NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F083055

Metagenome Family F083055

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F083055
Family Type Metagenome
Number of Sequences 113
Average Sequence Length 41 residues
Representative Sequence MTEHGPEFERENTKIGLALFGLFVVLVALTFAVAFIYLAVF
Number of Associated Samples 101
Number of Associated Scaffolds 113

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 1.77 %
% of genes near scaffold ends (potentially truncated) 19.47 %
% of genes from short scaffolds (< 2000 bps) 83.19 %
Associated GOLD sequencing projects 97
AlphaFold2 3D model prediction Yes
3D model pTM-score0.60

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (88.496 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(28.319 % of family members)
Environment Ontology (ENVO) Unclassified
(30.088 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(53.097 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 50.72%    β-sheet: 0.00%    Coil/Unstructured: 49.28%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.60
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 113 Family Scaffolds
PF01425Amidase 47.79
PF01040UbiA 35.40
PF00115COX1 1.77
PF13442Cytochrome_CBB3 0.88
PF08281Sigma70_r4_2 0.88

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 113 Family Scaffolds
COG0154Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidaseTranslation, ribosomal structure and biogenesis [J] 47.79

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms88.50 %
UnclassifiedrootN/A11.50 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2199352025|deepsgr__Contig_125638All Organisms → cellular organisms → Bacteria690Open in IMG/M
3300002568|C688J35102_118423539All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium558Open in IMG/M
3300002568|C688J35102_120594709All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1220Open in IMG/M
3300003990|Ga0055455_10083699All Organisms → cellular organisms → Bacteria921Open in IMG/M
3300004463|Ga0063356_104834334Not Available579Open in IMG/M
3300004479|Ga0062595_102326241All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium529Open in IMG/M
3300004643|Ga0062591_102722835All Organisms → cellular organisms → Bacteria523Open in IMG/M
3300005093|Ga0062594_102480878All Organisms → cellular organisms → Bacteria569Open in IMG/M
3300005163|Ga0066823_10149599All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium516Open in IMG/M
3300005294|Ga0065705_10194395All Organisms → cellular organisms → Bacteria1474Open in IMG/M
3300005329|Ga0070683_101684970All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium610Open in IMG/M
3300005330|Ga0070690_100396418All Organisms → cellular organisms → Bacteria1013Open in IMG/M
3300005332|Ga0066388_102459400All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium946Open in IMG/M
3300005332|Ga0066388_107482210All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium548Open in IMG/M
3300005355|Ga0070671_101556336All Organisms → cellular organisms → Bacteria586Open in IMG/M
3300005434|Ga0070709_10069004All Organisms → cellular organisms → Bacteria2275Open in IMG/M
3300005434|Ga0070709_11487941All Organisms → cellular organisms → Bacteria549Open in IMG/M
3300005434|Ga0070709_11710214All Organisms → cellular organisms → Bacteria514Open in IMG/M
3300005440|Ga0070705_100011237All Organisms → cellular organisms → Bacteria4510Open in IMG/M
3300005526|Ga0073909_10434058All Organisms → cellular organisms → Bacteria625Open in IMG/M
3300005535|Ga0070684_100051629All Organisms → cellular organisms → Bacteria3573Open in IMG/M
3300005549|Ga0070704_100057378All Organisms → cellular organisms → Bacteria2768Open in IMG/M
3300005587|Ga0066654_10641093All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium591Open in IMG/M
3300005614|Ga0068856_100939491All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium883Open in IMG/M
3300005617|Ga0068859_101744379All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium688Open in IMG/M
3300005718|Ga0068866_10728999Not Available683Open in IMG/M
3300005764|Ga0066903_102564897All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium988Open in IMG/M
3300005841|Ga0068863_101698723All Organisms → cellular organisms → Bacteria641Open in IMG/M
3300005841|Ga0068863_102137076All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium570Open in IMG/M
3300005873|Ga0075287_1045365All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium596Open in IMG/M
3300005983|Ga0081540_1021271All Organisms → cellular organisms → Bacteria3870Open in IMG/M
3300006175|Ga0070712_100385643All Organisms → cellular organisms → Bacteria1154Open in IMG/M
3300006806|Ga0079220_10025898All Organisms → cellular organisms → Bacteria2538Open in IMG/M
3300006806|Ga0079220_10285701Not Available1010Open in IMG/M
3300006914|Ga0075436_100782828All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium710Open in IMG/M
3300006954|Ga0079219_10472040All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium866Open in IMG/M
3300009176|Ga0105242_11586476All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium688Open in IMG/M
3300009177|Ga0105248_11954877All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium666Open in IMG/M
3300009551|Ga0105238_12261074All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium579Open in IMG/M
3300009840|Ga0126313_10108860All Organisms → cellular organisms → Bacteria2048Open in IMG/M
3300010041|Ga0126312_10396986All Organisms → cellular organisms → Bacteria980Open in IMG/M
3300010359|Ga0126376_10738475All Organisms → cellular organisms → Bacteria952Open in IMG/M
3300010360|Ga0126372_10121277All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium2021Open in IMG/M
3300010360|Ga0126372_13289256All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium503Open in IMG/M
3300010364|Ga0134066_10408595All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium520Open in IMG/M
3300010373|Ga0134128_10140062All Organisms → cellular organisms → Bacteria2737Open in IMG/M
3300010400|Ga0134122_11116559Not Available782Open in IMG/M
3300012200|Ga0137382_10920719All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium629Open in IMG/M
3300012481|Ga0157320_1009572All Organisms → cellular organisms → Bacteria734Open in IMG/M
3300012494|Ga0157341_1047988All Organisms → cellular organisms → Bacteria514Open in IMG/M
3300012496|Ga0157353_1006619All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium862Open in IMG/M
3300012907|Ga0157283_10101226All Organisms → cellular organisms → Bacteria773Open in IMG/M
3300012910|Ga0157308_10102113All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium847Open in IMG/M
3300012915|Ga0157302_10063317All Organisms → cellular organisms → Bacteria1079Open in IMG/M
3300012941|Ga0162652_100106029All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium507Open in IMG/M
3300012951|Ga0164300_11007591All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium536Open in IMG/M
3300012955|Ga0164298_11414768All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium539Open in IMG/M
3300012958|Ga0164299_10798281All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium673Open in IMG/M
3300012958|Ga0164299_10858389Not Available654Open in IMG/M
3300012960|Ga0164301_10708743All Organisms → cellular organisms → Bacteria758Open in IMG/M
3300012960|Ga0164301_11329998All Organisms → cellular organisms → Bacteria584Open in IMG/M
3300012961|Ga0164302_11118502All Organisms → cellular organisms → Bacteria623Open in IMG/M
3300012984|Ga0164309_11511516All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium574Open in IMG/M
3300017792|Ga0163161_10678580All Organisms → cellular organisms → Bacteria856Open in IMG/M
3300018061|Ga0184619_10120730All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1186Open in IMG/M
3300019361|Ga0173482_10690839All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium526Open in IMG/M
3300019362|Ga0173479_10089886All Organisms → cellular organisms → Bacteria1113Open in IMG/M
3300019883|Ga0193725_1057813All Organisms → cellular organisms → Bacteria978Open in IMG/M
3300019886|Ga0193727_1008501All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium4046Open in IMG/M
3300020005|Ga0193697_1001471All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria6813Open in IMG/M
3300020016|Ga0193696_1001341All Organisms → cellular organisms → Bacteria7583Open in IMG/M
3300020022|Ga0193733_1153126All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium622Open in IMG/M
3300021363|Ga0193699_10009691All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium3447Open in IMG/M
3300021445|Ga0182009_10133742All Organisms → cellular organisms → Bacteria1165Open in IMG/M
3300021510|Ga0222621_1053819All Organisms → cellular organisms → Bacteria844Open in IMG/M
3300021510|Ga0222621_1145882Not Available504Open in IMG/M
3300021560|Ga0126371_13649393All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium519Open in IMG/M
3300022756|Ga0222622_10002698All Organisms → cellular organisms → Bacteria7593Open in IMG/M
3300022898|Ga0247745_1087765All Organisms → cellular organisms → Bacteria527Open in IMG/M
3300024181|Ga0247693_1047192All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium619Open in IMG/M
3300024232|Ga0247664_1057757All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium896Open in IMG/M
3300024232|Ga0247664_1177822All Organisms → cellular organisms → Bacteria504Open in IMG/M
3300024246|Ga0247680_1069280All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium517Open in IMG/M
3300024288|Ga0179589_10164817All Organisms → cellular organisms → Bacteria953Open in IMG/M
3300025552|Ga0210142_1046745All Organisms → cellular organisms → Bacteria834Open in IMG/M
3300025885|Ga0207653_10384188Not Available550Open in IMG/M
3300025916|Ga0207663_10206601All Organisms → cellular organisms → Bacteria1420Open in IMG/M
3300026088|Ga0207641_10694564All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1002Open in IMG/M
3300026312|Ga0209153_1210457All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium667Open in IMG/M
3300027775|Ga0209177_10392961Not Available554Open in IMG/M
3300027821|Ga0209811_10111653Not Available990Open in IMG/M
3300028281|Ga0247689_1019230All Organisms → cellular organisms → Bacteria902Open in IMG/M
3300028707|Ga0307291_1013109All Organisms → cellular organisms → Bacteria1824Open in IMG/M
3300028711|Ga0307293_10237529Not Available579Open in IMG/M
3300028718|Ga0307307_10002865All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium4330Open in IMG/M
3300028722|Ga0307319_10001035All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria8538Open in IMG/M
3300028768|Ga0307280_10284823All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium600Open in IMG/M
3300028771|Ga0307320_10284085All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium656Open in IMG/M
3300028778|Ga0307288_10034497All Organisms → cellular organisms → Bacteria1689Open in IMG/M
3300028796|Ga0307287_10148238All Organisms → cellular organisms → Bacteria891Open in IMG/M
3300028807|Ga0307305_10049614All Organisms → cellular organisms → Bacteria1933Open in IMG/M
3300028810|Ga0307294_10035844Not Available1387Open in IMG/M
3300028811|Ga0307292_10498772All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium522Open in IMG/M
3300028881|Ga0307277_10396629All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium617Open in IMG/M
3300028885|Ga0307304_10160273All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium943Open in IMG/M
3300028889|Ga0247827_10657947Not Available678Open in IMG/M
3300030511|Ga0268241_10009347All Organisms → cellular organisms → Bacteria1826Open in IMG/M
3300031938|Ga0308175_100011993All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria6570Open in IMG/M
3300031938|Ga0308175_100130184All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium2378Open in IMG/M
3300031996|Ga0308176_10023837All Organisms → cellular organisms → Bacteria4655Open in IMG/M
3300032013|Ga0310906_10768641All Organisms → cellular organisms → Bacteria678Open in IMG/M
3300033551|Ga0247830_11646197Not Available514Open in IMG/M
3300034817|Ga0373948_0156441All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium573Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil28.32%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere7.08%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil5.31%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil4.42%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil3.54%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil3.54%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil3.54%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere3.54%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment2.65%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil2.65%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil2.65%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands1.77%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil1.77%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.77%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil1.77%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil1.77%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil1.77%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil1.77%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere1.77%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere1.77%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.89%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.89%
Unplanted SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil0.89%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere0.89%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.89%
Rice Paddy SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil0.89%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.89%
SoilEnvironmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil0.89%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.89%
Tabebuia Heterophylla RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere0.89%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere0.89%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.89%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.89%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere0.89%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.89%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.89%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.89%
Rhizosphere SoilHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil0.89%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.89%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2199352025Soil microbial communities from Rothamsted, UK, for project Deep Soil - DEEP SOILEnvironmentalOpen in IMG/M
3300002568Grasslands soil microbial communities from Hopland, California, USA - 2EnvironmentalOpen in IMG/M
3300003990Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Goodyear_PhragC_D2EnvironmentalOpen in IMG/M
3300004463Combined assembly of Arabidopsis thaliana microbial communitiesHost-AssociatedOpen in IMG/M
3300004479Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAsEnvironmentalOpen in IMG/M
3300004643Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3EnvironmentalOpen in IMG/M
3300005093Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All BlocksEnvironmentalOpen in IMG/M
3300005163Soil and rhizosphere microbial communities from Laval, Canada - mgHMBEnvironmentalOpen in IMG/M
3300005294Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk SoilEnvironmentalOpen in IMG/M
3300005329Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaGEnvironmentalOpen in IMG/M
3300005330Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaGEnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005355Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaGHost-AssociatedOpen in IMG/M
3300005434Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaGEnvironmentalOpen in IMG/M
3300005440Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaGEnvironmentalOpen in IMG/M
3300005526Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1EnvironmentalOpen in IMG/M
3300005535Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaGEnvironmentalOpen in IMG/M
3300005549Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaGEnvironmentalOpen in IMG/M
3300005587Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103EnvironmentalOpen in IMG/M
3300005614Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2Host-AssociatedOpen in IMG/M
3300005617Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2Host-AssociatedOpen in IMG/M
3300005718Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2Host-AssociatedOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005841Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2Host-AssociatedOpen in IMG/M
3300005873Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_0N_301EnvironmentalOpen in IMG/M
3300005983Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1Host-AssociatedOpen in IMG/M
3300006175Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaGEnvironmentalOpen in IMG/M
3300006806Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100EnvironmentalOpen in IMG/M
3300006914Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5Host-AssociatedOpen in IMG/M
3300006954Agricultural soil microbial communities from Georgia to study Nitrogen management - GA ControlEnvironmentalOpen in IMG/M
3300009176Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaGHost-AssociatedOpen in IMG/M
3300009177Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaGHost-AssociatedOpen in IMG/M
3300009551Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaGHost-AssociatedOpen in IMG/M
3300009840Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105AEnvironmentalOpen in IMG/M
3300010041Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104AEnvironmentalOpen in IMG/M
3300010359Tropical forest soil microbial communities from Panama - MetaG Plot_15EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010364Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09212015EnvironmentalOpen in IMG/M
3300010373Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4EnvironmentalOpen in IMG/M
3300010400Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2EnvironmentalOpen in IMG/M
3300012200Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012481Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.1.yng.040610Host-AssociatedOpen in IMG/M
3300012494Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610Host-AssociatedOpen in IMG/M
3300012496Unplanted soil (control) microbial communities from North Carolina - M.Soil.4.yng.090610EnvironmentalOpen in IMG/M
3300012907Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S044-104R-1EnvironmentalOpen in IMG/M
3300012910Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S198-509B-2EnvironmentalOpen in IMG/M
3300012915Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S103-311B-2EnvironmentalOpen in IMG/M
3300012941Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t4i015EnvironmentalOpen in IMG/M
3300012951Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MGEnvironmentalOpen in IMG/M
3300012955Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MGEnvironmentalOpen in IMG/M
3300012958Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MGEnvironmentalOpen in IMG/M
3300012960Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MGEnvironmentalOpen in IMG/M
3300012961Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MGEnvironmentalOpen in IMG/M
3300012984Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MGEnvironmentalOpen in IMG/M
3300017792Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaGHost-AssociatedOpen in IMG/M
3300018061Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1EnvironmentalOpen in IMG/M
3300019361Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2)EnvironmentalOpen in IMG/M
3300019362Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2)EnvironmentalOpen in IMG/M
3300019883Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2a2EnvironmentalOpen in IMG/M
3300019886Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2c2EnvironmentalOpen in IMG/M
3300020005Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3m2EnvironmentalOpen in IMG/M
3300020016Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3m1EnvironmentalOpen in IMG/M
3300020022Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1s2EnvironmentalOpen in IMG/M
3300021363Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3c2EnvironmentalOpen in IMG/M
3300021445Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaGEnvironmentalOpen in IMG/M
3300021510Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_coexEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300022756Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1EnvironmentalOpen in IMG/M
3300022898Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S109-311C-5EnvironmentalOpen in IMG/M
3300024181Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK34EnvironmentalOpen in IMG/M
3300024232Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK05EnvironmentalOpen in IMG/M
3300024246Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK21EnvironmentalOpen in IMG/M
3300024288Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungalEnvironmentalOpen in IMG/M
3300025552Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Goodyear_PhragC_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300025885Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025916Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026088Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026312Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 (SPAdes)EnvironmentalOpen in IMG/M
3300027775Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes)EnvironmentalOpen in IMG/M
3300027821Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300028281Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK30EnvironmentalOpen in IMG/M
3300028707Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_148EnvironmentalOpen in IMG/M
3300028711Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_150EnvironmentalOpen in IMG/M
3300028718Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_194EnvironmentalOpen in IMG/M
3300028722Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_368EnvironmentalOpen in IMG/M
3300028768Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_119EnvironmentalOpen in IMG/M
3300028771Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_369EnvironmentalOpen in IMG/M
3300028778Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_142EnvironmentalOpen in IMG/M
3300028796Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_141EnvironmentalOpen in IMG/M
3300028807Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186EnvironmentalOpen in IMG/M
3300028810Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_151EnvironmentalOpen in IMG/M
3300028811Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_149EnvironmentalOpen in IMG/M
3300028881Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116EnvironmentalOpen in IMG/M
3300028885Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_185EnvironmentalOpen in IMG/M
3300028889Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day2EnvironmentalOpen in IMG/M
3300030511Bulk soil microbial communities from Mexico - Amatitan (Am) metaG (v2)EnvironmentalOpen in IMG/M
3300031938Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1EnvironmentalOpen in IMG/M
3300031996Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2EnvironmentalOpen in IMG/M
3300032013Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3EnvironmentalOpen in IMG/M
3300033551Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5EnvironmentalOpen in IMG/M
3300034817Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1Host-AssociatedOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
deepsgr_020149002199352025SoilMSEHGPEFERENTRIGLALFGLFVVLVALTFAVAFIYLDVF
C688J35102_11842353923300002568SoilMTEHGPEFERENTKLGLALFALFVVLVALTFAVGFIYLAVF*
C688J35102_12059470923300002568SoilMSEHGPEFERENTKIGLGLFGLFVVLVALTFAVAFIYLAVF*
Ga0055455_1008369923300003990Natural And Restored WetlandsMSEHGPEFERENTKIGLALFGLFVVLVALTFAAGFIYLAVF*
Ga0063356_10483433423300004463Arabidopsis Thaliana RhizosphereMSEHGPEFERENTRIGLALFGLFVVLVALTFAVAFIYLAVF*
Ga0062595_10232624123300004479SoilPAALMVEHGPEFERENTKIGLALFGLFVLLFGLTFAVAFIWLAAS*
Ga0062591_10272283523300004643SoilMAEHGPEFERQNTRLGLALFALFLVLLAIFFAVGFIYLAVF*
Ga0062594_10248087823300005093SoilMTEHGPEFERENTKLGLALFGLFLVLLGLAFAVAFIYLAVF*
Ga0066823_1014959923300005163SoilMSEHGPEFERENTKIGLALFGLFVVLVALTFAVGFIYLAVF*
Ga0065705_1019439523300005294Switchgrass RhizosphereMSEHGPEFERENTRIGLALFGLFVVLVALTFAVAFIYLAIF*
Ga0070683_10168497023300005329Corn RhizosphereMTEHGPEFERENTKLGLMLFGLFLVILALAFAVAFIYLAVF*
Ga0070690_10039641823300005330Switchgrass RhizosphereMTEHGPEFERENTKIGLALFGLFVVLVALTFGVAFIYLAVF*
Ga0066388_10245940013300005332Tropical Forest SoilMAEHDESFERTNVNIGLALFGLFVVLVGLAFAVAFIYLAVF*
Ga0066388_10748221023300005332Tropical Forest SoilMPEHDADFERTNTNIGLALFGLFVVLLGLAFAVAFIYLAVF*
Ga0070671_10155633613300005355Switchgrass RhizosphereVPEHDESFERANMNLGFALFGLFLLLLALAFAVAFIYLAVF*
Ga0070709_1006900433300005434Corn, Switchgrass And Miscanthus RhizosphereMHDHDESFERTNMNIGFALFGLFLVLLGLAFAVAFIYLAVF*
Ga0070709_1148794113300005434Corn, Switchgrass And Miscanthus RhizosphereMHGHDESFDRTNTKIGLALFGLFLVLLALGFAVAFIYLAVF*
Ga0070709_1171021423300005434Corn, Switchgrass And Miscanthus RhizosphereMAEHGPEFERENVKLGLLLFGLFVVLLGLGFAVAFIYLAVF*
Ga0070705_10001123753300005440Corn, Switchgrass And Miscanthus RhizosphereMTEHGPEFERANNRLGLALFGLFLVLLGLGFAVAFIYLAVF*
Ga0073909_1043405823300005526Surface SoilMAEHGPDFERENDKLGLALFGLFVVLLGLSFAVAFIYLAVF*
Ga0070684_10005162943300005535Corn RhizosphereMTEHGPDFERANNRIGLALFALFVVLVGLAFAVAFIYLAVF*
Ga0070704_10005737823300005549Corn, Switchgrass And Miscanthus RhizosphereMTEHGPEFERENTKIGLALFGLFVVLVALTFAVAFIYLAVS*
Ga0066654_1064109323300005587SoilMAEHGPDFERRNTRLGLLLFLLFVVLIALFFVVGFVYLAIF*
Ga0068856_10093949123300005614Corn RhizosphereMTEHGPEFERTNNRIGLALFGLFVALVGLGFAVAFIYLAVF*
Ga0068859_10174437913300005617Switchgrass RhizosphereARGRPAALMTEHGPEFERENTKLGLMLFGLFLVILALAFAVAFIYLAVF*
Ga0068866_1072899913300005718Miscanthus RhizosphereMTEHGPEFERENTKIGLALFGLFVVLVALTFAVAFIYLAVF*
Ga0066903_10256489723300005764Tropical Forest SoilMHEHDESFERRNTRIGLALFGLFVVLLGLAFAVAFIYLAVF*
Ga0068863_10169872323300005841Switchgrass RhizosphereMPEHDESFERANMNLGFALFGLFLLLLALAFAVAFIYLAVF*
Ga0068863_10213707613300005841Switchgrass RhizosphereMTEHGPELERENTKLGLALFGLFLVLLGLAFAVAFIYLAVF*
Ga0075287_104536523300005873Rice Paddy SoilMAQHGPEFERENTKIGLALFGLFVVLVALTFAVGFIYLAVF*
Ga0081540_102127143300005983Tabebuia Heterophylla RhizosphereMAEHGPEFERENTRIGLALFGLFLVLLGLTFAVAFIYLAVF*
Ga0070712_10038564323300006175Corn, Switchgrass And Miscanthus RhizosphereMHGHDESFDRTNTKIGLAVFGLFLVLLALGFAVAFIYLAVF*
Ga0079220_1002589843300006806Agricultural SoilMHDHDESFERTNMNIGFALFGLFLVLLGLALAVAFIYLAVF*
Ga0079220_1028570113300006806Agricultural SoilMTEHGPEFERANNRLGLALFGLFLVLLGLGFAVAFIY
Ga0075436_10078282813300006914Populus RhizosphereDESFERTNMNIGFALFGLFLVLLGLAFAVAFIYLAVF*
Ga0079219_1047204023300006954Agricultural SoilMTEHGPEFERTNTRIGLALFGLFVVLVGLAFAVAFVYLAVF*
Ga0105242_1158647623300009176Miscanthus RhizosphereMHDHNESFERTNMNIGFALFGLFLVLLGLAFAVAFIYLVVF*
Ga0105248_1195487713300009177Switchgrass RhizosphereMTEHGPEFERENTKIGLALFGLFVVLVALTFGVAFIYLAIF*
Ga0105238_1226107413300009551Corn RhizosphereMTEHGPEFERENTKIGLALFGLFVVLVALTFGVAFIYLAVS*
Ga0126313_1010886023300009840Serpentine SoilMNGHHEERGNLMLGLALFGLFVLLFGLAIAAAFIYLAVF*
Ga0126312_1039698623300010041Serpentine SoilMNGHHDERGNLMLGLALFGLFLLLFGLAIAAAFIYLAVF*
Ga0126376_1073847523300010359Tropical Forest SoilMHEHDADFERTNTNIGLALFGLFVVLLGLAFAVAFIYLALS*
Ga0126372_1012127733300010360Tropical Forest SoilMTEHDESFERENTKIGLWLFALFVVLFGLVFAVGFIYLAVF*
Ga0126372_1328925633300010360Tropical Forest SoilAEHDESFERTNVNIGLALFGLFVVLVGLAFAVAFIYLAVF*
Ga0134066_1040859523300010364Grasslands SoilMAEHGPEFERENNRLGVALLALFLVLVAVFFAVAFIYLAVF*
Ga0134128_1014006243300010373Terrestrial SoilMHDHDKSFERTNMNIGFALFGLFLVLLGLAFAVAFIYLAVF*
Ga0134122_1111655913300010400Terrestrial SoilMHDHDESFERTNMNIGFALFGLFLVLLGLAFAVAFIYLA
Ga0137382_1092071913300012200Vadose Zone SoilMREHGPEFERENTRIGLALLGLFVVLVALTFAVAFIYLAVF*
Ga0157320_100957223300012481Arabidopsis RhizosphereMHDHDESFERTNMNIGFALFGLFLVLLGLAFAVAYIYLAVF*
Ga0157341_104798823300012494Arabidopsis RhizosphereMHDHNESFERTNMNIGFALFGLFLVLLGLAFAVAFIYLAVF*
Ga0157353_100661913300012496Unplanted SoilESFERTNMNIGFALFGLFLVLLGLAFAVAYIYLAVF*
Ga0157283_1010122623300012907SoilMSEHGPEFERENTRIGLALFGLFVALVALTFAVGFIYLAVF*
Ga0157308_1010211323300012910SoilMSEHGPEFERENNRLGLMLFGLFVLLLAVFFAVGFIYLAVF*
Ga0157302_1006331723300012915SoilMAEHGPEFERENNRLGLMLFGLFLVLLAVFFAVGFIYLAVF*
Ga0162652_10010602923300012941SoilMTEHGSDFERGNLNLGLGLFGLFLLLFGLTFAAAFIYLAVF*
Ga0164300_1100759113300012951SoilMSEHGPEFERENTKIGLALFGLFVVLIALTFAVAFIYLAVF*
Ga0164298_1141476813300012955SoilALMSEHGPEFESENTKIGLALFGLCVVLIALTFAVAFIYLAVF*
Ga0164299_1079828123300012958SoilMSEHGPEFERENTKIGLALFGLFVVLVALTFAVAFIYLAVF*
Ga0164299_1085838913300012958SoilMTEHGPDFERENDKLGLALFGLFVVLLGLSFAVAFIYLAVF*
Ga0164301_1070874313300012960SoilMSEHGPEFERENTRIGLALFGLFVVLVALTFAVAFIYLAVI*
Ga0164301_1132999823300012960SoilMTEHGPEFERENTKIGLALFGLFVLLVALTFGVAFIYLAVF*
Ga0164302_1111850223300012961SoilMSEHGPEFERENTRIGLALFGLFVVLVALTFGVAFIYLAVF*
Ga0164309_1151151613300012984SoilALMSEHGPEFERENTRIGLALFGLFVVLVALTFGVAFIYLAVF*
Ga0163161_1067858023300017792Switchgrass RhizosphereMTEHGPEFERENTKIGLALFGLFVVLVALTFAVAFIYLAIF
Ga0184619_1012073033300018061Groundwater SedimentMTEHDPDLERGNLTLGLALFGLFLVLFGLTFAVAFIYLALS
Ga0173482_1069083923300019361SoilMTEHGPEFERENTKLGLALFGLFLVLLGLAFAVAFIYLAVF
Ga0173479_1008988623300019362SoilMSEHGPEFERENTRIGLALFGLFVALVALTFAVGFIYLAVF
Ga0193725_105781323300019883SoilMSEHGAEFERENTRIGLALFGLFVVLVALTFAVAFIYLAVF
Ga0193727_100850123300019886SoilMSEHGSEFERENTRIGLALFGLFVVLVALTFAVAFIYLAVF
Ga0193697_100147163300020005SoilMTEHGPEFEHQNTRIGLALFGLFVVLVALTFAVAFIYLALS
Ga0193696_100134133300020016SoilMTEHGPEFERQNTRIGLALFGLFVVLVALTFAVAFIYLALS
Ga0193733_115312623300020022SoilMAEHGPEFERENNRLGLALFGLFVVLVGLAFAVAFIYLAVF
Ga0193699_1000969133300021363SoilMSEHGPEFERENTRIGLALFGLFVVLLALTFAVAFVYLAVF
Ga0182009_1013374223300021445SoilMTEHGPEFERANNRLGLALFGLFLVLLGLGFAVAFIYLAVF
Ga0222621_105381923300021510Groundwater SedimentMTEHGPEFERQNTRIGLALFGLFVVLVALTFAVGFIYLAVF
Ga0222621_114588213300021510Groundwater SedimentMTEHGPEFERHNTRIGLALFGLFVVLVALTFAVAFIYLALS
Ga0126371_1364939313300021560Tropical Forest SoilESFERENTKIGLWLFALFVVLFGLVFAVGFIYLAVF
Ga0222622_1000269873300022756Groundwater SedimentMTEHGPEFERENTKLGLALFGLFVVLVALTFAVGFIYLAVF
Ga0247745_108776523300022898SoilMAEHGPEFERENNRLGLMLFGLFVLLLAVFFAVGFIYLAVF
Ga0247693_104719223300024181SoilMHEHDESFERTNTSIGLVLFGLFVALLGLAFAVAFIYLAVF
Ga0247664_105775713300024232SoilMHDHDESFERTNMNIGFALFGLFLALLGLAFAVAFIYLAVF
Ga0247664_117782223300024232SoilMTEHGPELERENTKLGLALFGLFLVLLGLAFAVAFIYLAVF
Ga0247680_106928013300024246SoilMTEHGPEFERENTKLGLMLFGLFLVILALAFAVAFIYLAVF
Ga0179589_1016481723300024288Vadose Zone SoilMSEHGPEFERENTRIGLALFGLFVVLVALTFAVAFIYLAVF
Ga0210142_104674523300025552Natural And Restored WetlandsMSEHGPEFERENTKIGLALFGLFVVLVALTFAAGFIYLAVF
Ga0207653_1038418813300025885Corn, Switchgrass And Miscanthus RhizosphereMTEHGPEFERENTKIGLALFGLFVVLVALTFGVAFIYLAVF
Ga0207663_1020660123300025916Corn, Switchgrass And Miscanthus RhizosphereMHGHDESFDRTNTKIGLAVFGLFLVLLALGFAVAFIYLAVF
Ga0207641_1069456423300026088Switchgrass RhizosphereESFERANMNLGFALFGLFLLLLALAFAVAFIYLAVF
Ga0209153_121045723300026312SoilMAEHGPDFERRNTRLGLLLFLLFVVLVALFFVVGFVYLAIF
Ga0209177_1039296113300027775Agricultural SoilMTEHGPEFERTNTRIGLALFGLFVVLVGLAFAVAFVYL
Ga0209811_1011165323300027821Surface SoilMAEHGPDFERENDKLGLALFGLFVVLLGLSFAVAFIYLAVF
Ga0247689_101923013300028281SoilMPEHDESFERANMNLGFALFGLFLLLLALAFAVAFIYLAVF
Ga0307291_101310923300028707SoilMAEHGPEFERENNQLGLALFGLFVVLVGLAFAVAFIYLAVF
Ga0307293_1023752913300028711SoilMTEHDSDLERGNLTLGLALFGLFLVLFGLTVAVAFIYLAVF
Ga0307307_1000286523300028718SoilMAEHGPEFERENTRLGLALFGLFVVLLGLGFAVAFIYLAVF
Ga0307319_1000103543300028722SoilMTDHDPDLERGNLTLGLALFGLFLGLFALVFAVAFIYLALS
Ga0307280_1028482323300028768SoilLMTEHGPEFERENTKLGLALFGLFVVLVALTFAVGFIYLAVF
Ga0307320_1028408533300028771SoilMTEHGSDFERGNLNLGLGLFGLFLVLFGLTFAAAFIYLAVF
Ga0307288_1003449713300028778SoilEFERENNRLGLALFGLFVVLVGLAFAVAFIYLAVF
Ga0307287_1014823823300028796SoilMTDHDPDLERGNLTLGLALFGLFLGLFALVFAVAF
Ga0307305_1004961423300028807SoilMAEHGPEFERENNRLGLALFGHFVVLVGLAFAVAFIYLAVF
Ga0307294_1003584433300028810SoilMTEHGPEFERENTKLGLALFGLFVVLVALTFAVGFIYL
Ga0307292_1049877223300028811SoilMTEHGSDFERGNLNLGLALFGLFLLLFGLTFAAAFIYLAVF
Ga0307277_1039662923300028881SoilMSEHDSDPERGNLNLNLGLGLFGLFLLLFGLTFAAAFIYLAVF
Ga0307304_1016027313300028885SoilEFERENTRIGLALFGLFVVLVALTFAVAFIYLAVF
Ga0247827_1065794723300028889SoilMSEHGPEFERENTRIGLALFGLFVVLVALTFAVAFIYLAIF
Ga0268241_1000934723300030511SoilMHEHDESFERTNMNIGFALFGLFVVLLGLSFAVAFIYLAVF
Ga0308175_10001199383300031938SoilMSEHGPEFERQNTRIGLALFGLFLVLVALTFAVAFIYLAVF
Ga0308175_10013018423300031938SoilMTEHGPEFERTNNRIGLALFALFVVLVGLAFAVAFIYLAVF
Ga0308176_1002383753300031996SoilMSEHGPEFERQNTRIGLALFGLFLVLVGLTFAVAFIYLAVF
Ga0310906_1076864123300032013SoilMAEHRPDFERENDKLGLALFGLFVVLLGLSFAVAFIYLAVF
Ga0247830_1164619713300033551SoilMSEHGPEFERENTRIGLALFGLFVVLVALTFAVAFI
Ga0373948_0156441_456_5723300034817Rhizosphere SoilHDESFERTNMNIGFALFGLFLVLLGLAFAVAFIYLAVF

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.