Basic Information | |
---|---|
Family ID | F083042 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 113 |
Average Sequence Length | 46 residues |
Representative Sequence | RLRESEADLERELTVGDADRADLTLRLLKSLQPAPITDRPHSWDY |
Number of Associated Samples | 104 |
Number of Associated Scaffolds | 113 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 0.00 % |
% of genes near scaffold ends (potentially truncated) | 100.00 % |
% of genes from short scaffolds (< 2000 bps) | 92.92 % |
Associated GOLD sequencing projects | 94 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.46 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (99.115 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (27.434 % of family members) |
Environment Ontology (ENVO) | Unclassified (24.779 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (53.097 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 4.11% β-sheet: 19.18% Coil/Unstructured: 76.71% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.46 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 113 Family Scaffolds |
---|---|---|
PF02775 | TPP_enzyme_C | 5.31 |
PF01855 | POR_N | 0.88 |
PF06155 | GBBH-like_N | 0.88 |
COG ID | Name | Functional Category | % Frequency in 113 Family Scaffolds |
---|---|---|---|
COG0674 | Pyruvate:ferredoxin oxidoreductase or related 2-oxoacid:ferredoxin oxidoreductase, alpha subunit | Energy production and conversion [C] | 0.88 |
COG3536 | Uncharacterized conserved protein, DUF971 family | Function unknown [S] | 0.88 |
COG4231 | TPP-dependent indolepyruvate ferredoxin oxidoreductase, alpha subunit | Energy production and conversion [C] | 0.88 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 99.12 % |
Unclassified | root | N/A | 0.88 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000732|JGI12023J11887_1010978 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 540 | Open in IMG/M |
3300001867|JGI12627J18819_10278949 | All Organisms → cellular organisms → Bacteria | 672 | Open in IMG/M |
3300005165|Ga0066869_10057596 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 699 | Open in IMG/M |
3300005167|Ga0066672_10813676 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 587 | Open in IMG/M |
3300005336|Ga0070680_101395925 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 606 | Open in IMG/M |
3300005355|Ga0070671_100228717 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1578 | Open in IMG/M |
3300005436|Ga0070713_102103460 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 547 | Open in IMG/M |
3300005454|Ga0066687_10142690 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1258 | Open in IMG/M |
3300005533|Ga0070734_10446137 | All Organisms → cellular organisms → Bacteria | 738 | Open in IMG/M |
3300005539|Ga0068853_100807834 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 898 | Open in IMG/M |
3300005546|Ga0070696_101100408 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 668 | Open in IMG/M |
3300005556|Ga0066707_10764927 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 600 | Open in IMG/M |
3300006032|Ga0066696_10798381 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 602 | Open in IMG/M |
3300006175|Ga0070712_100961181 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 738 | Open in IMG/M |
3300006176|Ga0070765_101877395 | All Organisms → cellular organisms → Bacteria | 561 | Open in IMG/M |
3300007788|Ga0099795_10044972 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1586 | Open in IMG/M |
3300010043|Ga0126380_10642643 | All Organisms → cellular organisms → Bacteria | 843 | Open in IMG/M |
3300010043|Ga0126380_10978679 | All Organisms → cellular organisms → Bacteria | 710 | Open in IMG/M |
3300010048|Ga0126373_10115731 | All Organisms → cellular organisms → Bacteria | 2501 | Open in IMG/M |
3300010326|Ga0134065_10073619 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1093 | Open in IMG/M |
3300010358|Ga0126370_11598042 | All Organisms → cellular organisms → Bacteria | 624 | Open in IMG/M |
3300010359|Ga0126376_12107401 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 607 | Open in IMG/M |
3300010361|Ga0126378_13447423 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 502 | Open in IMG/M |
3300010362|Ga0126377_11810532 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 686 | Open in IMG/M |
3300010396|Ga0134126_11993935 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 635 | Open in IMG/M |
3300012683|Ga0137398_11149596 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 532 | Open in IMG/M |
3300012918|Ga0137396_11267920 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 514 | Open in IMG/M |
3300012927|Ga0137416_11428890 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 627 | Open in IMG/M |
3300012975|Ga0134110_10106513 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1136 | Open in IMG/M |
3300012986|Ga0164304_10903839 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 691 | Open in IMG/M |
3300015374|Ga0132255_101119467 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1184 | Open in IMG/M |
3300016341|Ga0182035_11589042 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 589 | Open in IMG/M |
3300016371|Ga0182034_10684759 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 871 | Open in IMG/M |
3300016445|Ga0182038_10170122 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1685 | Open in IMG/M |
3300017961|Ga0187778_10572026 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 755 | Open in IMG/M |
3300017961|Ga0187778_10610395 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 732 | Open in IMG/M |
3300017970|Ga0187783_10385295 | All Organisms → cellular organisms → Bacteria | 1019 | Open in IMG/M |
3300017970|Ga0187783_10618392 | All Organisms → cellular organisms → Bacteria | 783 | Open in IMG/M |
3300017970|Ga0187783_11024120 | Not Available | 595 | Open in IMG/M |
3300017974|Ga0187777_10957151 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 618 | Open in IMG/M |
3300018060|Ga0187765_10206944 | All Organisms → cellular organisms → Bacteria | 1136 | Open in IMG/M |
3300018090|Ga0187770_10815426 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 747 | Open in IMG/M |
3300018468|Ga0066662_11704115 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 659 | Open in IMG/M |
3300020199|Ga0179592_10051376 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1874 | Open in IMG/M |
3300020581|Ga0210399_10189739 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1708 | Open in IMG/M |
3300020581|Ga0210399_10720511 | All Organisms → cellular organisms → Bacteria | 819 | Open in IMG/M |
3300020582|Ga0210395_10269884 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1279 | Open in IMG/M |
3300021178|Ga0210408_11129177 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 602 | Open in IMG/M |
3300021402|Ga0210385_10729488 | All Organisms → cellular organisms → Bacteria | 759 | Open in IMG/M |
3300021403|Ga0210397_11283118 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 569 | Open in IMG/M |
3300021433|Ga0210391_10161797 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1762 | Open in IMG/M |
3300021475|Ga0210392_10039358 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 2842 | Open in IMG/M |
3300021478|Ga0210402_10553869 | All Organisms → cellular organisms → Bacteria | 1067 | Open in IMG/M |
3300021559|Ga0210409_10284452 | All Organisms → cellular organisms → Bacteria | 1493 | Open in IMG/M |
3300021560|Ga0126371_10286870 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1769 | Open in IMG/M |
3300021953|Ga0213880_10153477 | All Organisms → cellular organisms → Bacteria | 630 | Open in IMG/M |
3300024227|Ga0228598_1092959 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 607 | Open in IMG/M |
3300025903|Ga0207680_10515663 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 852 | Open in IMG/M |
3300025916|Ga0207663_10385363 | All Organisms → cellular organisms → Bacteria | 1069 | Open in IMG/M |
3300025917|Ga0207660_10868983 | All Organisms → cellular organisms → Bacteria | 736 | Open in IMG/M |
3300025927|Ga0207687_10496815 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1018 | Open in IMG/M |
3300025931|Ga0207644_10729314 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 827 | Open in IMG/M |
3300025932|Ga0207690_11501679 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 563 | Open in IMG/M |
3300025937|Ga0207669_11882087 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 511 | Open in IMG/M |
3300026041|Ga0207639_10756567 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 904 | Open in IMG/M |
3300026308|Ga0209265_1081477 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 918 | Open in IMG/M |
3300026316|Ga0209155_1054311 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1548 | Open in IMG/M |
3300026317|Ga0209154_1267093 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 578 | Open in IMG/M |
3300026528|Ga0209378_1283300 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 528 | Open in IMG/M |
3300027505|Ga0209218_1064812 | All Organisms → cellular organisms → Bacteria | 747 | Open in IMG/M |
3300027512|Ga0209179_1141604 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 537 | Open in IMG/M |
3300027535|Ga0209734_1026840 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1067 | Open in IMG/M |
3300027821|Ga0209811_10161292 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 836 | Open in IMG/M |
3300027826|Ga0209060_10332134 | All Organisms → cellular organisms → Bacteria | 693 | Open in IMG/M |
3300028906|Ga0308309_11504153 | All Organisms → cellular organisms → Bacteria | 575 | Open in IMG/M |
3300029636|Ga0222749_10329680 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 795 | Open in IMG/M |
3300030520|Ga0311372_10287182 | All Organisms → cellular organisms → Bacteria | 2616 | Open in IMG/M |
3300031544|Ga0318534_10685224 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 580 | Open in IMG/M |
3300031546|Ga0318538_10696446 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 551 | Open in IMG/M |
3300031572|Ga0318515_10473894 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 669 | Open in IMG/M |
3300031640|Ga0318555_10010153 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 4109 | Open in IMG/M |
3300031681|Ga0318572_10875705 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 533 | Open in IMG/M |
3300031682|Ga0318560_10001361 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans | 8457 | Open in IMG/M |
3300031708|Ga0310686_102051671 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 587 | Open in IMG/M |
3300031719|Ga0306917_10616643 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 853 | Open in IMG/M |
3300031720|Ga0307469_10597476 | All Organisms → cellular organisms → Bacteria | 986 | Open in IMG/M |
3300031740|Ga0307468_102096891 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 544 | Open in IMG/M |
3300031744|Ga0306918_10628926 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 841 | Open in IMG/M |
3300031744|Ga0306918_11321739 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 554 | Open in IMG/M |
3300031754|Ga0307475_10123430 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 2041 | Open in IMG/M |
3300031754|Ga0307475_10926007 | All Organisms → cellular organisms → Bacteria | 687 | Open in IMG/M |
3300031769|Ga0318526_10182200 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 857 | Open in IMG/M |
3300031792|Ga0318529_10545989 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 538 | Open in IMG/M |
3300031793|Ga0318548_10415344 | All Organisms → cellular organisms → Bacteria | 659 | Open in IMG/M |
3300031794|Ga0318503_10041885 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1376 | Open in IMG/M |
3300031794|Ga0318503_10218380 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 618 | Open in IMG/M |
3300031795|Ga0318557_10090344 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1345 | Open in IMG/M |
3300031795|Ga0318557_10373806 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 655 | Open in IMG/M |
3300031799|Ga0318565_10563404 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 548 | Open in IMG/M |
3300031823|Ga0307478_10795394 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 792 | Open in IMG/M |
3300031831|Ga0318564_10382756 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 616 | Open in IMG/M |
3300031846|Ga0318512_10212010 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 949 | Open in IMG/M |
3300031859|Ga0318527_10105658 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1159 | Open in IMG/M |
3300031879|Ga0306919_11267518 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 559 | Open in IMG/M |
3300031910|Ga0306923_12430574 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
3300031962|Ga0307479_11909834 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 544 | Open in IMG/M |
3300032042|Ga0318545_10296683 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 581 | Open in IMG/M |
3300032063|Ga0318504_10026978 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 2242 | Open in IMG/M |
3300032094|Ga0318540_10495009 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 590 | Open in IMG/M |
3300032180|Ga0307471_100879387 | All Organisms → cellular organisms → Bacteria | 1063 | Open in IMG/M |
3300032782|Ga0335082_10032116 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 5564 | Open in IMG/M |
3300032783|Ga0335079_11462898 | All Organisms → cellular organisms → Bacteria | 676 | Open in IMG/M |
3300032955|Ga0335076_10543848 | All Organisms → cellular organisms → Bacteria | 1044 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 27.43% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 7.08% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 7.08% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 7.08% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 6.19% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 6.19% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 5.31% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 3.54% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.54% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 2.65% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.65% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 2.65% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.77% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.77% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.77% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.77% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.77% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.89% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.89% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.89% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.89% |
Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 0.89% |
Exposed Rock | Environmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Exposed Rock | 0.89% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.89% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.89% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.89% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.89% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.89% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000732 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M2 | Environmental | Open in IMG/M |
3300001867 | Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705) | Environmental | Open in IMG/M |
3300005165 | Soil and rhizosphere microbial communities from Laval, Canada - mgHMC | Environmental | Open in IMG/M |
3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Environmental | Open in IMG/M |
3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Host-Associated | Open in IMG/M |
3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
3300005454 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 | Environmental | Open in IMG/M |
3300005533 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 | Environmental | Open in IMG/M |
3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Host-Associated | Open in IMG/M |
3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
3300010326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012975 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015 | Environmental | Open in IMG/M |
3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
3300021953 | Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R07 | Environmental | Open in IMG/M |
3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Host-Associated | Open in IMG/M |
3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026308 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 (SPAdes) | Environmental | Open in IMG/M |
3300026316 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 (SPAdes) | Environmental | Open in IMG/M |
3300026317 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 (SPAdes) | Environmental | Open in IMG/M |
3300026528 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 (SPAdes) | Environmental | Open in IMG/M |
3300027505 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_O3 (SPAdes) | Environmental | Open in IMG/M |
3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) | Environmental | Open in IMG/M |
3300027535 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M2 (SPAdes) | Environmental | Open in IMG/M |
3300027821 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027826 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300030520 | III_Palsa_N2 coassembly | Environmental | Open in IMG/M |
3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
3300031682 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22 | Environmental | Open in IMG/M |
3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
3300031769 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f24 | Environmental | Open in IMG/M |
3300031792 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23 | Environmental | Open in IMG/M |
3300031793 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21 | Environmental | Open in IMG/M |
3300031794 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f23 | Environmental | Open in IMG/M |
3300031795 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19 | Environmental | Open in IMG/M |
3300031799 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f21 | Environmental | Open in IMG/M |
3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
3300031831 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f20 | Environmental | Open in IMG/M |
3300031846 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19 | Environmental | Open in IMG/M |
3300031859 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f25 | Environmental | Open in IMG/M |
3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
3300032042 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f26 | Environmental | Open in IMG/M |
3300032063 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17 | Environmental | Open in IMG/M |
3300032094 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f25 | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI12023J11887_10109782 | 3300000732 | Forest Soil | DLERELTVGDADRADLTLHLLKSLQPAPITDRPHSWDY* |
JGI12627J18819_102789491 | 3300001867 | Forest Soil | RITIWHPRLRDAAADLERELTVGEADRAELTLRLTKSLAPAPLDDRPHSWDY* |
Ga0066869_100575961 | 3300005165 | Soil | YRVNIWHPRLRDAGTDLERELTVQDSDRAELTLRLAKPLQPAPLTERPHSWDY* |
Ga0066672_108136762 | 3300005167 | Soil | ADLERELTVGDADRADLTLRLLKSLQPAPITDRAHSWDY* |
Ga0070680_1013959252 | 3300005336 | Corn Rhizosphere | GIWHPRLRDAETDLERELSVGDTDRADLTLRLAKSLEPEPLIDRPRSWDY* |
Ga0070671_1002287171 | 3300005355 | Switchgrass Rhizosphere | RLGDTETDLARELSVGESDRAELTLRLTRGLQPAPLTDRPHSWDY* |
Ga0070713_1021034601 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | ADLERQLTVIDTDRAELTLRLAKPLQPAPLTERPHSWDY* |
Ga0066687_101426902 | 3300005454 | Soil | PRMRETEADLERELTVGDADRAELTVHLGKSLLPAPISDRPHSWDY* |
Ga0070734_104461371 | 3300005533 | Surface Soil | ERELTVGEGDHAELTLRLLKSLEPAPIARQHSWDY* |
Ga0068853_1008078342 | 3300005539 | Corn Rhizosphere | IWHPRLRDAGTDLERELTVQESDRAELTLRLAKPLQPAPLTERPHSWDY* |
Ga0070696_1011004082 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | GRYTVGIWHPRLRDAEADLERELSVGETDRADLTLRLGKSLEPAPLIDRPHSWDY* |
Ga0066707_107649272 | 3300005556 | Soil | RETEADLERELTVGDADRAELTVHLGKSLLPAPISDRPHSWDY* |
Ga0066696_107983812 | 3300006032 | Soil | MRETEADLERELTVGDADRAELTVHLGKSLLPAPISDRPHSWDY* |
Ga0070712_1009611812 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | RLRDTETDLARELTVGEGDRAELTLRLTRGLQPAPLTDRPHSWDY* |
Ga0070765_1018773952 | 3300006176 | Soil | PSELTRELMVGEGDRADLTVRLGKALEPARLTDRPHSWD* |
Ga0099795_100449723 | 3300007788 | Vadose Zone Soil | YQVSIWHPRLRESDTDLQRELTVGDADRADLQLHLLKSLQPAPINDRPHSWDY* |
Ga0126380_106426432 | 3300010043 | Tropical Forest Soil | ARELTVGESDRAELTLHLSRSLQPAPLTDRPHSWDY* |
Ga0126380_109786792 | 3300010043 | Tropical Forest Soil | RVVLWHPRLRDDETDLARELTVGEGDRAELTLRLSRSLQPGPLADRPHSWDY* |
Ga0126373_101157311 | 3300010048 | Tropical Forest Soil | RYRVELWHPRLRDSEADLERELTIGETDRTDMTLRLSKPLQPAPLARQPHSWDY* |
Ga0134065_100736192 | 3300010326 | Grasslands Soil | DLERELTVGDADRADLTLRLLKSLQPAPITDRPHSWDY* |
Ga0126370_115980421 | 3300010358 | Tropical Forest Soil | HPRLRDESGELERELTVGDGDRAELTLRVQKALQPAQLTAHPHSWDY* |
Ga0126376_121074012 | 3300010359 | Tropical Forest Soil | GLRDNEAELGRELTVAEAGRAQLTPSMSRPLQPAPLTVRPHSRDY* |
Ga0126378_134474232 | 3300010361 | Tropical Forest Soil | RVRELTVGESDRAELTLRLSRPLQPAPLNDRPHSWDY* |
Ga0126377_118105322 | 3300010362 | Tropical Forest Soil | GRELTVADADRAELTLRLSRPLQPAPLTNRPHSWDY* |
Ga0134126_119939351 | 3300010396 | Terrestrial Soil | LGDTETDLARELSVGEGDRAELTLRLTRGLQPAPLTDRPHSWDY* |
Ga0137398_111495961 | 3300012683 | Vadose Zone Soil | IWHPRLRESDTDLQRELTVGDADRADLQLHLLKSLQPAPITDRPHSWDY* |
Ga0137396_112679202 | 3300012918 | Vadose Zone Soil | VERELTVGDADRSDLTLRLLKSLQSAPIADRPHSWDY* |
Ga0137416_114288901 | 3300012927 | Vadose Zone Soil | TDLQRELTVGDADRADLQLHLLKSLQPTPITDRPHSWDY* |
Ga0134110_101065132 | 3300012975 | Grasslands Soil | RLRESEADLERELTVGDADRADLTLRLLKSLQPAPITDRPHSWDY* |
Ga0164304_109038392 | 3300012986 | Soil | RELTVQESDRAELTLRLAKPLQPAPLTERPHSWDY* |
Ga0132255_1011194671 | 3300015374 | Arabidopsis Rhizosphere | ERELTVQESDRAELTLRLAKPLQPAPLTERPHSWDY* |
Ga0182035_115890421 | 3300016341 | Soil | RLRDSESDLERELTVGEGDRADLTLHLSKPLQPARLTDRPHSWDY |
Ga0182034_106847591 | 3300016371 | Soil | RIRDDEADLRRELTVGDADRAELTLRLSRPPQPAPLTNRPHSWDY |
Ga0182038_101701221 | 3300016445 | Soil | RELTVGEGDRAELTLRLTRGLQPAPLAERPHSWDY |
Ga0187778_105720262 | 3300017961 | Tropical Peatland | RLREPESNLDRELAIGDAERAELTVQLSKPLQPAPLHDHPHTWDY |
Ga0187778_106103952 | 3300017961 | Tropical Peatland | AWSTEVTRGRYRIAVWHPRMRESEADLERELTVGETDHAELTLRLTKTLAPAPLSDRRHSWDY |
Ga0187783_103852951 | 3300017970 | Tropical Peatland | NADLERELTVGEGDRADLTLRLSKPLQPAPLADRPHSWDY |
Ga0187783_106183922 | 3300017970 | Tropical Peatland | DSESDLERELTIGDGDRAALTLHLAKPLQPAPLTDRPHSWD |
Ga0187783_110241202 | 3300017970 | Tropical Peatland | ERVKSVRELAVEGDRAELTLRLTKPLQPAPLADRPHSWDY |
Ga0187777_109571512 | 3300017974 | Tropical Peatland | REDAPDLERELTVGDNDRADLTVHLSKSLQPAPLTDRPHSWDY |
Ga0187765_102069442 | 3300018060 | Tropical Peatland | EESDLARELTVNEGDRAELTLHLTRLLQPAPLSDRPHSWDY |
Ga0187770_108154262 | 3300018090 | Tropical Peatland | LWHPRLREPDAEVERELSVGDADRAELTVHLSRPLQPAPLAPDPHSQDY |
Ga0066662_117041152 | 3300018468 | Grasslands Soil | SIWHPRMRETEADLEHELTVGDADRAELTVHLGKSLLPAPISDRPHSWDY |
Ga0179592_100513761 | 3300020199 | Vadose Zone Soil | RESDTDLQRELTVGDADRADLQLHLLKSLQPAPINDRPHSWDY |
Ga0210399_101897393 | 3300020581 | Soil | LERELTVGDADRADLTLHLLKSLQPAPIADRPHSWDY |
Ga0210399_107205111 | 3300020581 | Soil | EVTRGRYRISVWHPRMRDAEADSERELTVGQSDHAELTLKLAKPLAPARLADRPHSWDY |
Ga0210395_102698841 | 3300020582 | Soil | YRIALWHPRLRENDANLQRELTVAEGERAELTLSLSKPLQPAELTDRPHSWDY |
Ga0210408_111291772 | 3300021178 | Soil | LWHPRLRESEADLERELTIAEADRAELTLHLTKTLQPARLAERPHSWDY |
Ga0210385_107294882 | 3300021402 | Soil | PRVRDNDLERELMVGDADSAELTLRLAKPLQPAPLTDRPHSWDY |
Ga0210397_112831182 | 3300021403 | Soil | GRYQITIWHPRTRESEADLQRELTIGDGDRADLTVRLQKALQPAPIADRPHSWDY |
Ga0210391_101617973 | 3300021433 | Soil | RYRVALWHPRLRENDANLQRELTVAEGERAELTLSLSKPLQPAELTDRPHSWDY |
Ga0210392_100393581 | 3300021475 | Soil | EVTRGHYEVSLWHPRIRDDSADLERQLTVSESDRAELTLRLAKPLQPAPLTERPHSWDY |
Ga0210402_105538691 | 3300021478 | Soil | VTRGHYAVSLWHPRIRDDGADLERQLTVSESDRAELTLRLAKPLQPAPLTEQRLHSWDY |
Ga0210409_102844521 | 3300021559 | Soil | RIRDDGADLERQLTVSESDRAELTLRLAKPLQPAPLTERPHSWDY |
Ga0126371_102868701 | 3300021560 | Tropical Forest Soil | PRMRENEADLERELTVGESDHAELTLRLTKSLQPAPIADRPHSWDY |
Ga0213880_101534771 | 3300021953 | Exposed Rock | REEAADLERELTVGETDRAELTLRLSRPLLPAPLGNRPHSWDY |
Ga0228598_10929591 | 3300024227 | Rhizosphere | RELSVGEADHAELTLRLTKSLTPAPLAERPHSWDYQ |
Ga0207680_105156631 | 3300025903 | Switchgrass Rhizosphere | DLERELTVQESDRAELTLRLAKPLQPAPLTERPHSWDY |
Ga0207663_103853631 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | PRIRDDSADLERQLTVIDTDRAELTLRLAKPLQPAPLTQRPHSWDY |
Ga0207660_108689831 | 3300025917 | Corn Rhizosphere | VGIWHPRLRDAETDLERELSVGDTDRADLTLRLAKSLEPEPLIDRPRSWDY |
Ga0207687_104968152 | 3300025927 | Miscanthus Rhizosphere | NIWHPRLRDAGTDLERELTVQESDRAELTLRLAKPLQPAPLTERPHSWDY |
Ga0207644_107293141 | 3300025931 | Switchgrass Rhizosphere | RLGDTETDLARELSVGESDRAELTLRLTRGLQPAPLTDRPHSWDY |
Ga0207690_115016792 | 3300025932 | Corn Rhizosphere | VNIWHPRLRDAGTDLERELTVQESDRAELTLRLAKPLQPAPLSERPHSWDY |
Ga0207669_118820872 | 3300025937 | Miscanthus Rhizosphere | AGTDLERELTVQESDRAELTLRLAKPLQPAPLTERPHSWDY |
Ga0207639_107565671 | 3300026041 | Corn Rhizosphere | YRVNIWHPRLRDAGTDLERELTVQESDRAELTLRLAKPLQPAPLTERPHSWDY |
Ga0209265_10814771 | 3300026308 | Soil | ADLERELTVGDADRADLTLRLLKSLQPAPITDRPHSWDY |
Ga0209155_10543111 | 3300026316 | Soil | SIWHPRMRETEADLERELTVGDADRAELTVHLGKSLLPAPITDRPHSWDY |
Ga0209154_12670932 | 3300026317 | Soil | LERELTVGDADRADLTLRLLKSLQPAPITDRAHSWDY |
Ga0209378_12833002 | 3300026528 | Soil | MRETEADLERELTVGDAGRAELTVHLGKSLLPAPISDRPHSWDY |
Ga0209218_10648122 | 3300027505 | Forest Soil | ARDEPSELTRELMVGEGDRADLTVRLGKALEPARLTDRPHSWD |
Ga0209179_11416041 | 3300027512 | Vadose Zone Soil | PRLRESDTDLQRELTVGDADRADLQLHLLKSLQPAPINDRPHSWDY |
Ga0209734_10268402 | 3300027535 | Forest Soil | PRLRDSAADLERELTVGDADRADLTLHLLKSLQPAPIADRPHSWDY |
Ga0209811_101612921 | 3300027821 | Surface Soil | GRELTVADADRAELTLRLSRPLQPAPLTDRPHSWDY |
Ga0209060_103321342 | 3300027826 | Surface Soil | NTDLERELTVGEGDHAELTLRLLKSLEPAPIARQHSWDY |
Ga0308309_115041531 | 3300028906 | Soil | RDEPSELTRELMVGEGDRADLTVRLGKALEPARLTDRPHSWD |
Ga0222749_103296801 | 3300029636 | Soil | QVTIWHPRLRDSPADLERELTVGDADRADLTLHLLKSLQPAPIADRPHSWDY |
Ga0311372_102871824 | 3300030520 | Palsa | VPRGHYRVELWHPRARDEPAELTRELTVGEADRADLTVRLGKTLEPARLADRAHSWD |
Ga0318534_106852241 | 3300031544 | Soil | VELWHPRLRDNETELARELTVGESDRAELTLRLSRPLQPAPLSDRPHSWDY |
Ga0318538_106964462 | 3300031546 | Soil | DDEADLSRELTVGDADRAELTLRLSRPPQPAPLTDRPHSWDY |
Ga0318515_104738942 | 3300031572 | Soil | LARELTVGEGDRAELTLRLTRGLQPAPLAERPQSWDY |
Ga0318555_100101534 | 3300031640 | Soil | ALWHPRLRDNETDLERELTVGDGDRAEFTLRLTHGLQPAPLADRPHSWDY |
Ga0318572_108757052 | 3300031681 | Soil | VELWHPRIRDDEADLRRELTVGDADRAELTLRLSRPPQPAPLTDRPHSWDY |
Ga0318560_100013619 | 3300031682 | Soil | LERELTVGDSDRADLTLRLSKPLQPAPLSDRPHSWDY |
Ga0310686_1020516711 | 3300031708 | Soil | RELTVGDTDRADLTLRLAKPLEPAPITDRPHSWDY |
Ga0306917_106166431 | 3300031719 | Soil | RGHYRVELWHPRLRDNETELARELTVGESDRAELTLRLSRPQQPAPLSDRPHSWDY |
Ga0307469_105974761 | 3300031720 | Hardwood Forest Soil | ERQLTVSETDRAELTLRLAKPLQPAPLAERPHSWDY |
Ga0307468_1020968912 | 3300031740 | Hardwood Forest Soil | DLGRELTVADADRAELTLRLSRPLQPAPLTDRPHSWDY |
Ga0306918_106289262 | 3300031744 | Soil | DLARELTVGEGDRAELTLRLTRGLQPAPLAERPHSWDY |
Ga0306918_113217391 | 3300031744 | Soil | HPRLRDNETELARELSVGEGDRAELTLRLTRGLQPAPLAERPHSWDY |
Ga0307475_101234303 | 3300031754 | Hardwood Forest Soil | PRLRESAADLERELTVGEDDRADLTLHLQKSLQPAPITDRPHSWDY |
Ga0307475_109260071 | 3300031754 | Hardwood Forest Soil | SNEVVRGRYRITIWHPRMRDEPGDLERELTVGEADHAELTLRLGKPLTPAPLADRPHSWD |
Ga0318526_101822002 | 3300031769 | Soil | YRVAVWHPRLRENSEDLERELTVGDSDRADLTLRLSKPLQPAPLSDRPHSWDY |
Ga0318529_105459891 | 3300031792 | Soil | ALWHPRLRENSEDLERELTVGDSDRADLTLRLSKPLQPAPLSDRPHSWDY |
Ga0318548_104153442 | 3300031793 | Soil | LRDSEADLERELTVGETDRADLTLRLSKPLQPAPLGGRAHSWDY |
Ga0318503_100418851 | 3300031794 | Soil | LWHPRLRDNETDLERELTVGEGDRAELTLRLTHGLQPAPLADRPHSWDY |
Ga0318503_102183801 | 3300031794 | Soil | YRVALWHPRLRENSEDLERELTVGDSDRADLTLRLSKPLQPAPLSDRPHSWDY |
Ga0318557_100903442 | 3300031795 | Soil | PRIRDDEADLRRELTVGDADRAELTLRLSRPPQPAPLTNRPHSWDY |
Ga0318557_103738061 | 3300031795 | Soil | RDNETELARELTVGESDRAELTLRLSRPLQPAPLSDRPHSWDY |
Ga0318565_105634041 | 3300031799 | Soil | ALWHPRLRDNETDLERELTVGEGDRAELTLRLTHGLQPAPLAERPHSWDY |
Ga0307478_107953942 | 3300031823 | Hardwood Forest Soil | SIWHPRVRESAADLERELTVGEDDRADLTLHLQKSLQPAPITDRPHSWDY |
Ga0318564_103827562 | 3300031831 | Soil | VAVWHPRLRENSEDLERELTVGDSDRADLTLRLSKPLQPAPLSDRPHSWDY |
Ga0318512_102120101 | 3300031846 | Soil | VELWHPRIRDDEADLRRELTVGDADRAELTLRLSRPPQPAPLTNRPHSWDY |
Ga0318527_101056581 | 3300031859 | Soil | LWHPRIRDDEADLRRELTVGDADRAELTLRLSRPPQPAPLTDRPHSWDY |
Ga0306919_112675181 | 3300031879 | Soil | SEDLERELTVGDSDRADLTLRLSKPLQPAPLSDRPHSWDY |
Ga0306923_124305741 | 3300031910 | Soil | DNESDLERELTVGEGDRADLTLRLAKPLQPGPLAERPHSWDY |
Ga0307479_119098341 | 3300031962 | Hardwood Forest Soil | WHPRVRESEADLVRELTVAEDDRADLQLHLLKSLQPAPITDRPHSWDY |
Ga0318545_102966831 | 3300032042 | Soil | LWHPRLRDNETDLARELTVGEGDRAELTLRLTRGLQPAPLAERPHSWDY |
Ga0318504_100269783 | 3300032063 | Soil | ARELTVGEGDRAELTLRLTRGLQPAPLAERPHSWDY |
Ga0318540_104950092 | 3300032094 | Soil | ALWHPRLRDNETDLARELTVGEGDRAELTLRLTRGLQPAPLAERPHSWDY |
Ga0307471_1008793871 | 3300032180 | Hardwood Forest Soil | RDEPGDLERELTVGEADHAELTLRLGKPLTPAPLADRPHSWAY |
Ga0335082_100321168 | 3300032782 | Soil | GAWSTEVTRGRYRIAVWHPRMRESEADLERELTVGETDHAELTLRLTKTLTPAPLSERRHSWDY |
Ga0335079_114628982 | 3300032783 | Soil | GSWAAELAPGRYQVTIWHPRLRAEAKDLAREFAVGADDRAEFTIRLAKPLQPAPLDRPHSWDY |
Ga0335076_105438481 | 3300032955 | Soil | VNLWHPRVRDEGADLERQLTVSEGDRAELTLRLVKPLQPAPLERPHSWDY |
⦗Top⦘ |