NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F082876

Metagenome / Metatranscriptome Family F082876

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F082876
Family Type Metagenome / Metatranscriptome
Number of Sequences 113
Average Sequence Length 43 residues
Representative Sequence YGVFLITSKVLDARRRGATTEAYGAIRRKEERSKATPQMMP
Number of Associated Samples 67
Number of Associated Scaffolds 113

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 7.96 %
% of genes near scaffold ends (potentially truncated) 90.27 %
% of genes from short scaffolds (< 2000 bps) 73.45 %
Associated GOLD sequencing projects 59
AlphaFold2 3D model prediction Yes
3D model pTM-score0.28

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (69.027 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Oceanic → Sediment → Marine Sediment
(31.858 % of family members)
Environment Ontology (ENVO) Unclassified
(46.903 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Sediment (saline)
(40.708 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 46.38%    β-sheet: 0.00%    Coil/Unstructured: 53.62%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.28
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 113 Family Scaffolds
PF07690MFS_1 2.65
PF00216Bac_DNA_binding 2.65
PF00072Response_reg 1.77
PF04055Radical_SAM 1.77
PF00005ABC_tran 1.77
PF00701DHDPS 1.77
PF01368DHH 1.77
PF04879Molybdop_Fe4S4 0.88
PF01546Peptidase_M20 0.88
PF13476AAA_23 0.88
PF02421FeoB_N 0.88
PF02771Acyl-CoA_dh_N 0.88
PF00316FBPase 0.88
PF00027cNMP_binding 0.88
PF03454MoeA_C 0.88
PF07992Pyr_redox_2 0.88
PF01402RHH_1 0.88
PF00152tRNA-synt_2 0.88
PF02880PGM_PMM_III 0.88
PF00211Guanylate_cyc 0.88
PF16916ZT_dimer 0.88
PF01136Peptidase_U32 0.88
PF10035DUF2179 0.88
PF06050HGD-D 0.88
PF00749tRNA-synt_1c 0.88
PF02223Thymidylate_kin 0.88
PF08448PAS_4 0.88
PF03590AsnA 0.88
PF02190LON_substr_bdg 0.88
PF04015DUF362 0.88
PF02665Nitrate_red_gam 0.88
PF12675DUF3795 0.88
PF03989DNA_gyraseA_C 0.88
PF13607Succ_CoA_lig 0.88
PF04216FdhE 0.88
PF02321OEP 0.88
PF01965DJ-1_PfpI 0.88
PF00037Fer4 0.88
PF01022HTH_5 0.88
PF00999Na_H_Exchanger 0.88
PF14602Hexapep_2 0.88
PF02092tRNA_synt_2f 0.88
PF02085Cytochrom_CIII 0.88
PF12838Fer4_7 0.88
PF13404HTH_AsnC-type 0.88
PF01210NAD_Gly3P_dh_N 0.88
PF01725Ham1p_like 0.88
PF13382Adenine_deam_C 0.88
PF13977TetR_C_6 0.88
PF07927HicA_toxin 0.88
PF02899Phage_int_SAM_1 0.88
PF01266DAO 0.88
PF01098FTSW_RODA_SPOVE 0.88
PF04073tRNA_edit 0.88
PF13537GATase_7 0.88
PF08443RimK 0.88
PF13567DUF4131 0.88
PF13732DUF4162 0.88
PF01541GIY-YIG 0.88
PF02649GCHY-1 0.88
PF00501AMP-binding 0.88
PF00579tRNA-synt_1b 0.88
PF01343Peptidase_S49 0.88
PF01063Aminotran_4 0.88
PF00496SBP_bac_5 0.88
PF14437MafB19-deam 0.88
PF00583Acetyltransf_1 0.88
PF07498Rho_N 0.88
PF00850Hist_deacetyl 0.88
PF04167DUF402 0.88
PF05362Lon_C 0.88
PF11006DUF2845 0.88
PF00155Aminotran_1_2 0.88
PF02922CBM_48 0.88
PF03480DctP 0.88
PF01713Smr 0.88

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 113 Family Scaffolds
COG03294-hydroxy-tetrahydrodipicolinate synthase/N-acetylneuraminate lyaseCell wall/membrane/envelope biogenesis [M] 3.54
COG0776Bacterial nucleoid DNA-binding protein IHF-alphaReplication, recombination and repair [L] 2.65
COG0115Branched-chain amino acid aminotransferase/4-amino-4-deoxychorismate lyaseAmino acid transport and metabolism [E] 1.77
COG0123Acetoin utilization deacetylase AcuC or a related deacetylaseSecondary metabolites biosynthesis, transport and catabolism [Q] 1.77
COG0616Periplasmic serine protease, ClpP classPosttranslational modification, protein turnover, chaperones [O] 1.77
COG1538Outer membrane protein TolCCell wall/membrane/envelope biogenesis [M] 1.77
COG0008Glutamyl- or glutaminyl-tRNA synthetaseTranslation, ribosomal structure and biogenesis [J] 0.88
COG0017Aspartyl/asparaginyl-tRNA synthetaseTranslation, ribosomal structure and biogenesis [J] 0.88
COG0025NhaP-type Na+/H+ or K+/H+ antiporterInorganic ion transport and metabolism [P] 0.88
COG0033Phosphoglucomutase/phosphomannomutaseCarbohydrate transport and metabolism [G] 0.88
COG0125Thymidylate kinaseNucleotide transport and metabolism [F] 0.88
COG0127Inosine/xanthosine triphosphate pyrophosphatase, all-alpha NTP-PPase familyNucleotide transport and metabolism [F] 0.88
COG0158Fructose-1,6-bisphosphataseCarbohydrate transport and metabolism [G] 0.88
COG0162Tyrosyl-tRNA synthetaseTranslation, ribosomal structure and biogenesis [J] 0.88
COG0173Aspartyl-tRNA synthetaseTranslation, ribosomal structure and biogenesis [J] 0.88
COG0180Tryptophanyl-tRNA synthetaseTranslation, ribosomal structure and biogenesis [J] 0.88
COG0188DNA gyrase/topoisomerase IV, subunit AReplication, recombination and repair [L] 0.88
COG0303Molybdopterin Mo-transferase (molybdopterin biosynthesis)Coenzyme transport and metabolism [H] 0.88
COG0370Fe2+ transporter FeoBInorganic ion transport and metabolism [P] 0.88
COG0466ATP-dependent Lon protease, bacterial typePosttranslational modification, protein turnover, chaperones [O] 0.88
COG0475Kef-type K+ transport system, membrane component KefBInorganic ion transport and metabolism [P] 0.88
COG0751Glycyl-tRNA synthetase, beta subunitTranslation, ribosomal structure and biogenesis [J] 0.88
COG0772Peptodoglycan polymerase FtsW/RodA/SpoVECell cycle control, cell division, chromosome partitioning [D] 0.88
COG082623S rRNA C2501 and tRNA U34 5'-hydroxylation protein RlhA/YrrN/YrrO, U32 peptidase familyTranslation, ribosomal structure and biogenesis [J] 0.88
COG1067Predicted ATP-dependent proteasePosttranslational modification, protein turnover, chaperones [O] 0.88
COG1109PhosphomannomutaseCarbohydrate transport and metabolism [G] 0.88
COG1190Lysyl-tRNA synthetase, class IITranslation, ribosomal structure and biogenesis [J] 0.88
COG1469GTP cyclohydrolase FolE2Coenzyme transport and metabolism [H] 0.88
COG1724Predicted RNA binding protein YcfA, dsRBD-like fold, HicA-like mRNA interferase familyGeneral function prediction only [R] 0.88
COG1750Predicted archaeal serine protease, S18 familyGeneral function prediction only [R] 0.88
COG1775Benzoyl-CoA reductase/2-hydroxyglutaryl-CoA dehydratase subunit, BcrC/BadD/HgdBAmino acid transport and metabolism [E] 0.88
COG1960Acyl-CoA dehydrogenase related to the alkylation response protein AidBLipid transport and metabolism [I] 0.88
COG2006Uncharacterized conserved protein, DUF362 familyFunction unknown [S] 0.88
COG2114Adenylate cyclase, class 3Signal transduction mechanisms [T] 0.88
COG2181Nitrate reductase gamma subunitEnergy production and conversion [C] 0.88
COG2269Elongation factor P--beta-lysine ligase (EF-P beta-lysylation pathway)Translation, ribosomal structure and biogenesis [J] 0.88
COG2502Asparagine synthetase AAmino acid transport and metabolism [E] 0.88
COG3004Na+/H+ antiporter NhaAEnergy production and conversion [C] 0.88
COG3058Formate dehydrogenase maturation protein FdhEPosttranslational modification, protein turnover, chaperones [O] 0.88
COG3263NhaP-type Na+/H+ and K+/H+ antiporter with C-terminal TrkAC and CorC domainsEnergy production and conversion [C] 0.88
COG3480Predicted secreted protein YlbL, contains PDZ domainSignal transduction mechanisms [T] 0.88
COG4651Predicted Kef-type K+ transport protein, K+/H+ antiporter domainInorganic ion transport and metabolism [P] 0.88
COG4973Site-specific recombinase XerCReplication, recombination and repair [L] 0.88
COG4974Site-specific recombinase XerDReplication, recombination and repair [L] 0.88


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms69.03 %
UnclassifiedrootN/A30.97 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000229|TB_LI09_3DRAFT_1002676All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → delta proteobacterium NaphS24733Open in IMG/M
3300000393|WOR_117991Not Available606Open in IMG/M
3300001751|JGI2172J19969_10130023Not Available714Open in IMG/M
3300001751|JGI2172J19969_10220071All Organisms → cellular organisms → Bacteria520Open in IMG/M
3300001752|JGI2173J19968_10021580All Organisms → cellular organisms → Bacteria2252Open in IMG/M
3300001752|JGI2173J19968_10084852All Organisms → cellular organisms → Bacteria → Proteobacteria940Open in IMG/M
3300001752|JGI2173J19968_10092854All Organisms → cellular organisms → Bacteria887Open in IMG/M
3300001753|JGI2171J19970_10154266All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → unclassified Chromatiales → Chromatiales bacterium761Open in IMG/M
3300001753|JGI2171J19970_10175096Not Available702Open in IMG/M
3300001854|JGI24422J19971_10033488All Organisms → cellular organisms → Bacteria3027Open in IMG/M
3300001855|JGI2160J19893_10006058All Organisms → cellular organisms → Bacteria3108Open in IMG/M
3300001855|JGI2160J19893_10076428All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium657Open in IMG/M
3300002052|SMTZ1_10001590All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria25426Open in IMG/M
3300002052|SMTZ1_10004702All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → delta proteobacterium NaphS213718Open in IMG/M
3300002052|SMTZ1_10018248All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales6875Open in IMG/M
3300002053|SMTZ23_10037306All Organisms → cellular organisms → Bacteria11837Open in IMG/M
3300004050|Ga0055491_10016257All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Olavius sp. associated proteobacterium Delta 11409Open in IMG/M
3300005252|Ga0068712_1129465Not Available860Open in IMG/M
3300005254|Ga0068714_10399727Not Available511Open in IMG/M
3300005612|Ga0070723_10035827All Organisms → cellular organisms → Bacteria → Proteobacteria1900Open in IMG/M
3300005832|Ga0074469_10159863All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria2113Open in IMG/M
3300006224|Ga0079037_101872161All Organisms → cellular organisms → Bacteria599Open in IMG/M
3300008417|Ga0115363_10175884Not Available526Open in IMG/M
3300009034|Ga0115863_1253241All Organisms → cellular organisms → Bacteria2092Open in IMG/M
3300009037|Ga0105093_10034560All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfatibacillum → Desulfatibacillum alkenivorans2216Open in IMG/M
3300009037|Ga0105093_10318990Not Available831Open in IMG/M
3300009053|Ga0105095_10496435Not Available677Open in IMG/M
3300009053|Ga0105095_10778619Not Available535Open in IMG/M
3300009078|Ga0105106_10196018Not Available1475Open in IMG/M
3300009078|Ga0105106_10341182All Organisms → cellular organisms → Bacteria1083Open in IMG/M
3300009078|Ga0105106_10437632All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium HGW-Deltaproteobacteria-15942Open in IMG/M
3300009078|Ga0105106_11122266Not Available558Open in IMG/M
3300009078|Ga0105106_11262875All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae524Open in IMG/M
3300009078|Ga0105106_11360014Not Available504Open in IMG/M
3300009087|Ga0105107_10281922All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium HGW-Deltaproteobacteria-151159Open in IMG/M
3300009091|Ga0102851_10447205All Organisms → cellular organisms → Bacteria1314Open in IMG/M
3300009131|Ga0115027_10002645All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria5134Open in IMG/M
3300009153|Ga0105094_10428127Not Available767Open in IMG/M
3300009179|Ga0115028_10259705Not Available1142Open in IMG/M
3300009506|Ga0118657_10018825All Organisms → cellular organisms → Bacteria → Proteobacteria13914Open in IMG/M
3300009506|Ga0118657_11787075Not Available716Open in IMG/M
3300009506|Ga0118657_11826386All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium707Open in IMG/M
3300010392|Ga0118731_104621946All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfatiglans → Desulfatiglans anilini1329Open in IMG/M
3300010392|Ga0118731_113676882All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria898Open in IMG/M
3300010412|Ga0136852_10334897Not Available1486Open in IMG/M
3300010413|Ga0136851_10356297All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1476Open in IMG/M
3300010413|Ga0136851_11547735Not Available638Open in IMG/M
3300010993|Ga0139329_131336Not Available547Open in IMG/M
3300013098|Ga0164320_10650420All Organisms → cellular organisms → Bacteria553Open in IMG/M
3300013098|Ga0164320_10745204Not Available522Open in IMG/M
3300015370|Ga0180009_10035320All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria3467Open in IMG/M
3300015370|Ga0180009_10079847All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Olavius sp. associated proteobacterium Delta 11818Open in IMG/M
3300017963|Ga0180437_10238334All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1410Open in IMG/M
3300017963|Ga0180437_10459720All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium943Open in IMG/M
3300017963|Ga0180437_11206283Not Available539Open in IMG/M
3300017971|Ga0180438_10092170All Organisms → cellular organisms → Bacteria2631Open in IMG/M
3300017971|Ga0180438_10974876Not Available615Open in IMG/M
3300021351|Ga0210365_10561745Not Available557Open in IMG/M
3300025807|Ga0208828_1012456All Organisms → cellular organisms → Bacteria2262Open in IMG/M
3300025807|Ga0208828_1069925All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Acidibrevibacterium → Acidibrevibacterium fodinaquatile810Open in IMG/M
3300027721|Ga0209492_1293150Not Available543Open in IMG/M
3300027792|Ga0209287_10090673All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium1140Open in IMG/M
3300027814|Ga0209742_10024919All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophobacteraceae1982Open in IMG/M
(restricted) 3300027856|Ga0255054_10272178Not Available827Open in IMG/M
3300027871|Ga0209397_10000106All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae7676Open in IMG/M
3300027885|Ga0209450_10128740Not Available1722Open in IMG/M
3300027887|Ga0208980_10652585All Organisms → cellular organisms → Bacteria597Open in IMG/M
3300027888|Ga0209635_10024969All Organisms → cellular organisms → Bacteria4815Open in IMG/M
3300027888|Ga0209635_10038512All Organisms → cellular organisms → Bacteria3888Open in IMG/M
3300027888|Ga0209635_10056781All Organisms → cellular organisms → Bacteria3191Open in IMG/M
3300027888|Ga0209635_10171477All Organisms → cellular organisms → Bacteria1771Open in IMG/M
3300027888|Ga0209635_10221534All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1530Open in IMG/M
3300027888|Ga0209635_10331999All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium SM23_611200Open in IMG/M
3300027888|Ga0209635_10952319All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division KSB1 → unclassified candidate division KSB1 → candidate division KSB1 bacterium 4484_219599Open in IMG/M
3300027890|Ga0209496_10086306All Organisms → cellular organisms → Bacteria1308Open in IMG/M
3300027893|Ga0209636_10386879All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium1195Open in IMG/M
3300027893|Ga0209636_10580792All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium906Open in IMG/M
3300027893|Ga0209636_11223117Not Available527Open in IMG/M
3300027897|Ga0209254_10969481Not Available557Open in IMG/M
3300027900|Ga0209253_10318514Not Available1202Open in IMG/M
3300027901|Ga0209427_10025654All Organisms → cellular organisms → Bacteria6038Open in IMG/M
3300027901|Ga0209427_10037667All Organisms → cellular organisms → Bacteria4769Open in IMG/M
3300027901|Ga0209427_10050731All Organisms → cellular organisms → Bacteria → Proteobacteria3963Open in IMG/M
3300027901|Ga0209427_10087486All Organisms → cellular organisms → Bacteria2818Open in IMG/M
3300027901|Ga0209427_10088319All Organisms → cellular organisms → Bacteria2801Open in IMG/M
3300027901|Ga0209427_10121555All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria2293Open in IMG/M
3300027901|Ga0209427_10129487All Organisms → cellular organisms → Bacteria2202Open in IMG/M
3300027901|Ga0209427_10150131All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria2006Open in IMG/M
3300027901|Ga0209427_10364703All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1128Open in IMG/M
3300027901|Ga0209427_10405445All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1052Open in IMG/M
3300027901|Ga0209427_10423587All Organisms → cellular organisms → Bacteria1022Open in IMG/M
3300027917|Ga0209536_100131346All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria3171Open in IMG/M
3300027972|Ga0209079_10059224All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1297Open in IMG/M
3300027979|Ga0209705_10018476All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria3830Open in IMG/M
3300029827|Ga0134606_10093397Not Available950Open in IMG/M
3300029827|Ga0134606_10219135All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales586Open in IMG/M
3300031367|Ga0307440_1176377Not Available586Open in IMG/M
3300031691|Ga0316579_10076431Not Available1591Open in IMG/M
3300031691|Ga0316579_10152537All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division WOR-3 → candidate division WOR-3 bacterium1115Open in IMG/M
3300031834|Ga0315290_10846724All Organisms → cellular organisms → Bacteria → Proteobacteria779Open in IMG/M
3300031834|Ga0315290_11616624Not Available523Open in IMG/M
3300032118|Ga0315277_11070474All Organisms → cellular organisms → Bacteria729Open in IMG/M
3300032143|Ga0315292_10167724Not Available1778Open in IMG/M
3300032163|Ga0315281_10668284Not Available1086Open in IMG/M
3300032164|Ga0315283_11062420All Organisms → cellular organisms → Bacteria → Proteobacteria853Open in IMG/M
3300033406|Ga0316604_10095786All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1556Open in IMG/M
3300033413|Ga0316603_10325493All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1366Open in IMG/M
3300033481|Ga0316600_10696458All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium714Open in IMG/M
3300033481|Ga0316600_10986206All Organisms → cellular organisms → Bacteria596Open in IMG/M
3300033485|Ga0316626_11756369All Organisms → cellular organisms → Bacteria560Open in IMG/M
3300033486|Ga0316624_10586967All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium967Open in IMG/M
3300033488|Ga0316621_11522330Not Available514Open in IMG/M
3300033557|Ga0316617_100551254All Organisms → cellular organisms → Bacteria1059Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Marine SedimentEnvironmental → Aquatic → Marine → Oceanic → Sediment → Marine Sediment31.86%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment14.16%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil7.08%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment5.31%
Hypersaline Lake SedimentEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Sediment → Hypersaline Lake Sediment4.42%
WetlandEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland3.54%
Freshwater Lake SedimentEnvironmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment2.65%
Marine SedimentEnvironmental → Aquatic → Marine → Coastal → Sediment → Marine Sediment2.65%
Mangrove SedimentEnvironmental → Aquatic → Marine → Wetlands → Sediment → Mangrove Sediment2.65%
Mangrove SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Mangrove Sediment2.65%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater1.77%
Freshwater WetlandsEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands1.77%
GroundwaterEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater1.77%
MarineEnvironmental → Aquatic → Marine → Coastal → Sediment → Marine1.77%
Marine SedimentEnvironmental → Aquatic → Marine → Hydrothermal Vents → Sediment → Marine Sediment1.77%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere1.77%
Enrichment CultureEngineered → Lab Enrichment → Defined Media → Anaerobic Media → Unclassified → Enrichment Culture1.77%
SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Sediment0.89%
GroundwaterEnvironmental → Aquatic → Freshwater → Groundwater → Cave Water → Groundwater0.89%
SeawaterEnvironmental → Aquatic → Marine → Inlet → Unclassified → Seawater0.89%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine0.89%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh0.89%
Marine SedimentEnvironmental → Aquatic → Marine → Intertidal Zone → Sediment → Marine Sediment0.89%
Sediment, IntertidalEnvironmental → Aquatic → Marine → Intertidal Zone → Sediment → Sediment, Intertidal0.89%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands0.89%
WetlandEnvironmental → Aquatic → Marine → Wetlands → Sediment → Wetland0.89%
Hydrothermal VentsEnvironmental → Aquatic → Marine → Hydrothermal Vents → Unclassified → Hydrothermal Vents0.89%
Sediment (Intertidal)Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal)0.89%
SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment0.89%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000229Groundwater microbial communities from subsurface biofilms in sulfidic aquifier in Frasassi Gorge, Italy, sample from two redox zones- LI09_3EnvironmentalOpen in IMG/M
3300000393GB background transcript assemblyEnvironmentalOpen in IMG/M
3300001751Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-2-30_32EnvironmentalOpen in IMG/M
3300001752Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-1-36_30EnvironmentalOpen in IMG/M
3300001753Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-3-24_28EnvironmentalOpen in IMG/M
3300001854Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-1-52-54EnvironmentalOpen in IMG/M
3300001855Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-2-8_12EnvironmentalOpen in IMG/M
3300002052Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-1-36_30EnvironmentalOpen in IMG/M
3300002053Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR_SMTZEnvironmentalOpen in IMG/M
3300004050Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_CattailNLA_D2EnvironmentalOpen in IMG/M
3300005252Enrichment culture microbial communities from Arthur Kill intertidal strait, New Jersey, USA, that are MTBE-degrading - MTBE-AKS1 (Arthur Kill Sulfidogenic replicate 1) MetaGEngineeredOpen in IMG/M
3300005254Enrichment culture microbial communities from rom New York Harbor, USA that are MTBE-degrading - MTBE-NYH (New York Harbor Sulfidogenic) MetaGEngineeredOpen in IMG/M
3300005612Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd00.2EnvironmentalOpen in IMG/M
3300005832Microbial communities from Baker Bay sediment, Columbia River estuary, Washington - S.41_BBBEnvironmentalOpen in IMG/M
3300006224Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 4 metaGEnvironmentalOpen in IMG/M
3300008417Sea floor sediment microbial communities from Gulf of Mexico Methane Seep - MPC12TEnvironmentalOpen in IMG/M
3300009034Intertidal mud flat sediment archaeal communities from Garolim Bay, Chungcheongnam-do, KoreaEnvironmentalOpen in IMG/M
3300009037Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 1-3cm March2015EnvironmentalOpen in IMG/M
3300009053Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 19-21cm March2015EnvironmentalOpen in IMG/M
3300009078Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm September2015EnvironmentalOpen in IMG/M
3300009087Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 19-21cm September2015EnvironmentalOpen in IMG/M
3300009091Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300009131Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Open_0915_D1EnvironmentalOpen in IMG/M
3300009153Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 10-12cm March2015EnvironmentalOpen in IMG/M
3300009179Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Plant_0915_D1EnvironmentalOpen in IMG/M
3300009506Mangrove sediment microbial communities from Mai Po Nature Reserve Marshes in Hong Kong, China - Maipo_8EnvironmentalOpen in IMG/M
3300010392Coastal sediment microbial communities from Rhode Island, USA. Combined Assembly of Gp0121717, Gp0123912, Gp0123935, Gp0139423, Gp0139424, Gp0139388, Gp0139387, Gp0139386, Gp0139385EnvironmentalOpen in IMG/M
3300010412Mangrove sediment microbial communities from Mai Po Nature Reserve Marshes in Hong Kong, China - Maipo_10EnvironmentalOpen in IMG/M
3300010413Mangrove sediment microbial communities from Mai Po Nature Reserve Marshes in Hong Kong, China - Maipo_9EnvironmentalOpen in IMG/M
3300010993ECM15MPS05_Bassembled -- Sediment microbial communities from coastal marsh in Port Sulphur, LA sequencing method B (2X150bp)EnvironmentalOpen in IMG/M
3300013098Subseafloor sediment microbial communities from Guaymas Basin, Gulf of California, Mexico - Guay11, Core 4567-28, 0-3 cmEnvironmentalOpen in IMG/M
3300015370Groundwater microbial communities from the Aspo Hard Rock Laboratory (HRL) deep subsurface site, Sweden - OS_PC_MetaGEnvironmentalOpen in IMG/M
3300017963Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_3_D_1 metaGEnvironmentalOpen in IMG/M
3300017971Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_3_D_2 metaGEnvironmentalOpen in IMG/M
3300021351Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Washington, United States ? S.637 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300025807Freshwater microbial communities from Lake Kivu, Western Province, Rwanda to study Microbial Dark Matter (Phase II) - Kivu_160m (SPAdes)EnvironmentalOpen in IMG/M
3300027721Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015 (SPAdes)EnvironmentalOpen in IMG/M
3300027792Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm May2015 (SPAdes)EnvironmentalOpen in IMG/M
3300027814Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-3-8_10 (SPAdes)EnvironmentalOpen in IMG/M
3300027856 (restricted)Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_23EnvironmentalOpen in IMG/M
3300027871Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Open_0915_D1 (SPAdes)EnvironmentalOpen in IMG/M
3300027885Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - LWP11 LW (SPAdes)EnvironmentalOpen in IMG/M
3300027887Wetland microbial communities from Twitchell Island in the Sacramento Delta, sample from surface sediment Aug2011 Site A1 BulkEnvironmentalOpen in IMG/M
3300027888Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-2-30_32 (SPAdes)EnvironmentalOpen in IMG/M
3300027890Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Plant_0915_D1 (SPAdes)EnvironmentalOpen in IMG/M
3300027893Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-1-52-54 (SPAdes)EnvironmentalOpen in IMG/M
3300027897Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - DIP11 DI (SPAdes)EnvironmentalOpen in IMG/M
3300027900Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - BRP12 BR (SPAdes)EnvironmentalOpen in IMG/M
3300027901Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-1-36_30 (SPAdes)EnvironmentalOpen in IMG/M
3300027917Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-2-8_12 (SPAdes)EnvironmentalOpen in IMG/M
3300027972Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 10-12cm September2015 (SPAdes)EnvironmentalOpen in IMG/M
3300027979Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm September2015 (SPAdes)EnvironmentalOpen in IMG/M
3300029827Marine sediment microbial communities from Barataria Bay, New Orleans, USA to study impact of Deep Water Horizon explosion - M1047EnvironmentalOpen in IMG/M
3300031367Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - WE1604-10EnvironmentalOpen in IMG/M
3300031691Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrAHost-AssociatedOpen in IMG/M
3300031834Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_0EnvironmentalOpen in IMG/M
3300032118Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_15EnvironmentalOpen in IMG/M
3300032143Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_0EnvironmentalOpen in IMG/M
3300032163Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G07_0EnvironmentalOpen in IMG/M
3300032164Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_0EnvironmentalOpen in IMG/M
3300033406Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day20_CTEnvironmentalOpen in IMG/M
3300033413Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day10_noCTEnvironmentalOpen in IMG/M
3300033481Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day5_CTEnvironmentalOpen in IMG/M
3300033485Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_T1_C1_D5_AEnvironmentalOpen in IMG/M
3300033486Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_N3_C1_D5_AEnvironmentalOpen in IMG/M
3300033488Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_OW2_C1_D1_CEnvironmentalOpen in IMG/M
3300033557Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D2_BEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
TB_LI09_3DRAFT_100267653300000229GroundwaterLEEFLITSEASGARRRGATTEAYGAIRRKEERAKATPQMMP
WOR_11799123300000393Hydrothermal VentsKSAGYGVSLITSKVLDARRRGATTEAYGAIRRKEERSKATPQMMP*
JGI2172J19969_1013002313300001751Marine SedimentSAGYGIFLITSKVLDARRRGATTEAYGAIRRKEERSKATPQMMP*
JGI2172J19969_1022007123300001751Marine SedimentAGYGVFLITSKVLDARRRGATTEAYGAIRRKEKRSKATPQMMP*
JGI2173J19968_1002158013300001752Marine SedimentYGVFLITSEVLDARRRGATAEAYGAIRRKEERSKATPQMMP*
JGI2173J19968_1008485213300001752Marine SedimentMKSAGYALFLITSKVLDARRRGVTTEAYGAIRRKEERSKATPQMIP*
JGI2173J19968_1009285423300001752Marine SedimentFLITSKVLDARRRGATTEAYGAIRRKEERSKATPQMMP*
JGI2171J19970_1015426623300001753Marine SedimentGLRGFLATRKVSDTRRRGVMTEAYGEIRRREERSKATP*
JGI2171J19970_1017509623300001753Marine SedimentKLKSAGYGVFLITSKVLDARRRGATTEVYGAIRRKEERSKETPQMMP*
JGI24422J19971_1003348863300001854Marine SedimentLKSAGYGVFLITSKVLDARRRGATTEAYGAIRRKEERSK
JGI2160J19893_1000605843300001855Marine SedimentMKSAAYGVFLITSKVLDARRRGATTEAYGAIRRKKERSKATPQMMP*
JGI2160J19893_1007642813300001855Marine SedimentAAYGVFLITSKVLDARRRGATTEAYGAIRRKEERSKATPQMMP*
SMTZ1_1000159013300002052Marine SedimentLITSKVLDARRRGATTEAYGAIRRKEERSKATPQMMP*
SMTZ1_1000470213300002052Marine SedimentKPAGYAVLLITSKVLDARRRGATTEAYGAIRRREERSKATPQMMP*
SMTZ1_1001824813300002052Marine SedimentMKPAGYAVVLITSKVLDARRRGATTEAYGAIRRKEERSK
SMTZ23_10037306113300002053Marine SedimentVKLAGYAPVLITSKVLDARRRGATTEAYGAIRRKKERSKATPQ
Ga0055491_1001625713300004050Natural And Restored WetlandsEADFEQFLITSKASDARRRGATTEAYGAIRRKEERAKATPQMVP*
Ga0068712_112946523300005252Enrichment CultureEFLITSKASDARRRGATSEAYGIIRRNEERAKATPQMMP*
Ga0068714_1039972723300005254Enrichment CultureGKFLITSKASDARRRGATTEAYEPIRRKEERAKATPQMMP*
Ga0070723_1003582713300005612Marine SedimentMKLESYGVFLITIKVLDARRRGATTEAYGLIRRKEERS
Ga0074469_1015986323300005832Sediment (Intertidal)MVSVGLGQFLITSKASDARRRGATTEAYEPIRRKEEQAKATPQMMP*
Ga0079037_10187216123300006224Freshwater WetlandsQFLITSKASDARRRGATTEAYEAIRRKEERAKATPQIMP*
Ga0115363_1017588423300008417SedimentMKLPAYGVFLITSKVLDARRRGATTEAYGSXRRXEERSKATPQMXP*
Ga0115863_125324113300009034Sediment, IntertidalKLKSAGYGVFLITRKVLDARRRGATTEAYGAIRRKEEGSEATPQMMP*
Ga0105093_1003456013300009037Freshwater SedimentKRDLGLEVFLITSKASDARRRGATTEAYEAIRRKEESASGGKATPQMMP*
Ga0105093_1031899013300009037Freshwater SedimentKMGLGTFLIARKESDARCRGATTETYEPIRRREEREKATPQMMP*
Ga0105095_1049643513300009053Freshwater SedimentASDARRRGATTEAYGAIRRKEESASGGKATPQMMP*
Ga0105095_1077861923300009053Freshwater SedimentFLITSEHPADARRRGTTTEAYGAIRRKEERAKATPQMMP*
Ga0105106_1019601823300009078Freshwater SedimentRERKQEAASEQFLITSEASDARRRGATTEAYEAIRRKEERAKATPQMMP*
Ga0105106_1034118213300009078Freshwater SedimentMGLEVFLITRKASDARRRGATTEAYEAIRRKEERAKATPQMMP
Ga0105106_1043763213300009078Freshwater SedimentSKASDARRRGATTEAYEAIRRKEESASGGKATPQMMP*
Ga0105106_1112226613300009078Freshwater SedimentFLITSKASDARRRGATTEAYGAIRRKKERAKATQQMMS*
Ga0105106_1126287523300009078Freshwater SedimentEGFLITSEASDARRRGATTEAYGVIRRKEERAKATPQMMPCR*
Ga0105106_1136001413300009078Freshwater SedimentLKVTFLITSKASDARRRGATTEAYGVIRHKEERPKATWQMMS*
Ga0105107_1028192213300009087Freshwater SedimentFLITSEASDARRRGATTEAYGAIHRKEERAKATPQMMH*
Ga0102851_1044720513300009091Freshwater WetlandsSTGLGTFLITSKASDARRQGATTEAYGPIRRKKERTLATQQMML*
Ga0115027_1000264553300009131WetlandEGFLITSEASDARRRGATTEAYGAIRRKEERAKATPQMMP*
Ga0105094_1042812713300009153Freshwater SedimentDFEQFLITSKASDARHRGATTEEYEAIRRKEERAKATPQMMP*
Ga0115028_1025970523300009179WetlandDSDFEGFLITSKALDAKRRGATTEAYGAIRRKEERSKATPQMMP*
Ga0118657_1001882543300009506Mangrove SedimentMKSAAYGVFLITTKVLDARRRGATTEAYGAIRRKEERSKATPQMMP*
Ga0118657_1178707523300009506Mangrove SedimentYGVFLITSKVLDARRRGATTEAYGAIRRKEERSKATPQMMP*
Ga0118657_1182638623300009506Mangrove SedimentTSKVLDARRQGVPTEADKKLRRREKRAKATQQMMP*
Ga0118731_10462194633300010392MarineLITSKVLDARRRGATTEPYGAIRRKEERSKATPQMMP*
Ga0118731_11367688233300010392MarineMKLAVFRVFLITIKVLDARRQGATTEAYGSIGRREERSKATPQMI
Ga0136852_1033489723300010412Mangrove SedimentKLKSASYAVFLITSKVLDARRQGATREVYGAIRHNEERSKATPQNLSLRKQG*
Ga0136851_1035629733300010413Mangrove SedimentSAAYAVFLITSKVLDARRRGATTEAYGAIRRKEERSKATPQMMP*
Ga0136851_1154773523300010413Mangrove SedimentINQLSILGINLKSEGYGLSVTTSKVLDARRRGATTEAYGSIRRKEERSKGTPQMMP*
Ga0139329_13133613300010993SedimentSKVLDARHRGATTEAYGAIRRKEVPSMATPQMMP*
Ga0164320_1065042023300013098Marine SedimentMKLAGYGVSRIVSKVLDARRRGATTEAYGAIRRKEERSKATPQM
Ga0164320_1074520413300013098Marine SedimentSLIISKVLDARRRGATTEAYGAIRRKDERSKATTQMMP*
Ga0180009_1003532013300015370GroundwaterSASLGGFLITGKASDARRRGATTEAYEPIRRKEERAKATPQMML*
Ga0180009_1007984713300015370GroundwaterFLITSKALDARRRGATTEAYRAIRRKEERAKATPQMMP*
Ga0180437_1023833413300017963Hypersaline Lake SedimentLITRKVLDARRRGATTEAYGAIRRKEERSKATPQMMP
Ga0180437_1045972013300017963Hypersaline Lake SedimentMKKAGYAALLITSKALDARRRGAKTEAYGAIRRKEERSKATPQMMP
Ga0180437_1120628313300017963Hypersaline Lake SedimentALITIKVLDARRRGATTEAYGAIRRKEERSKATPQMMP
Ga0180438_1009217023300017971Hypersaline Lake SedimentMELESYAALLITSKVLDARRRGVTTEAYAPIRRKEERSKATPQMMP
Ga0180438_1097487613300017971Hypersaline Lake SedimentMKPESYAVLLIPSKALDARRRGVTTEAYGAIRRKEERSKATPLELAKSRLGG
Ga0210365_1056174523300021351EstuarineLEKSASLGRFLITGKASDARRRGATTEAYEPIRRKEERAKATPQMMP
Ga0208828_101245613300025807FreshwaterRLRSADYVIFLITVKILDARRRGATTEAYGAIRRKEKRSKATPQMMSCR
Ga0208828_106992513300025807FreshwaterYGVFLITSKILDARRRGATTEAYGAIRRKEERSKATPQMMF
Ga0209492_129315023300027721Freshwater SedimentRAGYQEFLITSKASDARRRGATTEAYGAIRRKEERAKATPQMMP
Ga0209287_1009067313300027792Freshwater SedimentPKPKPGAVYQGFLVTSKASDARRQGATTEAYGAIRRKEERSKATPQMMP
Ga0209742_1002491913300027814Marine SedimentAAYGVFLITSKVLDARRRGATTEAYGAIRRKEERSKATPQMMP
(restricted) Ga0255054_1027217813300027856SeawaterTIKALDARRRGATTEAYGLIRRKEEGSKVTRQMMA
Ga0209397_1000010613300027871WetlandGFLITSEASDARRRGATTEAYGAIRRKEERAKATPQMMP
Ga0209450_1012874013300027885Freshwater Lake SedimentTSEASDARRRGATTEAYEAIRRKEERAMATPQRMP
Ga0208980_1065258513300027887WetlandVRFREPRQMADFDQFLITGKTSDAGRRGATTEAYEAIRRKEERAKATPQMMP
Ga0209635_1002496913300027888Marine SedimentKSAGYGVFLITSKVLDARRRGATTEAYGAIRRKEERSKATPQMMP
Ga0209635_1003851213300027888Marine SedimentMKSAGYGVFLITSKVLDARRRGATTEAYGAIRRKEERSKATP
Ga0209635_1005678113300027888Marine SedimentGIFLITSKVLDARRRGATTEAYGAIRRKKERSKATPQMIP
Ga0209635_1017147723300027888Marine SedimentKMKSAGYGVFLITSKVLDARRRGATTEAYGAIRRKEERSKATPQMMP
Ga0209635_1022153433300027888Marine SedimentGYGIFLITSKVLDARRRGATTEAYGAILRKEERSKATPQMMP
Ga0209635_1033199913300027888Marine SedimentEPLKLKSAGYGILLITSKVLDARRRGVTTEAYGVIRRKEERSKATPQMMP
Ga0209635_1095231923300027888Marine SedimentSRVKSAGYGVFLITSKVLDARHRGATAEAYGAIRREEERSKATPQMMP
Ga0209496_1008630613300027890WetlandEEARFEQFLITRKASDARRRGATTEAYEAIRRKEERAKATPQMMP
Ga0209636_1038687913300027893Marine SedimentYGVFLITSKVLDARRRGATTEAYGAIRRKEERSKATPQMMP
Ga0209636_1058079223300027893Marine SedimentGYGVFLITSKVLDARRRGATTEAYGAIRRKEERSKATPQMMP
Ga0209636_1122311713300027893Marine SedimentGYGVFLITSKVLDARRRGTTTEAYGAIRRKEERSKATQQMMP
Ga0209254_1096948113300027897Freshwater Lake SedimentMADFEQFLITGKTSDAKRRGATTEAYEAIRRKEESASCGKATPQMMF
Ga0209253_1031851423300027900Freshwater Lake SedimentTGLGTFLITSKASDARRQGATTEAYGPMRRKEERTQATQQMMTLRRQG
Ga0209427_1002565413300027901Marine SedimentFLITSKVLDARRRGATTEAYGAIRRKPVESLKVEREERSKATPQMMP
Ga0209427_1003766713300027901Marine SedimentLKTAGYRIFLITRKVLDARRRGATTEAYGTIRRKEERSKATPQMMP
Ga0209427_1005073113300027901Marine SedimentLITSKVLDARRRGATTEAYGAIRRKEERSKATLQMMA
Ga0209427_1008748613300027901Marine SedimentFLITSKVLDARRRGATTEAYGAIRRKEERPKATPQMMP
Ga0209427_1008831913300027901Marine SedimentMKAADYATSLITIKVLDARRRGATTEAYGAIRRKKERSKATPQMM
Ga0209427_1012155513300027901Marine SedimentAGYGVFLITSKVLDARRRGATTEAYGAIRRKEKRSKATPQMMP
Ga0209427_1012948723300027901Marine SedimentTRKVLDARRRGTTTEAYGAIRRKPVESLKVEREERSKATPQMVP
Ga0209427_1015013113300027901Marine SedimentMKPAGYAVLLITSKVLDARRRGATTEAYGAIRRKEERSKAT
Ga0209427_1036470313300027901Marine SedimentMKVSSLKLAGYTVLLITSKVLDARRRGATTEAYGAIRRKEERSK
Ga0209427_1040544523300027901Marine SedimentYGVFLITSEVLDARRRGATAEAYGAIRRKEERSKATPQMMP
Ga0209427_1042358723300027901Marine SedimentLIPTKVLDARRRGATTEAYGGIRRKEERSKATPQMMP
Ga0209536_10013134613300027917Marine SedimentMKSAAYGVFLITSKVLDARRRGATTEAYGAIRRKKERSKATPQMMP
Ga0209079_1005922413300027972Freshwater SedimentQASDFEGFLITSEASDARRRGATTEAYGAIRRKEERAKATPQMMP
Ga0209705_1001847613300027979Freshwater SedimentGVGISLVTGKASDARRRGATIEAYDQYAAKRSRTKATQQMMTYR
Ga0134606_1009339713300029827Marine SedimentITNKVLDARRRGATTEAYGAIRRKPAPAKAGERRSKAMAQNLCLQKQG
Ga0134606_1021913523300029827Marine SedimentSRIWEKFLITSKASDARRRGATTEAYGAIRRKEERAKATPQMMP
Ga0307440_117637713300031367Salt MarshKGILITSKALDARRRGATTEAYGIIRRKEERAKTTPQMMP
Ga0316579_1007643133300031691RhizospherePLFSILAMKPETYAVLLITSKALDARRRGATTEAYGAIRRKEERSKATPQMMP
Ga0316579_1015253713300031691RhizosphereMKPENYGVLLITSKALDARRQGVTTEAYGAIRRKEERSKATPLELA
Ga0315290_1084672413300031834SedimentMADFDQFLITGKTSDARRRGATTEAYEAIRRKEERAKATPQMMF
Ga0315290_1161662413300031834SedimentEEFLITSEASDARRRGATTEAYEAIRRKEERAKATQQMMP
Ga0315277_1107047413300032118SedimentSAGLGRFLITSEASDARRRGATTEAYEAIRRKEERAKATPQNLSLRKQG
Ga0315292_1016772443300032143SedimentLEEFLITSEASDARRRGATTEAYGAIRRKEERAKATPQMMP
Ga0315281_1066828423300032163SedimentMDFEEFLITSKASDARRRGATTEAYGAIRRKEERAKATPQMMP
Ga0315283_1106242033300032164SedimentEGFLITNKASGARRRGATTEAYEAIRRKEERAKATPQMMS
Ga0316604_1009578623300033406SoilKQDSNFEGFLITSEASDARRRGATTEAYGAIRRKEERAKATPQMMP
Ga0316603_1032549313300033413SoilSNFEGFLITSEASDARRRGATTEAYGAIRRKEERAKATPQMMS
Ga0316600_1069645823300033481SoilVALGRFLVTGKASDARRRGATNEAYEAIRRKEERTKATPQMMLCR
Ga0316600_1098620613300033481SoilEFPEPKPEVGFEQFLITRKAPDARRRGATSEAYGAIRRKEESA
Ga0316626_1175636923300033485SoilQDSKFEGFLITSEASDARRRGATTEAYGAIRRKEERAKATPQMMP
Ga0316624_1058696723300033486SoilPERKQEAGHEQFLITGKAPDARRRGATTEAYEAIRRKEERAKATPQMMP
Ga0316621_1152233023300033488SoilFFEARPGAGYQEFLITSKAADARRRGATSEAYGAISRREERPKATPQMML
Ga0316617_10055125423300033557SoilLFKQGCEEARFERFLITSKASDARRRGATTEAYEAIRRKEERAKATPQMMP


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.