NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F082945

Metagenome / Metatranscriptome Family F082945

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F082945
Family Type Metagenome / Metatranscriptome
Number of Sequences 113
Average Sequence Length 45 residues
Representative Sequence MVEFGLRFLKGPWATAALVCLAAFVVLFALAGQTVNAPFVYTAPK
Number of Associated Samples 99
Number of Associated Scaffolds 113

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 80.36 %
% of genes near scaffold ends (potentially truncated) 21.24 %
% of genes from short scaffolds (< 2000 bps) 81.42 %
Associated GOLD sequencing projects 90
AlphaFold2 3D model prediction Yes
3D model pTM-score0.45

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (91.150 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(15.929 % of family members)
Environment Ontology (ENVO) Unclassified
(26.549 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(51.327 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 50.68%    β-sheet: 0.00%    Coil/Unstructured: 49.32%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.45
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 113 Family Scaffolds
PF01757Acyl_transf_3 58.41
PF05239PRC 8.85
PF08238Sel1 3.54
PF10458Val_tRNA-synt_C 2.65
PF05015HigB-like_toxin 0.88
PF14714KH_dom-like 0.88
PF01381HTH_3 0.88
PF01597GCV_H 0.88
PF08281Sigma70_r4_2 0.88
PF10691DUF2497 0.88
PF07859Abhydrolase_3 0.88
PF12762DDE_Tnp_IS1595 0.88

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 113 Family Scaffolds
COG0509Glycine cleavage system protein H (lipoate-binding)Amino acid transport and metabolism [E] 0.88
COG0657Acetyl esterase/lipaseLipid transport and metabolism [I] 0.88
COG3549Plasmid maintenance system killer proteinDefense mechanisms [V] 0.88


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms91.15 %
UnclassifiedrootN/A8.85 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300001471|JGI12712J15308_10208837All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Roseiarcaceae → Roseiarcus → Roseiarcus fermentans515Open in IMG/M
3300001546|JGI12659J15293_10000797All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae10113Open in IMG/M
3300002245|JGIcombinedJ26739_100041837All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales4133Open in IMG/M
3300002245|JGIcombinedJ26739_100047587All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae3892Open in IMG/M
3300004091|Ga0062387_100140003All Organisms → cellular organisms → Bacteria → Proteobacteria1376Open in IMG/M
3300004092|Ga0062389_104746709All Organisms → cellular organisms → Bacteria → Proteobacteria512Open in IMG/M
3300004479|Ga0062595_101191322All Organisms → cellular organisms → Bacteria → Proteobacteria675Open in IMG/M
3300004635|Ga0062388_100310306All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Roseiarcaceae → Roseiarcus → Roseiarcus fermentans1322Open in IMG/M
3300005434|Ga0070709_11622049All Organisms → cellular organisms → Bacteria → Proteobacteria527Open in IMG/M
3300005533|Ga0070734_10016107All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales5126Open in IMG/M
3300005534|Ga0070735_10158288All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1402Open in IMG/M
3300005602|Ga0070762_10197027All Organisms → cellular organisms → Bacteria → Proteobacteria1231Open in IMG/M
3300005614|Ga0068856_101758413All Organisms → cellular organisms → Bacteria → Proteobacteria632Open in IMG/M
3300005712|Ga0070764_10434071Not Available781Open in IMG/M
3300005712|Ga0070764_11117289All Organisms → cellular organisms → Bacteria → Proteobacteria500Open in IMG/M
3300005764|Ga0066903_104392206All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Roseiarcaceae → Roseiarcus → Roseiarcus fermentans753Open in IMG/M
3300006176|Ga0070765_102105472Not Available527Open in IMG/M
3300009093|Ga0105240_10015764All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales10255Open in IMG/M
3300009545|Ga0105237_12114281All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Roseiarcaceae → Roseiarcus → Roseiarcus fermentans572Open in IMG/M
3300009624|Ga0116105_1190685All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Roseiarcaceae → Roseiarcus → Roseiarcus fermentans561Open in IMG/M
3300009633|Ga0116129_1156640All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Roseiarcaceae → Roseiarcus → Roseiarcus fermentans648Open in IMG/M
3300009784|Ga0123357_10667843All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Roseiarcaceae → Roseiarcus → Roseiarcus fermentans760Open in IMG/M
3300009824|Ga0116219_10059384All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Roseiarcaceae → Roseiarcus → Roseiarcus fermentans2257Open in IMG/M
3300009826|Ga0123355_10867284All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Roseiarcaceae → Roseiarcus → Roseiarcus fermentans989Open in IMG/M
3300009826|Ga0123355_11237775All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Roseiarcaceae → Roseiarcus → Roseiarcus fermentans757Open in IMG/M
3300009826|Ga0123355_12223570All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Roseiarcaceae → Roseiarcus → Roseiarcus fermentans500Open in IMG/M
3300010375|Ga0105239_11030920All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales946Open in IMG/M
3300011418|Ga0153954_1000237All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales49090Open in IMG/M
3300012924|Ga0137413_10691260All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Roseiarcaceae → Roseiarcus → Roseiarcus fermentans773Open in IMG/M
3300014169|Ga0181531_10644844Not Available657Open in IMG/M
3300014199|Ga0181535_10137552All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1542Open in IMG/M
3300014200|Ga0181526_10505265Not Available765Open in IMG/M
3300014200|Ga0181526_10530761All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Roseiarcaceae → Roseiarcus → Roseiarcus fermentans744Open in IMG/M
3300014501|Ga0182024_10289888All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Roseiarcaceae → Roseiarcus → Roseiarcus fermentans2170Open in IMG/M
3300014655|Ga0181516_10557430All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Roseiarcaceae → Roseiarcus → Roseiarcus fermentans590Open in IMG/M
3300015206|Ga0167644_1084733All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales991Open in IMG/M
3300016270|Ga0182036_10541221All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Roseiarcaceae → Roseiarcus → Roseiarcus fermentans927Open in IMG/M
3300016371|Ga0182034_10596264Not Available932Open in IMG/M
3300016422|Ga0182039_10969842All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Roseiarcaceae → Roseiarcus → Roseiarcus fermentans761Open in IMG/M
3300016445|Ga0182038_10865888All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Roseiarcaceae → Roseiarcus → Roseiarcus fermentans795Open in IMG/M
3300017924|Ga0187820_1073083All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Methylocapsa → unclassified Methylocapsa → Methylocapsa sp. S129955Open in IMG/M
3300017936|Ga0187821_10297969All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Roseiarcaceae → Roseiarcus → Roseiarcus fermentans640Open in IMG/M
3300017970|Ga0187783_10864487All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Roseiarcaceae → Roseiarcus → Roseiarcus fermentans652Open in IMG/M
3300017993|Ga0187823_10045612All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1192Open in IMG/M
3300018007|Ga0187805_10585862All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Roseiarcaceae → Roseiarcus → Roseiarcus fermentans526Open in IMG/M
3300018037|Ga0187883_10230439All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Roseiarcaceae → Roseiarcus → Roseiarcus fermentans948Open in IMG/M
3300018044|Ga0187890_10562718All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Roseiarcaceae → Roseiarcus → Roseiarcus fermentans642Open in IMG/M
3300020070|Ga0206356_10024026Not Available737Open in IMG/M
3300020582|Ga0210395_10030221All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales3968Open in IMG/M
3300020582|Ga0210395_10937550All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Roseiarcaceae → Roseiarcus → Roseiarcus fermentans643Open in IMG/M
3300020582|Ga0210395_11428060All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Roseiarcaceae → Roseiarcus → Roseiarcus fermentans504Open in IMG/M
3300021171|Ga0210405_10730407All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Roseiarcaceae → Roseiarcus → Roseiarcus fermentans763Open in IMG/M
3300021180|Ga0210396_11406945All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Roseiarcaceae → Roseiarcus → Roseiarcus fermentans576Open in IMG/M
3300021361|Ga0213872_10169847All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Roseiarcaceae → Roseiarcus → Roseiarcus fermentans946Open in IMG/M
3300021384|Ga0213876_10021612All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria3403Open in IMG/M
3300021401|Ga0210393_10238804All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1473Open in IMG/M
3300021402|Ga0210385_10650111All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Roseiarcaceae → Roseiarcus → Roseiarcus fermentans806Open in IMG/M
3300021404|Ga0210389_10172762All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Roseiarcaceae → Roseiarcus → Roseiarcus fermentans1681Open in IMG/M
3300021474|Ga0210390_10077746All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales2748Open in IMG/M
3300021477|Ga0210398_10362802All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Roseiarcaceae → Roseiarcus → Roseiarcus fermentans1181Open in IMG/M
3300021479|Ga0210410_11287333All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Roseiarcaceae → Roseiarcus → Roseiarcus fermentans623Open in IMG/M
3300021560|Ga0126371_13846088All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Roseiarcaceae → Roseiarcus → Roseiarcus fermentans506Open in IMG/M
3300023056|Ga0233357_1033281All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Roseiarcaceae → Roseiarcus → Roseiarcus fermentans644Open in IMG/M
3300025913|Ga0207695_10030771All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales5905Open in IMG/M
3300025914|Ga0207671_10331601All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Roseiarcaceae → Roseiarcus → Roseiarcus fermentans1205Open in IMG/M
3300027096|Ga0208099_1067308All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Roseiarcaceae → Roseiarcus → Roseiarcus fermentans503Open in IMG/M
3300027117|Ga0209732_1014170All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1341Open in IMG/M
3300027496|Ga0208987_1023843All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Roseiarcaceae → Roseiarcus → Roseiarcus fermentans1059Open in IMG/M
3300027505|Ga0209218_1035830All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Roseiarcaceae → Roseiarcus → Roseiarcus fermentans977Open in IMG/M
3300027619|Ga0209330_1074953All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Roseiarcaceae → Roseiarcus → Roseiarcus fermentans771Open in IMG/M
3300027696|Ga0208696_1046292All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Roseiarcaceae → Roseiarcus → Roseiarcus fermentans1534Open in IMG/M
3300027729|Ga0209248_10005237All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Roseiarcaceae → Roseiarcus → Roseiarcus fermentans4112Open in IMG/M
3300027729|Ga0209248_10041430All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1423Open in IMG/M
3300027767|Ga0209655_10110138All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Roseiarcaceae → Roseiarcus → Roseiarcus fermentans916Open in IMG/M
3300027812|Ga0209656_10379240All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Roseiarcaceae → Roseiarcus → Roseiarcus fermentans638Open in IMG/M
3300027825|Ga0209039_10413533All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Roseiarcaceae → Roseiarcus → Roseiarcus fermentans514Open in IMG/M
3300027826|Ga0209060_10017463All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales3854Open in IMG/M
3300027829|Ga0209773_10267104All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Roseiarcaceae → Roseiarcus → Roseiarcus fermentans714Open in IMG/M
3300027879|Ga0209169_10137777All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Roseiarcaceae → Roseiarcus → Roseiarcus fermentans1269Open in IMG/M
3300027908|Ga0209006_10149353All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2052Open in IMG/M
3300027908|Ga0209006_10843577All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Roseiarcaceae → Roseiarcus → Roseiarcus fermentans739Open in IMG/M
3300027908|Ga0209006_11272521All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Roseiarcaceae → Roseiarcus → Roseiarcus fermentans570Open in IMG/M
3300028906|Ga0308309_10779401All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Roseiarcaceae → Roseiarcus → Roseiarcus fermentans831Open in IMG/M
3300030503|Ga0311370_10849628Not Available1043Open in IMG/M
3300030509|Ga0302183_10066885All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Roseiarcaceae → Roseiarcus → Roseiarcus fermentans1421Open in IMG/M
3300031231|Ga0170824_119958117All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Roseiarcaceae → Roseiarcus → Roseiarcus fermentans753Open in IMG/M
3300031234|Ga0302325_11855809All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Roseiarcaceae → Roseiarcus → Roseiarcus fermentans752Open in IMG/M
3300031708|Ga0310686_105407163All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Roseiarcaceae → Roseiarcus → Roseiarcus fermentans1367Open in IMG/M
3300031708|Ga0310686_114117238All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Roseiarcaceae → Roseiarcus → Roseiarcus fermentans751Open in IMG/M
3300031715|Ga0307476_10313056All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Roseiarcaceae → Roseiarcus → Roseiarcus fermentans1153Open in IMG/M
3300031718|Ga0307474_11155114All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Roseiarcaceae → Roseiarcus → Roseiarcus fermentans613Open in IMG/M
3300031719|Ga0306917_11394870All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Roseiarcaceae → Roseiarcus → Roseiarcus fermentans541Open in IMG/M
3300031768|Ga0318509_10725077All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Roseiarcaceae → Roseiarcus → Roseiarcus fermentans551Open in IMG/M
3300031910|Ga0306923_11672581All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Roseiarcaceae → Roseiarcus → Roseiarcus fermentans659Open in IMG/M
3300031938|Ga0308175_102668272Not Available559Open in IMG/M
3300031939|Ga0308174_10576147All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Roseiarcaceae → Roseiarcus → Roseiarcus fermentans929Open in IMG/M
3300032001|Ga0306922_11204876All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Roseiarcaceae → Roseiarcus → Roseiarcus fermentans771Open in IMG/M
3300032008|Ga0318562_10110503All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Roseiarcaceae → Roseiarcus → Roseiarcus fermentans1566Open in IMG/M
3300032009|Ga0318563_10223645All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Roseiarcaceae → Roseiarcus → Roseiarcus fermentans1016Open in IMG/M
3300032066|Ga0318514_10679326All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Roseiarcaceae → Roseiarcus → Roseiarcus fermentans548Open in IMG/M
3300032067|Ga0318524_10421639All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Roseiarcaceae → Roseiarcus → Roseiarcus fermentans697Open in IMG/M
3300032770|Ga0335085_11727123All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Roseiarcaceae → Roseiarcus → Roseiarcus fermentans644Open in IMG/M
3300032829|Ga0335070_11006671All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Roseiarcaceae → Roseiarcus → Roseiarcus fermentans769Open in IMG/M
3300032892|Ga0335081_11108753All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales911Open in IMG/M
3300032893|Ga0335069_10100048All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Roseiarcaceae → Roseiarcus → Roseiarcus fermentans3666Open in IMG/M
3300032896|Ga0335075_10178887All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Roseiarcaceae → Roseiarcus → Roseiarcus fermentans2582Open in IMG/M
3300032898|Ga0335072_10227728All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales2172Open in IMG/M
3300032898|Ga0335072_10903901All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Roseiarcaceae → Roseiarcus → Roseiarcus fermentans826Open in IMG/M
3300032955|Ga0335076_10179074All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Roseiarcaceae → Roseiarcus → Roseiarcus fermentans2027Open in IMG/M
3300033134|Ga0335073_10004101All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Roseiarcaceae → Roseiarcus → Roseiarcus fermentans20387Open in IMG/M
3300033134|Ga0335073_10929635All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales911Open in IMG/M
3300033134|Ga0335073_12147026Not Available504Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil15.93%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil10.62%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil9.73%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil7.96%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil6.19%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil5.31%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog4.42%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere4.42%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment3.54%
Termite GutHost-Associated → Arthropoda → Digestive System → Gut → Unclassified → Termite Gut3.54%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil2.65%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa2.65%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland1.77%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland1.77%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.77%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil1.77%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil1.77%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil1.77%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil0.89%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil0.89%
Glacier Forefield SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil0.89%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.89%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.89%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil0.89%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland0.89%
PermafrostEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost0.89%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.89%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere0.89%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.89%
Plant RootsHost-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots0.89%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.89%
Attine Ant Fungus GardensHost-Associated → Fungi → Mycelium → Unclassified → Unclassified → Attine Ant Fungus Gardens0.89%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300001471Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2EnvironmentalOpen in IMG/M
3300001546Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1EnvironmentalOpen in IMG/M
3300002245Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027)EnvironmentalOpen in IMG/M
3300004091Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3EnvironmentalOpen in IMG/M
3300004092Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3EnvironmentalOpen in IMG/M
3300004479Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAsEnvironmentalOpen in IMG/M
3300004635Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3EnvironmentalOpen in IMG/M
3300005434Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaGEnvironmentalOpen in IMG/M
3300005533Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1EnvironmentalOpen in IMG/M
3300005534Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1EnvironmentalOpen in IMG/M
3300005602Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2EnvironmentalOpen in IMG/M
3300005614Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2Host-AssociatedOpen in IMG/M
3300005712Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4EnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300006176Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5EnvironmentalOpen in IMG/M
3300009093Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaGHost-AssociatedOpen in IMG/M
3300009545Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaGHost-AssociatedOpen in IMG/M
3300009624Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_10EnvironmentalOpen in IMG/M
3300009633Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_10EnvironmentalOpen in IMG/M
3300009784Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4Host-AssociatedOpen in IMG/M
3300009824Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaGEnvironmentalOpen in IMG/M
3300009826Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1Host-AssociatedOpen in IMG/M
3300010375Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaGHost-AssociatedOpen in IMG/M
3300011418Attine ant fungus gardens microbial communities from Florida, USA - TSFL038 MetaGHost-AssociatedOpen in IMG/M
3300012924Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300014169Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaGEnvironmentalOpen in IMG/M
3300014199Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_30_metaGEnvironmentalOpen in IMG/M
3300014200Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaGEnvironmentalOpen in IMG/M
3300014501Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300014655Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_10_metaGEnvironmentalOpen in IMG/M
3300015206Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G8B, Adjacent to main proglacial river, end of transect (Watson river))EnvironmentalOpen in IMG/M
3300016270Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080EnvironmentalOpen in IMG/M
3300016371Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172EnvironmentalOpen in IMG/M
3300016422Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111EnvironmentalOpen in IMG/M
3300016445Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108EnvironmentalOpen in IMG/M
3300017924Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_5EnvironmentalOpen in IMG/M
3300017936Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_1EnvironmentalOpen in IMG/M
3300017970Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300017993Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_3EnvironmentalOpen in IMG/M
3300018007Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5EnvironmentalOpen in IMG/M
3300018037Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_10EnvironmentalOpen in IMG/M
3300018044Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_10EnvironmentalOpen in IMG/M
3300020070Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300020582Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-OEnvironmentalOpen in IMG/M
3300021171Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-MEnvironmentalOpen in IMG/M
3300021180Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-OEnvironmentalOpen in IMG/M
3300021361Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2Host-AssociatedOpen in IMG/M
3300021384Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9Host-AssociatedOpen in IMG/M
3300021401Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-OEnvironmentalOpen in IMG/M
3300021402Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-OEnvironmentalOpen in IMG/M
3300021404Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-OEnvironmentalOpen in IMG/M
3300021474Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-OEnvironmentalOpen in IMG/M
3300021477Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-OEnvironmentalOpen in IMG/M
3300021479Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-MEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300023056Soil microbial communities from Shasta-Trinity National Forest, California, United States - GEON-SFM-MS2EnvironmentalOpen in IMG/M
3300025913Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025914Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300027096Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF043 (SPAdes)EnvironmentalOpen in IMG/M
3300027117Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_O1 (SPAdes)EnvironmentalOpen in IMG/M
3300027496Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_O2 (SPAdes)EnvironmentalOpen in IMG/M
3300027505Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_O3 (SPAdes)EnvironmentalOpen in IMG/M
3300027619Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O3 (SPAdes)EnvironmentalOpen in IMG/M
3300027696Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027729Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM1 (SPAdes)EnvironmentalOpen in IMG/M
3300027767Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM2 (SPAdes)EnvironmentalOpen in IMG/M
3300027812Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 (SPAdes)EnvironmentalOpen in IMG/M
3300027825Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM1 (SPAdes)EnvironmentalOpen in IMG/M
3300027826Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027829Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM1 (SPAdes)EnvironmentalOpen in IMG/M
3300027879Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 (SPAdes)EnvironmentalOpen in IMG/M
3300027908Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes)EnvironmentalOpen in IMG/M
3300028906Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2)EnvironmentalOpen in IMG/M
3300030503III_Palsa_E3 coassemblyEnvironmentalOpen in IMG/M
3300030509Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_2EnvironmentalOpen in IMG/M
3300031231Coassembly Site 11 (all samples) - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031234Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2EnvironmentalOpen in IMG/M
3300031708FICUS49499 Metagenome Czech Republic combined assemblyEnvironmentalOpen in IMG/M
3300031715Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05EnvironmentalOpen in IMG/M
3300031718Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05EnvironmentalOpen in IMG/M
3300031719Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2)EnvironmentalOpen in IMG/M
3300031768Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22EnvironmentalOpen in IMG/M
3300031833Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178EnvironmentalOpen in IMG/M
3300031910Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2)EnvironmentalOpen in IMG/M
3300031938Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1EnvironmentalOpen in IMG/M
3300031939Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R2EnvironmentalOpen in IMG/M
3300032001Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2)EnvironmentalOpen in IMG/M
3300032008Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18EnvironmentalOpen in IMG/M
3300032009Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19EnvironmentalOpen in IMG/M
3300032066Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18EnvironmentalOpen in IMG/M
3300032067Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22EnvironmentalOpen in IMG/M
3300032770Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5EnvironmentalOpen in IMG/M
3300032829Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3EnvironmentalOpen in IMG/M
3300032892Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5EnvironmentalOpen in IMG/M
3300032893Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1EnvironmentalOpen in IMG/M
3300032896Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.4EnvironmentalOpen in IMG/M
3300032898Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1EnvironmentalOpen in IMG/M
3300032955Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5EnvironmentalOpen in IMG/M
3300033134Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI12712J15308_1020883723300001471Forest SoilLVSWEIRSEMLEFGLRFLKGPWATAALVCLAAFVVLFALAGQTVSALFVYTAPK*
JGI12659J15293_1000079743300001546Forest SoilMLEFGLRFLKGPWATAALVCLAAFVVLFALAGQTVSALFVYTAPK*
JGIcombinedJ26739_10004183733300002245Forest SoilMLEFGLRFLXGPWATAALVCLAAFVVLFALAGQTVSALFVYTAPK*
JGIcombinedJ26739_10004758723300002245Forest SoilMIEFGLRFLKGPWATAALVCLAAFVVXFALAGQTVNAPFVYTAPK*
Ga0062387_10014000333300004091Bog Forest SoilMVEFGLRFLKGPWATAALICLAAFVVLFALAGQTVNAPFVYTAPK*
Ga0062389_10474670923300004092Bog Forest SoilMVEFGLRFLRGPWATAALVCLAAFVVLFALAGQTVNALFVYTAPK*
Ga0062595_10119132223300004479SoilMGEFGLRFLKGPWATAALICLLAFVILFALAGQTINAPFVYTAPK*
Ga0062388_10031030623300004635Bog Forest SoilMQFNACSPVSREIRFGMVEFGLRLLRGPWATAALICLAAFVVLFALAGQTLNAPFVYTAPR*
Ga0070709_1162204913300005434Corn, Switchgrass And Miscanthus RhizosphereMMEFGLRFLKGPWATAALVCLAAFVVLFALAGQTINAPFVYTAPK*
Ga0070734_1001610733300005533Surface SoilMVEFGLRLLKGPWATAALVCLAAFVVLFALAGQTLNAPFVYTAPR*
Ga0070735_1015828823300005534Surface SoilMVESALRFLKGPWATAALVCLAAFVVLFALAGQTVNAPFVYTAPK*
Ga0070762_1019702723300005602SoilMIEFGLRFLKGPWATAALVCLAAFVVLFALAGQTVNAPFVYTAPK*
Ga0068856_10175841313300005614Corn RhizosphereSAGALWRMGEFGLRFLKGPWATAALVCLLAFVILFALAGQTIIAPFVYTAPK*
Ga0070764_1043407123300005712SoilMLEFGLRFLKGPWATAALICLAAFVVLFALAGQTVNALFVYTAPK*
Ga0070764_1111728913300005712SoilSWEIRSEMLEFGLRFLKGPWATAALVCLAAFVVLFALAGQTVSALFVYAAPK*
Ga0066903_10439220623300005764Tropical Forest SoilMVEIGLRLLKGPWAAAALVCLAAFIVLFALAGQTLNAPFVYTAPR*
Ga0070765_10210547223300006176SoilMLEFGLRFLKGPWATAALICLAAFVVLLALAGQTVNALFVYTAPK*
Ga0105240_1001576433300009093Corn RhizosphereMIDFALRFLKGPWATAALLCLAAFIVLFALAGQTVNAPFVYTPPQ*
Ga0105237_1211428113300009545Corn RhizosphereMVEFALRFLKGPWATAALVCLAALVVLFALAGQTVNAPFVYTAPK*
Ga0116105_119068523300009624PeatlandGLRLLKGPWATAALICLAALIVLFALAGQTLNAPFVYTAPR*
Ga0116129_115664023300009633PeatlandMVEFGLRLLKGPWATGALVCLAALVVLFALAGQTVNALFVYAASK*
Ga0123357_1066784313300009784Termite GutMIEFGLRFLKGPWATAALVCLAAFVVLFALAGQTINAPFVYTAPK*
Ga0116219_1005938423300009824Peatlands SoilMVEFGLPLLKGPWATAALVCLAAFVLLFALAGQTVNAPFVYTAPR*
Ga0123355_1086728423300009826Termite GutMIEFGLRFLKGPWATAALVCLAAFVVLFALAGQTINAPFVYIAPK*
Ga0123355_1123777523300009826Termite GutEFGLRFLKGPWAAAALVCLAAFVVLFALAGQPLNAPFVYIAPK*
Ga0123355_1222357013300009826Termite GutMIELGLWLLKGPWATAALVCLAAVVVLFALAGQTINAPFVYTAPK*
Ga0105239_1103092023300010375Corn RhizosphereMGEFGLRFLKGPWATAALVCLLAFVILFALAGQTIIAPFVYTAPK*
Ga0153954_1000237393300011418Attine Ant Fungus GardensMLGFGLRLLGGPWATAALICLAALVLLFALAGQTVNAPFVYTAPK*
Ga0137413_1069126023300012924Vadose Zone SoilMLEFGLRFLKGPWATAALICLAAFVVLFALAGQTTNALFVYSAPK*
Ga0181531_1064484413300014169BogMVEFGLRFLRGPWATAALVCVAAFVVLFALAGQTVNA
Ga0181535_1013755243300014199BogMIEFGLRLLKGPWATAALICLAAIVVLFALAGQTLNAPFVYTAPR*
Ga0181526_1050526533300014200BogMQAPDAGESCGSARLHLAEFVRRQAAGPWAAPALVCLLVIVILFAIAGQTVNAPFVYTP
Ga0181526_1053076123300014200BogMIEFGLRLLKGPWATAALICLAAFVVLFALAGQTLNAPFVYTAPR*
Ga0182024_1028988823300014501PermafrostMVELGLRFLKGPWATAALICLAAFVILFALAGQTTNALFVYSAPK*
Ga0181516_1055743023300014655BogMVEIGLRILKGPWATAALICLAALVVLFALAGQTLNAPFVYTAPR*
Ga0167644_108473323300015206Glacier Forefield SoilMLEFGLRFLKGPWATAALICLAAFVVLFALAGQTTNALFVYSASK*
Ga0182036_1054122123300016270SoilMVEFGLRFLKGPWATAALVCLAAFVVLFALAGQTVNAPFVYTAPR
Ga0182034_1059626423300016371SoilMVEFGLRLLKGPWATAAVICLAAFVVLFALAGQTVNAPFVYTPSR
Ga0182039_1096984223300016422SoilMVEFGLRFLKGPWATAALVCLAAFVLLFALAGQTVNAPFVYAPPR
Ga0182038_1086588813300016445SoilMVEFGLQFLKGPWATAAVICLAAFVVLFALAGQTVNAPFVYTPSR
Ga0187820_107308323300017924Freshwater SedimentMVESALRFLKGPWATAALVCLAAFVVLFALAGQTINAPFVYTAPK
Ga0187821_1029796923300017936Freshwater SedimentVESALRFLKGPWATAALVCLAAFVVLFALAGQTVNAPFVYTAPK
Ga0187783_1086448723300017970Tropical PeatlandMVEFGARLWRGPWATAALVCLAAFVVLFVLAGQTVNAPFVYTAPR
Ga0187823_1004561223300017993Freshwater SedimentMVESALRFLKGPWATAALVCLAAFVVLFALAGQTVNAPFVYTAPK
Ga0187805_1058586213300018007Freshwater SedimentMVEFGLPLLKGPWATAALVCLAAFVVLFALAGQTVNAPFVYTAPR
Ga0187883_1023043923300018037PeatlandMVEIGLRLLKGPWATAALICLAALVVLFALAGQTLNAPFVYTAPR
Ga0187890_1056271813300018044PeatlandMFEIGLRLLKGPWATAALICLAALVVLFALAGQTLNAPFVYTAPR
Ga0206356_1002402623300020070Corn, Switchgrass And Miscanthus RhizosphereMVEFALRFLKGPWATAALVCLAALVVLFALAGQTVNAPFVYTAPK
Ga0210395_1003022123300020582SoilMVEFGLRFLKGPWATAALICLAAFVVLFALAGQTVNAPFVYTAPK
Ga0210395_1093755023300020582SoilMLEFGLRFLKGPWATAALVCLAAFVVLFALAGQTVSALFVYTAPK
Ga0210395_1142806013300020582SoilMIEFGLGLLKGPWATAALICLAALVVLFALAGQTVNAPFVYTAPQ
Ga0210405_1073040723300021171SoilMIEFGLRFLKGPWATAALVCLAAFVVLFALAGQTVNAPFVYTAPK
Ga0210396_1140694513300021180SoilLKGPWATAALVCLAAFVVLFALAGQTVNAPFVYTAPK
Ga0213872_1016984723300021361RhizosphereMLDVCAQMLQGPWARPALICLAALVLLFALAGEHVNAPFVYTAPQ
Ga0213876_1002161223300021384Plant RootsMIEFGLRLLKGPWATAALVCLAAFVILFALAGQTINAPFVYTAPK
Ga0210393_1023880423300021401SoilMLEFGLRFLKGPWATAALVCLAAFVVLFALAGQTVNALFVYTGPK
Ga0210385_1065011113300021402SoilMVEFGLRFLKGPWATAALICLAAFVVLFALAGQTVNALFVYTAPK
Ga0210389_1017276223300021404SoilMVEFGLRLLKGPWATAALICLAAFVVLFALAGQTVNAPFVYTAPK
Ga0210390_1007774623300021474SoilMVEFGLRLLKGPWATGALVCLAALVVLFALAGQTVNALFVYAASK
Ga0210398_1036280223300021477SoilMVEFGLRFLKGPWATAALICLATFVVLFALAGQTVNAPFVYTAPK
Ga0210410_1128733323300021479SoilALRGNSTGMVEFGLRFLKGPWATAALICLAAFVVLFALAGQTVNAPFVYTAPK
Ga0126371_1384608823300021560Tropical Forest SoilMVEFGLRLLKGPWATAALVCLAAFVVLLALAGQTVNAPFVYTAPK
Ga0233357_103328113300023056SoilMVEFGLRFLKGPWATAALICLAAFVVLFALAGQTTNALFVYSAPK
Ga0207695_1003077123300025913Corn RhizosphereMIDFALRFLKGPWATAALLCLAAFIVLFALAGQTVNAPFVYTPPQ
Ga0207671_1033160123300025914Corn RhizosphereMGEFGLRFLKGPWATAALICLLAFVILFALAGQTIIAPFVYTAPK
Ga0208099_106730823300027096Forest SoilMVEFGLRLLKGPWATGALVCLAALVVLFALAGQTVNAPFVYTAPK
Ga0209732_101417023300027117Forest SoilMLEFGLRVLKGPWATAALVCLAAFVVLFALAGQTVSALFVYTAPK
Ga0208987_102384323300027496Forest SoilMVELGLRFLKGPWATAALICLAAFVVLFALAGQTTNALFVYSAPK
Ga0209218_103583013300027505Forest SoilMVEFGLRFLKGPWATAALVCLAAFVVLFALAGQTVNAPFVYTAPK
Ga0209330_107495313300027619Forest SoilRGNSTGMIEFGLRFLKGPWATAALVCLAAFVVLFALAGQTVNAPFVYTAPK
Ga0208696_104629223300027696Peatlands SoilMVEFGLPLLKGPWATAALVCLAAFVLLFALAGQTVNAPFVYTAPR
Ga0209248_1000523713300027729Bog Forest SoilMVEFGLRLLKGPWATAALICLAAFVVLFALAGQTLNAPFVYTAPR
Ga0209248_1004143023300027729Bog Forest SoilMVEIGLRLLKGPWATAALICLAALVVLFALAGQTLNA
Ga0209655_1011013823300027767Bog Forest SoilMVEIGLRLLKGPWATAALICLAAFVVLFALAGQTLNAPFVYTSPR
Ga0209656_1037924013300027812Bog Forest SoilRGSEGPARLHMVEFVMRQAAGPWAAPALICLLAIVLLFALAGQTVNAPFVYTPPA
Ga0209039_1041353313300027825Bog Forest SoilMVEIGLRLLKGPWATAALICLAAVVVLFALAGQTLNAPFVYTAPR
Ga0209060_1001746323300027826Surface SoilMVEFGLRLLKGPWATAALVCLAAFVVLFALAGQTLNAPFVYTAPR
Ga0209773_1026710413300027829Bog Forest SoilMVEFGLRLLKGPWATAALICLAAFVVLFALAGQTLNAPFVYTSPR
Ga0209169_1013777713300027879SoilSSGRLNDPANARSLVSWEIRSEMLEFGLRFLKGPWATAALVCLAAFVVLFALAGQTVSALFVYAAPK
Ga0209006_1014935333300027908Forest SoilMLEFGLRFLKGPWATAALVCLAAFVVLFALAGQTVNALFVYTAPK
Ga0209006_1084357723300027908Forest SoilMVAFGLRFLRGPWATAALVCLAAFVVLFALAGQTVNALFVYTGPK
Ga0209006_1127252113300027908Forest SoilMVEFGLQFLKGPWATAALICLAAFVVLFALAGQTVNALFVYTAPQ
Ga0308309_1077940113300028906SoilMLEFGLRFLKGPWATAALICLAAFVVLLALAGQTVNALFVYTAPK
Ga0311370_1084962823300030503PalsaMLEFGLRFLKGPWATAALICLAAFVVLFALAGQTVNALFVYTAPK
Ga0302183_1006688523300030509PalsaPIGMVEIGLRVLKGPWATAALICLAALVVLFALAGQTLNAPFVYTAPR
Ga0170824_11995811723300031231Forest SoilLVLGALTGMVEFGLRFLKGPWATAVLICLAALVVLFALAGQTVNALFVYTAPK
Ga0302325_1185580923300031234PalsaMVEFALRFLKGPWATAALICLAAFVILFALAGQTVNALFVYAGPK
Ga0310686_10540716323300031708SoilMVELGVRFLKGPWATAALICVAAFIVLFALAGQTTNALFVYAAPK
Ga0310686_11411723813300031708SoilMVEFGLRFLKGPWATAALICVAAFVVLFALAGQTTNALFVYAAPK
Ga0307476_1031305613300031715Hardwood Forest SoilMVEFGLRFLKGPWATASLVCLAAFVVLFALAGQTVNASFVYTAPK
Ga0307474_1115511413300031718Hardwood Forest SoilRLLKGPWATAALVCLAALVVLFALAGQTVNAPFVYTAPK
Ga0306917_1139487013300031719SoilMVEFGLRLLKGPWATAALVCLAAFVLLFALAGQTVNAPFVYTPPR
Ga0318509_1072507713300031768SoilFLGDAIGMVEFGLRFLKGPWATAALICLAAFVVLFALAGQTVNAPFVYTAPK
Ga0310917_1101741213300031833SoilMAFFLRQLSRPWATPALICLAAFVVLFALAGQTFNAPFVYYSPR
Ga0306923_1167258113300031910SoilMVEFGLRFLKGPWATAALVCLAAFVVLFALAGQTVNAPFVYTPPR
Ga0308175_10266827223300031938SoilMMEFGLRFLKGPWAAAALVCLAAFVILFALAGQTINAPFVYTAPK
Ga0308174_1057614723300031939SoilMMEFGLRFLRGPWAAAALVCLAAFVVLFALAGQTINAPFVYTAPR
Ga0306922_1120487613300032001SoilMVEFGLRLLKGPWATAALVCLAAFVLLFALAGQTVNAPFVYTPSR
Ga0318562_1011050323300032008SoilMTELGLRLLKGPWAAAALICLAAFVVLFALAGQTLNAPFVYTAPR
Ga0318563_1022364523300032009SoilMVEFALRLLKGPWAMAALICLAAFVVLFALAGQTLNAPFVYTAPR
Ga0318514_1067932623300032066SoilGMVEFGLRLLKGPWATAALACLAAFVVLFALAGQTVNAPFVYAPPR
Ga0318524_1042163913300032067SoilFGLRLLKGPWATAALVCLAAFVVLFALAGQTVNAPFVYTPPR
Ga0335085_1172712313300032770SoilESALRFLKGPWATAALVCLAAFVILFALAGQTVNAPFVYTAPQ
Ga0335070_1100667113300032829SoilGGDRIGMVEFGLRLLKGPWATAALLCLAALVVLFALAGQTVNAPFVYTAPR
Ga0335081_1110875313300032892SoilMVEFVLRLMKGPWATAALICLAALVVLFALAGQTVNAPFVYTAPT
Ga0335069_1010004833300032893SoilMLEFGLRLLKGPWATAALLCLAALVVLFALAGQTVNAPFVYTAPR
Ga0335075_1017888723300032896SoilMVEFGLRFLKGPWATAALVCLAALVVLFALAGQTVNAPFVYTAPK
Ga0335072_1022772823300032898SoilMVEFGLRFLKGPWATAALVCLAAFVVLFALAGQTINAPFVYTAPK
Ga0335072_1090390113300032898SoilMVESALRFLKGPWATAALVCLAAFVILFALAGQTVNAPFVYTAPQ
Ga0335076_1017907423300032955SoilDLIEMVEFALRLLKGPWATAALICLAAFVVLFALAGQTLNAPFVYTAPR
Ga0335073_1000410123300033134SoilMVEFALRLLKGPWATAALICLAAFVVLFALAGQTLNAPFVYTAPR
Ga0335073_1092963513300033134SoilMVEFGLRFLKGPWATAALVCLAALVVLFALAGQTVNAPFVYTAP
Ga0335073_1214702613300033134SoilMIEFGLGLLKGPWATAALICLAAFVVLFALAGQTIN


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.