024310|Ga0247681_1036516All Organisms → cellular organisms → Bacteria737Open in IMG/M
3300025619|Ga0207926_1070974All Organisms → cellular organisms → Bacteria → Acidobacteria904Open in IMG/M
3300025906|Ga0207699_10358109All Organisms → cellular organisms → Bacteria1031Open in IMG/M
3300025936|Ga0207670_11013119Not Available699Open in IMG/M
3300026317|Ga0209154_1264820All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium → Acidobacterium ailaaui582Open in IMG/M
3300026323|Ga0209472_1140824All Organisms → cellular organisms → Bacteria920Open in IMG/M
3300026469|Ga0257169_1033527All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium → Acidobacterium ailaaui773Open in IMG/M
3300027605|Ga0209329_1101134Not Available631Open in IMG/M
3300027635|Ga0209625_1102981All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium640Open in IMG/M
3300027645|Ga0209117_1165701All Organisms → cellular organisms → Bacteria571Open in IMG/M
3300027660|Ga0209736_1090230All Organisms → cellular organisms → Bacteria839Open in IMG/M
3300027678|Ga0209011_1219177All Organisms → cellular organisms → Bacteria → Acidobacteria512Open in IMG/M
3300027745|Ga0209908_10101754All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium711Open in IMG/M
3300027765|Ga0209073_10207120All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium → Acidobacterium ailaaui748Open in IMG/M
3300027765|Ga0209073_10310507All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis627Open in IMG/M
3300027855|Ga0209693_10018051All Organisms → cellular organisms → Bacteria3374Open in IMG/M
3300027867|Ga0209167_10150007All Organisms → cellular organisms → Bacteria1223Open in IMG/M
3300027905|Ga0209415_10052828All Organisms → cellular organisms → Bacteria5180Open in IMG/M
3300028536|Ga0137415_10393048All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi1191Open in IMG/M
3300031128|Ga0170823_13688764All Organisms → cellular organisms → Bacteria566Open in IMG/M
3300031231|Ga0170824_123918912All Organisms → cellular organisms → Bacteria905Open in IMG/M
3300031258|Ga0302318_10173343All Organisms → cellular organisms → Bacteria1024Open in IMG/M
3300031616|Ga0307508_10167494Not Available1801Open in IMG/M
3300031718|Ga0307474_11606687All Organisms → cellular organisms → Bacteria511Open in IMG/M
3300031777|Ga0318543_10162737All Organisms → cellular organisms → Bacteria → Acidobacteria984Open in IMG/M
3300031823|Ga0307478_11191785All Organisms → cellular organisms → Bacteria634Open in IMG/M
3300031845|Ga0318511_10280475All Organisms → cellular organisms → Bacteria751Open in IMG/M
3300031910|Ga0306923_11315105All Organisms → cellular organisms → Bacteria → Acidobacteria766Open in IMG/M
3300031942|Ga0310916_10887287All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium748Open in IMG/M
3300031946|Ga0310910_10229435All Organisms → cellular organisms → Bacteria1447Open in IMG/M
3300031947|Ga0310909_10963678All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis698Open in IMG/M
3300031996|Ga0308176_11504686All Organisms → cellular organisms → Bacteria717Open in IMG/M
3300032041|Ga0318549_10274820All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis759Open in IMG/M
3300032054|Ga0318570_10438838All Organisms → cellular organisms → Bacteria → Acidobacteria596Open in IMG/M
3300032174|Ga0307470_10006017All Organisms → cellular organisms → Bacteria4773Open in IMG/M
3300032174|Ga0307470_10023951All Organisms → cellular organisms → Bacteria2803Open in IMG/M
3300032180|Ga0307471_101869125All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium750Open in IMG/M
3300032205|Ga0307472_101956098All Organisms → cellular organisms → Bacteria586Open in IMG/M
3300032261|Ga0306920_101349749All Organisms → cellular organisms → Bacteria1024Open in IMG/M
3300032401|Ga0315275_11560830All Organisms → cellular organisms → Bacteria707Open in IMG/M
3300032783|Ga0335079_12327241All Organisms → cellular organisms → Bacteria508Open in IMG/M
3300032829|Ga0335070_10285683All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1604Open in IMG/M
3300032829|Ga0335070_12045884All Organisms → cellular organisms → Bacteria515Open in IMG/M
3300032898|Ga0335072_10791823All Organisms → cellular organisms → Bacteria908Open in IMG/M
3300033412|Ga0310810_10144406All Organisms → cellular organisms → Bacteria → Acidobacteria2773Open in IMG/M
3300034163|Ga0370515_0329301All Organisms → cellular organisms → Bacteria645Open in IMG/M
3300034819|Ga0373958_0029199All Organisms → cellular organisms → Bacteria → Acidobacteria1072Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil19.47%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil13.27%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil7.96%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil5.31%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil5.31%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil4.42%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil3.54%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil3.54%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland3.54%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil2.65%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil2.65%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil1.77%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil1.77%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil1.77%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil1.77%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil1.77%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere1.77%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment0.89%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland0.89%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment0.89%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds0.89%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil0.89%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.89%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil0.89%
Untreated Peat SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil0.89%
Rice Paddy SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil0.89%
Thawing PermafrostEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Thawing Permafrost0.89%
Prmafrost SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil0.89%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere0.89%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.89%
BogEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Bog0.89%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere0.89%
EctomycorrhizaHost-Associated → Plants → Roots → Unclassified → Unclassified → Ectomycorrhiza0.89%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.89%
Rhizosphere SoilHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil0.89%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.89%
Sugar Cane Bagasse Incubating BioreactorEngineered → Solid Waste → Grass → Composting → Bioreactor → Sugar Cane Bagasse Incubating Bioreactor0.89%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000156Sugar cane bagasse incubating bioreactor microbial communities from Sao Carlos, Brazil, that are aerobic and semianaerobicEngineeredOpen in IMG/M
3300000953Soil microbial communities from Great Prairies - Kansas Corn soilEnvironmentalOpen in IMG/M
3300004082Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3EnvironmentalOpen in IMG/M
3300004092Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3EnvironmentalOpen in IMG/M
3300005446Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135EnvironmentalOpen in IMG/M
3300005537Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1EnvironmentalOpen in IMG/M
3300005543Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaGHost-AssociatedOpen in IMG/M
3300005557Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153EnvironmentalOpen in IMG/M
3300005610Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3EnvironmentalOpen in IMG/M
3300005896Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_80N_204EnvironmentalOpen in IMG/M
3300005993Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-046EnvironmentalOpen in IMG/M
3300006059Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012EnvironmentalOpen in IMG/M
3300006237Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2)Host-AssociatedOpen in IMG/M
3300006794Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107EnvironmentalOpen in IMG/M
3300006804Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200EnvironmentalOpen in IMG/M
3300006903Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5Host-AssociatedOpen in IMG/M
3300007255Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1EnvironmentalOpen in IMG/M
3300009038Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaGEnvironmentalOpen in IMG/M
3300009089Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaGEnvironmentalOpen in IMG/M
3300009522Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaGEnvironmentalOpen in IMG/M
3300010046Tropical forest soil microbial communities from Panama - MetaG Plot_36EnvironmentalOpen in IMG/M
3300010358Tropical forest soil microbial communities from Panama - MetaG Plot_3EnvironmentalOpen in IMG/M
3300010359Tropical forest soil microbial communities from Panama - MetaG Plot_15EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300012096Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaGEnvironmentalOpen in IMG/M
3300012203Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaGEnvironmentalOpen in IMG/M
3300012683Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaGEnvironmentalOpen in IMG/M
3300012685Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaGEnvironmentalOpen in IMG/M
3300012923Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaGEnvironmentalOpen in IMG/M
3300012925Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012957Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MGEnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300015052Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300015054Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300015262Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaGHost-AssociatedOpen in IMG/M
3300016341Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170EnvironmentalOpen in IMG/M
3300016357Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000EnvironmentalOpen in IMG/M
3300017933Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1EnvironmentalOpen in IMG/M
3300017961Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MGEnvironmentalOpen in IMG/M
3300017973Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MGEnvironmentalOpen in IMG/M
3300018047Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10EnvironmentalOpen in IMG/M
3300018058Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MGEnvironmentalOpen in IMG/M
3300018085Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018433Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116EnvironmentalOpen in IMG/M
3300020001Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1a2EnvironmentalOpen in IMG/M
3300020199Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300020579Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-MEnvironmentalOpen in IMG/M
3300020580Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-MEnvironmentalOpen in IMG/M
3300020582Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-OEnvironmentalOpen in IMG/M
3300021171Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-MEnvironmentalOpen in IMG/M
3300021401Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-OEnvironmentalOpen in IMG/M
3300021407Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-OEnvironmentalOpen in IMG/M
3300021420Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-MEnvironmentalOpen in IMG/M
3300021432Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-MEnvironmentalOpen in IMG/M
3300021475Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-OEnvironmentalOpen in IMG/M
3300021478Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-MEnvironmentalOpen in IMG/M
3300024310Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK22EnvironmentalOpen in IMG/M
3300025619Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-1 deep-072012 (SPAdes)EnvironmentalOpen in IMG/M
3300025906Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025936Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026317Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 (SPAdes)EnvironmentalOpen in IMG/M
3300026323Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 (SPAdes)EnvironmentalOpen in IMG/M
3300026469Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-17-BEnvironmentalOpen in IMG/M
3300027605Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_M3 (SPAdes)EnvironmentalOpen in IMG/M
3300027635Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_M2 (SPAdes)EnvironmentalOpen in IMG/M
3300027645Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 (SPAdes)EnvironmentalOpen in IMG/M
3300027660Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M3 (SPAdes)EnvironmentalOpen in IMG/M
3300027678Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M3 (SPAdes)EnvironmentalOpen in IMG/M
3300027745Thawing permafrost microbial communities from the Arctic, studying carbon transformations - Permafrost 812P2MEnvironmentalOpen in IMG/M
3300027765Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes)EnvironmentalOpen in IMG/M
3300027855Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes)EnvironmentalOpen in IMG/M
3300027867Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027905Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes)EnvironmentalOpen in IMG/M
3300028536Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300031128Oak Summer Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031231Coassembly Site 11 (all samples) - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031258Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_1EnvironmentalOpen in IMG/M
3300031616Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EMHost-AssociatedOpen in IMG/M
3300031718Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05EnvironmentalOpen in IMG/M
3300031777Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24EnvironmentalOpen in IMG/M
3300031823Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05EnvironmentalOpen in IMG/M
3300031845Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f18EnvironmentalOpen in IMG/M
3300031910Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2)EnvironmentalOpen in IMG/M
3300031942Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176EnvironmentalOpen in IMG/M
3300031946Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172EnvironmentalOpen in IMG/M
3300031947Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000HEnvironmentalOpen in IMG/M
3300031996Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2EnvironmentalOpen in IMG/M
3300032041Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22EnvironmentalOpen in IMG/M
3300032054Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f23EnvironmentalOpen in IMG/M
3300032174Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M
3300032401Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G03_0EnvironmentalOpen in IMG/M
3300032783Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3EnvironmentalOpen in IMG/M
3300032829Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3EnvironmentalOpen in IMG/M
3300032898Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1EnvironmentalOpen in IMG/M
3300033412Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NCEnvironmentalOpen in IMG/M
3300034163Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_04D_14EnvironmentalOpen in IMG/M
3300034819Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1Host-AssociatedOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
NODE_033264923300000156Sugar Cane Bagasse Incubating BioreactorMRSISSRISVMSGEGALSVFARAKELEAQGRSIIHLELG
JGI11615J12901_1026684313300000953SoilMRPLASRMSVMTGEGALSVYSHAKQLEKEGKSIIHLEL
Ga0062384_10021357333300004082Bog Forest SoilMIGFPRATMRPIATRVSQLNGEGALAVFSRAKELEKEGRS
Ga0062389_10297569823300004092Bog Forest SoilMTNATHTRKIASRVSQLTGEGALAVYSRAKELERAGKSIIHL
Ga0066686_1072716413300005446SoilMRPLAARMSVMSGEGALSVFARAKELERQGHSVIHLELGE
Ga0070730_1029925913300005537Surface SoilMTRIASRVAQLTGEGALAVFSRAKELEKQGRSIIHL
Ga0070672_10116822223300005543Miscanthus RhizosphereMRPLAARMSVMTGEGALTIFARAKELERAGRSIIHLELGE
Ga0066704_1089508213300005557SoilMTQRRIASRVSQLNGEGALAVFSRAKELERQGRSI
Ga0070763_1001423343300005610SoilMRSIASRMSVMSGEGALSVFARAKELERQGHSVIH
Ga0075282_102260813300005896Rice Paddy SoilVRQLASRLAVMSGEGALSVYARAKELEAAGRSIIHLEL
Ga0080027_1004390413300005993Prmafrost SoilMRPLATRVSQLTGEGALAVFSRAKELERQGRSIIH
Ga0075017_10081404113300006059WatershedsMAKIATRVSQLTGEGALAVYTRAKDLEKEGRSIIHLELG
Ga0097621_10167548513300006237Miscanthus RhizosphereMKPIASRMSVMTGEGALDVYLRAKALERLGQSIIHLELG
Ga0066658_1039479623300006794SoilMTRIASRISQLNGEGALAVYSRAKQLERQGRSIIRL
Ga0079221_1141175413300006804Agricultural SoilMRSIASRISVMSGEGALSVFARAKELEAQGRSIIHLEL
Ga0075426_1109423023300006903Populus RhizosphereMKSIAARIGVMSGEGALSVYSRAKELERQGRSIIHLEL
Ga0075426_1154125223300006903Populus RhizosphereMTRIASRVSQLNGEGALTVYSRAKELERQGRSIIHL
Ga0099791_1004727013300007255Vadose Zone SoilMTRIASRVSQLNGEGALTVYSRAKELERQGRSIIHLE
Ga0099829_1011674923300009038Vadose Zone SoilMTRIASRVSQLKGEGALAVYSRAKELERHGRSIIHLELG
Ga0099829_1087374113300009038Vadose Zone SoilMRKLAARLKGMTGEGALEVFTRAKELERQGRSIIH
Ga0099829_1170066513300009038Vadose Zone SoilMPKIATRVSQLTGEGALAVFSRAKDLEKEGRSIIH
Ga0099828_1069291713300009089Vadose Zone SoilMRPLASRMSVMSGEGALSVYARAKELEREGHSIIHL
Ga0116218_152180913300009522Peatlands SoilMPNIAARVSQLTGEGALAVFSRAKELEKQGRSIIHLE
Ga0126384_1056925923300010046Tropical Forest SoilMIFSPMAKIASRISELTGEGALAVFTRAKELEKQGRSVIHL
Ga0126370_1062969413300010358Tropical Forest SoilMIFSPMAKIASRISELTGEGALAVFTRAKELEKQGRSVIHLEL
Ga0126376_1186430923300010359Tropical Forest SoilMTRIATRVSQLNGEGALAVYSRAKELEKQGRSIIHLEL
Ga0126372_1253103223300010360Tropical Forest SoilMTRIASRVSQLHGEGALAVYSRAKELERLGRSIIHL
Ga0126378_1213023613300010361Tropical Forest SoilMRSIASRISVMSGEGALSVFARAKELEAQGRSIIHLE
Ga0126381_10361997013300010376Tropical Forest SoilMRPLASRLNVMSGEGALSVFARATELERAGRSIIHLEL
Ga0126381_10381657323300010376Tropical Forest SoilMAKIASRIDQLTGEGALAVFTRAKELEKEGRSIIHLELG*
Ga0126383_1086343313300010398Tropical Forest SoilMAKIASRIDQLTGEGALAVFTRAKELEKEGRSIIHLELGE
Ga0137389_1051304043300012096Vadose Zone SoilMRKLAARLKGMTGEGALEVFTRARELERQGRSIIHLE
Ga0137399_1059180123300012203Vadose Zone SoilMTERRIATRVSQLNGEGALAVFARAKELERQGRSII
Ga0137398_1053471713300012683Vadose Zone SoilMARRQIATRVSQLNGEGALAVFARAKELEGQGRSIIHLE
Ga0137397_1003650813300012685Vadose Zone SoilMTRIASRVSQLNGEGALAVYSRAKELERRGRSIIHL
Ga0137359_1161313613300012923Vadose Zone SoilMAQIASRVAQLNGEGALSVFARAKELEKQGRSIIHL
Ga0137419_1161252123300012925Vadose Zone SoilMKPLASRLEVLTGEGALTIYLRAKELELAGRSIIHLELGEP
Ga0164303_1010349213300012957SoilMRSLASRLSVMSGEGALSVFARAKELERQGRSIIHLEL
Ga0126369_1270304413300012971Tropical Forest SoilMRALAKRIGELSGEGALAVFQRARELERAGRDIIHL
Ga0137411_128421333300015052Vadose Zone SoilMTRIASRVSQLHGEGALAVYSRAKELEQQGRSIIHLE
Ga0137420_111820313300015054Vadose Zone SoilMTRIASRVSQLHGEGALAVYSRAKELEQQGRSIIHL
Ga0182007_1010941313300015262RhizosphereMKPIASRMSVMTGEGALTVFAHAKELERQGKSIIHLEL
Ga0182035_1031027713300016341SoilMAKIASRVSHLTGEGALAVYSRAKELEKEGRSIIH
Ga0182032_1152094013300016357SoilMPKIATRVSQLTGEGALAVFARAKELEKKGRSIIHLE
Ga0187801_1016313923300017933Freshwater SedimentMGKIASRVAELNGEGALAVFARAKELEKQGRSIIHLEL
Ga0187778_1039086813300017961Tropical PeatlandMPKIATRVSQLTGEGALAVFTRAKELEKEGRSIIHL
Ga0187780_1018028913300017973Tropical PeatlandMPKIATRVSQLTGEGALAVFTRAKELEKEGRSIIH
Ga0187859_1004037913300018047PeatlandMRSIASRISVMSGEGALSVFARAKELERQGRSIIHLEL
Ga0187766_1018812713300018058Tropical PeatlandMAKIASRISQLTGEGALAVFTRAKELEEQGRSIIH
Ga0187772_1076962513300018085Tropical PeatlandMRSIASRMSVMSGEGALSVFARAKELENQGRSIIHL
Ga0066667_1089631113300018433Grasslands SoilMTRIASRVSQLHGEGALAVYSRAKELERRGRSIIHLE
Ga0193731_100791813300020001SoilMRPLASRMSVMSGEGALSVFARAKELERAGRSIIHLELG
Ga0179592_1006390623300020199Vadose Zone SoilMAKIASRIAHLTGEGALAVFTRAKELEKAGRSIIHLEL
Ga0210407_1126265723300020579SoilMRRIASRVSQLNGEGALAVYSRAKELERAGRSIIH
Ga0210403_1041362423300020580SoilMAKIASRISQLTGEGALAVFTRARELEKAGHSIIH
Ga0210403_1131325513300020580SoilMRRIASRVSQLNGEGALAVFSRAKELERAGRSIIH
Ga0210395_1056995713300020582SoilMKSIASRMSVMSGEGALSVFARAKELERQGRSIIHLEL
Ga0210395_1102111713300020582SoilMRPVATRVSQLTGEGALAVFSRAKELEREGRSIIHL
Ga0210405_1074823823300021171SoilMRSIASRMSVMSGEGALSVFARAREMEGQGRSIIHL
Ga0210393_1158257713300021401SoilMRRIASRVSQLNGEGALAVYSRAKELERAGRSIIHLEL
Ga0210383_1073017023300021407SoilMQPLASRMAVMTGEGALSVYARAKELEREGRSIIH
Ga0210383_1171615213300021407SoilMRSIASRVSVMSGEGALSVFARAKELEAQGRSIIHLE
Ga0210394_1068575113300021420SoilMRPLASRMAVMTGEGALSVYARAKELEREGRSIIHLE
Ga0210384_1001996943300021432SoilMRPLASRISQMTGEGALAVYSRAKELEKQGRSIIHLELG
Ga0210392_1041406413300021475SoilMKPLASRVSQLNGEGALAVFSRAKELEKQGRSIIH
Ga0210402_1102477923300021478SoilMRKIASRVAQLHGEGALAVYSRAKELEREGRSIIHLELGE
Ga0247681_103651613300024310SoilMTRIATRVSQLNGEGALAVFSRAKELERQGRSIIH
Ga0207926_107097433300025619Arctic Peat SoilMRPLASRLSVLSGEGALTVYSRAKELERQGRSIIHL
Ga0207699_1035810923300025906Corn, Switchgrass And Miscanthus RhizosphereMRPLASRLNVMSGEGALSVFARAKELERHGRSIIHL
Ga0207670_1101311923300025936Switchgrass RhizosphereMRPIAARIDALSGEGALSVYARAKELERQGRSIIH
Ga0209154_126482033300026317SoilMRALASRMSVMSGEGALSVFAHARELERQGRSIIHLE
Ga0209472_114082433300026323SoilMGTRRIATRVSQLNGEGALAVFSRAKQLEKQGHSII
Ga0257169_103352713300026469SoilMRPIASRISVMSGEGALSVFARAKELEREGRSIIHLEL
Ga0209329_110113413300027605Forest SoilMRRIASRVSQLNGEGALAVYSRAKELERAGRSIIHL
Ga0209625_110298123300027635Forest SoilMTRIASRVSQLNGEGALAVYSRAKELERQGRSIIHLE
Ga0209117_116570113300027645Forest SoilMTRIASRVSQLTGEGALAVFSRAKELERQGRSIIHL
Ga0209736_109023013300027660Forest SoilMAKIASRISQLTGEGALAVFSRAKELEKAGHSIIHLELG
Ga0209011_121917723300027678Forest SoilMAKIASRVSQLTGEGALAVFSRAKELEKEGRSIIHLE
Ga0209908_1010175413300027745Thawing PermafrostMRPLASRMSVMSGEGALSVFARAKELERVGRSIIPVSYTHLD
Ga0209073_1020712033300027765Agricultural SoilMRPPASRLKVMSGEGALSVYARAKELEAQGRPIIHLEL
Ga0209073_1031050713300027765Agricultural SoilMTRIASRVSQLHGEGALSVYSRAKELERSGRSVIHLELG
Ga0209693_1001805113300027855SoilMRSIASRMSVMSGEGALSVFARAKELERQGHSVIHLE
Ga0209167_1015000723300027867Surface SoilMRSIASRMSVMSGEGALSVYARAKELEAQGRSVIH
Ga0209415_1005282813300027905Peatlands SoilMQPLASRMSVMTGEGALAVNARARELERQGRSIIH
Ga0137415_1039304813300028536Vadose Zone SoilMAPIASRVAELNGEGALSVFARAKELEKLGRSIIHL
Ga0170823_1368876423300031128Forest SoilMIGFPGATMRPIATRVSQLNGEGALAVFSRAKELEKEGR
Ga0170824_12391891223300031231Forest SoilMRSIASRMSVMSGEGALSVFARAKELEAQGRSIIY
Ga0302318_1017334323300031258BogMRSIASRMSVMSGEGALSVFARAKELESQGRSIIHLEL
Ga0307508_1016749423300031616EctomycorrhizaMAAMKAVAARIAEMRGEGALSVYARAKELERDGRSII
Ga0307474_1160668723300031718Hardwood Forest SoilMKQTRKIASRVAQLTGEGALAVYSRAKELERAGKSIIHLEL
Ga0318543_1016273733300031777SoilMRSLASRLSVMSGEGALSVFARAKELERAGRSIIH
Ga0307478_1119178513300031823Hardwood Forest SoilMRSIASRMSVMSGEGALSVFARARELERQGRSIIHLEL
Ga0318511_1028047523300031845SoilMRSLASRLSVMSGEGALSVFARAKELERAGKHGERA
Ga0306923_1131510513300031910SoilMPRIAARISQLTGEGALAVFSRAKELEKEGRSIIHLE
Ga0310916_1088728713300031942SoilMAKIASRIDQLTGEGALAVFTRAKELETEGRSIIH
Ga0310910_1022943513300031946SoilMPDIATRVSELSGEGALAVFARAKELEQQGRSIIH
Ga0310909_1096367823300031947SoilMTRIASRVSQLHGEGALAVYSRAKELERLGRSVIH
Ga0308176_1150468613300031996SoilMRPLASRMAVMSGEGALSVYARAKELERAGRSIIHLEL
Ga0318549_1027482013300032041SoilMTRIASRVSQLHGEGALAVYSRAKELERLGRSVIHLELG
Ga0318570_1043883813300032054SoilMPNIATRVSELSGEGALAVFARAKELEQQGRSIIHL
Ga0307470_1000601733300032174Hardwood Forest SoilMAKIASRIAQLTGEGALAVFTRAKELEEAGRSIIHLELGE
Ga0307470_1002395113300032174Hardwood Forest SoilMAQIASRVAELNGEGAISVFARAKELEKQGRSIIH
Ga0307471_10186912523300032180Hardwood Forest SoilMTRIASRVSQLTGEGALAVFSRAKELERQGRSIIH
Ga0307472_10195609813300032205Hardwood Forest SoilMTRIASRVSQLNGEGALAVFSRAKELEKQGRSIIHLE
Ga0306920_10134974923300032261SoilMAKIATRISQLTGEGALAVYTRAKELEKQGRSIIH
Ga0315275_1156083013300032401SedimentMKSLASRLSVLTGEGALTVYARAKELERQGRSIIHLELG
Ga0335079_1232724113300032783SoilMRPIASRMSVMTGEGALSVYQRAKELEARGQSIIHLELG
Ga0335070_1028568313300032829SoilMRPLSSRLSVLTGEGALSIYLQAKELERQGRSIIHLELGE
Ga0335070_1204588413300032829SoilMAKIASRIDQLTGEGALAVFTRAKELEKEGRSIIH
Ga0335072_1079182313300032898SoilMRSIASRMSVMSGEGALSVFARAKELEAQGQSIIHLELG
Ga0310810_1014440613300033412SoilMRPLAARMSVMTGEGALTIFARAKELERAGRSIIH
Ga0370515_0329301_539_6433300034163Untreated Peat SoilMRSIASRMSVMSGEGALSVFARAQDLERQGRSIIH
Ga0373958_0029199_3_1073300034819Rhizosphere SoilMRPLAARMSVMSGEGALTIFARAKELERAGRSIIH

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.