NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F083284

Metagenome / Metatranscriptome Family F083284

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F083284
Family Type Metagenome / Metatranscriptome
Number of Sequences 113
Average Sequence Length 56 residues
Representative Sequence MSAFIITRIQVGDYETWRPMFDQDRPRAREKAKVQRVFRNVDDPNHVFVFLEFASV
Number of Associated Samples 106
Number of Associated Scaffolds 113

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 75.22 %
% of genes near scaffold ends (potentially truncated) 95.58 %
% of genes from short scaffolds (< 2000 bps) 92.92 %
Associated GOLD sequencing projects 105
AlphaFold2 3D model prediction Yes
3D model pTM-score0.68

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (93.805 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(23.894 % of family members)
Environment Ontology (ENVO) Unclassified
(26.549 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(51.327 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 16.67%    β-sheet: 28.57%    Coil/Unstructured: 54.76%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.68
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 113 Family Scaffolds
PF12697Abhydrolase_6 9.73
PF08447PAS_3 3.54
PF08241Methyltransf_11 2.65
PF07883Cupin_2 2.65
PF00440TetR_N 1.77
PF00005ABC_tran 1.77
PF13649Methyltransf_25 1.77
PF01370Epimerase 1.77
PF12847Methyltransf_18 0.88
PF02502LacAB_rpiB 0.88
PF00196GerE 0.88
PF02621VitK2_biosynth 0.88
PF00027cNMP_binding 0.88
PF13565HTH_32 0.88
PF05742TANGO2 0.88
PF13744HTH_37 0.88
PF00589Phage_integrase 0.88
PF05694SBP56 0.88
PF00144Beta-lactamase 0.88
PF00248Aldo_ket_red 0.88
PF13358DDE_3 0.88
PF02659Mntp 0.88
PF13599Pentapeptide_4 0.88
PF12840HTH_20 0.88
PF07690MFS_1 0.88
PF01070FMN_dh 0.88
PF13669Glyoxalase_4 0.88
PF13365Trypsin_2 0.88
PF01810LysE 0.88
PF10294Methyltransf_16 0.88
PF00702Hydrolase 0.88
PF00459Inositol_P 0.88

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 113 Family Scaffolds
COG0069Glutamate synthase domain 2Amino acid transport and metabolism [E] 0.88
COG0698Ribose 5-phosphate isomerase RpiBCarbohydrate transport and metabolism [G] 0.88
COG1304FMN-dependent dehydrogenase, includes L-lactate dehydrogenase and type II isopentenyl diphosphate isomeraseEnergy production and conversion [C] 0.88
COG1427Chorismate dehydratase (menaquinone biosynthesis, futalosine pathway)Coenzyme transport and metabolism [H] 0.88
COG1680CubicO group peptidase, beta-lactamase class C familyDefense mechanisms [V] 0.88
COG1686D-alanyl-D-alanine carboxypeptidaseCell wall/membrane/envelope biogenesis [M] 0.88
COG1971Putative Mn2+ efflux pump MntPInorganic ion transport and metabolism [P] 0.88
COG2367Beta-lactamase class ADefense mechanisms [V] 0.88
COG3332Uncharacterized stress-responsive protein, TANGO2 (Transport and Golgi organisation 2) family, contains NRDE motifGeneral function prediction only [R] 0.88


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms93.81 %
UnclassifiedrootN/A6.19 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2199352025|deepsgr__Contig_61891All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2421Open in IMG/M
3300000880|AL20A1W_1141974All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium1399Open in IMG/M
3300001536|A1565W1_10020547All Organisms → cellular organisms → Bacteria → Terrabacteria group873Open in IMG/M
3300001978|JGI24747J21853_1050920All Organisms → cellular organisms → Bacteria505Open in IMG/M
3300003453|ERB_1011669All Organisms → cellular organisms → Bacteria2841Open in IMG/M
3300004081|Ga0063454_100687960All Organisms → cellular organisms → Bacteria → Terrabacteria group767Open in IMG/M
3300004153|Ga0063455_101043313All Organisms → cellular organisms → Bacteria597Open in IMG/M
3300004479|Ga0062595_102405305Not Available522Open in IMG/M
3300004643|Ga0062591_101081597All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria770Open in IMG/M
3300004801|Ga0058860_12230276All Organisms → cellular organisms → Bacteria1037Open in IMG/M
3300004808|Ga0062381_10052486All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1162Open in IMG/M
3300005176|Ga0066679_10160878All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1412Open in IMG/M
3300005177|Ga0066690_10296820All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1091Open in IMG/M
3300005181|Ga0066678_10246772All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales1154Open in IMG/M
3300005181|Ga0066678_10281930All Organisms → cellular organisms → Bacteria1083Open in IMG/M
3300005205|Ga0068999_10133573Not Available516Open in IMG/M
3300005335|Ga0070666_10454524All Organisms → cellular organisms → Bacteria925Open in IMG/M
3300005434|Ga0070709_10014569All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria4449Open in IMG/M
3300005438|Ga0070701_10574028All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia743Open in IMG/M
3300005447|Ga0066689_10724705All Organisms → cellular organisms → Bacteria621Open in IMG/M
3300005536|Ga0070697_101156620All Organisms → cellular organisms → Bacteria689Open in IMG/M
3300005542|Ga0070732_10940067All Organisms → cellular organisms → Bacteria → Terrabacteria group528Open in IMG/M
3300005545|Ga0070695_101155842All Organisms → cellular organisms → Bacteria → Terrabacteria group635Open in IMG/M
3300005546|Ga0070696_101094605All Organisms → cellular organisms → Bacteria669Open in IMG/M
3300005556|Ga0066707_10389388All Organisms → cellular organisms → Bacteria → Terrabacteria group908Open in IMG/M
3300005556|Ga0066707_10834584All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria568Open in IMG/M
3300006034|Ga0066656_10170701All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1371Open in IMG/M
3300006034|Ga0066656_10346517All Organisms → cellular organisms → Bacteria → Terrabacteria group960Open in IMG/M
3300006163|Ga0070715_11041987All Organisms → cellular organisms → Bacteria → Terrabacteria group512Open in IMG/M
3300006175|Ga0070712_101526175All Organisms → cellular organisms → Bacteria → Terrabacteria group584Open in IMG/M
3300006791|Ga0066653_10746846All Organisms → cellular organisms → Bacteria → Terrabacteria group510Open in IMG/M
3300006845|Ga0075421_101666124All Organisms → cellular organisms → Bacteria → Terrabacteria group691Open in IMG/M
3300009012|Ga0066710_104671240All Organisms → cellular organisms → Bacteria → Terrabacteria group512Open in IMG/M
3300009089|Ga0099828_10349595All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1332Open in IMG/M
3300009094|Ga0111539_12182606All Organisms → cellular organisms → Bacteria → Terrabacteria group642Open in IMG/M
3300009147|Ga0114129_11123716All Organisms → cellular organisms → Bacteria982Open in IMG/M
3300009176|Ga0105242_11717899All Organisms → cellular organisms → Bacteria → Terrabacteria group664Open in IMG/M
3300009545|Ga0105237_11374119All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia713Open in IMG/M
3300010147|Ga0126319_1172860All Organisms → cellular organisms → Bacteria1061Open in IMG/M
3300010322|Ga0134084_10133494All Organisms → cellular organisms → Bacteria → Terrabacteria group821Open in IMG/M
3300010362|Ga0126377_10867547All Organisms → cellular organisms → Bacteria → Terrabacteria group964Open in IMG/M
3300010375|Ga0105239_10300625All Organisms → cellular organisms → Bacteria1807Open in IMG/M
3300010379|Ga0136449_104123133All Organisms → cellular organisms → Bacteria → Terrabacteria group540Open in IMG/M
3300010401|Ga0134121_11104314All Organisms → cellular organisms → Bacteria786Open in IMG/M
3300010403|Ga0134123_11727022All Organisms → cellular organisms → Bacteria → Terrabacteria group677Open in IMG/M
3300011119|Ga0105246_11714531All Organisms → cellular organisms → Bacteria → Terrabacteria group597Open in IMG/M
3300011269|Ga0137392_10732184All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium818Open in IMG/M
3300012008|Ga0120174_1071012All Organisms → cellular organisms → Bacteria → Terrabacteria group909Open in IMG/M
3300012198|Ga0137364_11327312All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria535Open in IMG/M
3300012208|Ga0137376_11581249All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium547Open in IMG/M
3300012210|Ga0137378_10567816All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1043Open in IMG/M
3300012363|Ga0137390_11870301All Organisms → cellular organisms → Bacteria → Terrabacteria group530Open in IMG/M
3300012469|Ga0150984_122673203All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces kanamyceticus547Open in IMG/M
3300012914|Ga0157297_10402077All Organisms → cellular organisms → Bacteria → Terrabacteria group549Open in IMG/M
3300012958|Ga0164299_10221649All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1109Open in IMG/M
3300012977|Ga0134087_10448883All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium638Open in IMG/M
3300012986|Ga0164304_10872809All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria701Open in IMG/M
3300012989|Ga0164305_10359932All Organisms → cellular organisms → Bacteria → Terrabacteria group1099Open in IMG/M
3300013296|Ga0157374_10964041All Organisms → cellular organisms → Bacteria872Open in IMG/M
3300013296|Ga0157374_11024581All Organisms → cellular organisms → Bacteria → Terrabacteria group845Open in IMG/M
3300013308|Ga0157375_12372404All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia633Open in IMG/M
3300013766|Ga0120181_1137554All Organisms → cellular organisms → Bacteria → Terrabacteria group532Open in IMG/M
3300013768|Ga0120155_1140087All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium659Open in IMG/M
3300013770|Ga0120123_1010541All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1774Open in IMG/M
3300014295|Ga0075305_1082649Not Available629Open in IMG/M
3300014827|Ga0120171_1085923All Organisms → cellular organisms → Bacteria826Open in IMG/M
3300017654|Ga0134069_1164822All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia745Open in IMG/M
3300017792|Ga0163161_10485460All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1004Open in IMG/M
3300018051|Ga0184620_10187327All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria683Open in IMG/M
3300018429|Ga0190272_12402163All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales571Open in IMG/M
3300018432|Ga0190275_13313278All Organisms → cellular organisms → Bacteria → Terrabacteria group521Open in IMG/M
3300018468|Ga0066662_12665099All Organisms → cellular organisms → Bacteria → Terrabacteria group529Open in IMG/M
3300019867|Ga0193704_1048728All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria832Open in IMG/M
3300020005|Ga0193697_1044404All Organisms → cellular organisms → Bacteria1108Open in IMG/M
3300020022|Ga0193733_1053582All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1138Open in IMG/M
3300021078|Ga0210381_10114232All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria889Open in IMG/M
3300021078|Ga0210381_10294311All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria585Open in IMG/M
3300021080|Ga0210382_10570958All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium501Open in IMG/M
3300022694|Ga0222623_10233067All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria712Open in IMG/M
3300024330|Ga0137417_1397249All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria5142Open in IMG/M
3300025581|Ga0208355_1045799All Organisms → cellular organisms → Bacteria → Terrabacteria group1096Open in IMG/M
3300025903|Ga0207680_10946984Not Available617Open in IMG/M
3300025913|Ga0207695_11174801All Organisms → cellular organisms → Bacteria → Terrabacteria group647Open in IMG/M
3300025928|Ga0207700_10243261Not Available1534Open in IMG/M
3300026041|Ga0207639_11978983All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia544Open in IMG/M
3300026067|Ga0207678_11325966All Organisms → cellular organisms → Bacteria → Terrabacteria group637Open in IMG/M
3300026078|Ga0207702_12263745Not Available532Open in IMG/M
3300027379|Ga0209842_1068004All Organisms → cellular organisms → Bacteria629Open in IMG/M
3300028589|Ga0247818_10743867All Organisms → cellular organisms → Bacteria682Open in IMG/M
3300028710|Ga0307322_10011792All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces1943Open in IMG/M
3300028713|Ga0307303_10178286All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria520Open in IMG/M
3300028714|Ga0307309_10076560All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria768Open in IMG/M
3300028716|Ga0307311_10237913All Organisms → cellular organisms → Bacteria → Terrabacteria group539Open in IMG/M
3300028720|Ga0307317_10209518All Organisms → cellular organisms → Bacteria → Terrabacteria group657Open in IMG/M
3300028722|Ga0307319_10324564All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria510Open in IMG/M
3300028791|Ga0307290_10204268All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria724Open in IMG/M
3300028791|Ga0307290_10338956All Organisms → cellular organisms → Bacteria → Terrabacteria group550Open in IMG/M
3300028796|Ga0307287_10001331All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria8237Open in IMG/M
3300028799|Ga0307284_10002553All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales4801Open in IMG/M
3300028814|Ga0307302_10646436All Organisms → cellular organisms → Bacteria → Terrabacteria group526Open in IMG/M
3300028875|Ga0307289_10002343All Organisms → cellular organisms → Bacteria7799Open in IMG/M
3300028876|Ga0307286_10382997All Organisms → cellular organisms → Bacteria → Terrabacteria group526Open in IMG/M
3300028878|Ga0307278_10420243All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Kineosporiales → Kineosporiaceae → Angustibacter → unclassified Angustibacter → Angustibacter sp. Root456587Open in IMG/M
3300031096|Ga0308193_1056035All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria602Open in IMG/M
3300031200|Ga0307496_10078615All Organisms → cellular organisms → Bacteria609Open in IMG/M
3300031228|Ga0299914_11302735All Organisms → cellular organisms → Bacteria → Terrabacteria group576Open in IMG/M
3300031716|Ga0310813_10017761All Organisms → cellular organisms → Bacteria4792Open in IMG/M
3300031912|Ga0306921_11286307All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria810Open in IMG/M
3300032001|Ga0306922_11254068Not Available752Open in IMG/M
3300032001|Ga0306922_11601804All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria648Open in IMG/M
3300032179|Ga0310889_10059511All Organisms → cellular organisms → Bacteria → Terrabacteria group1521Open in IMG/M
3300032261|Ga0306920_100723714All Organisms → cellular organisms → Bacteria1465Open in IMG/M
3300034681|Ga0370546_025655All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria809Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil23.89%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil8.85%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere7.08%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil6.19%
PermafrostEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost6.19%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil3.54%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment2.65%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil2.65%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere2.65%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere2.65%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere2.65%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.77%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil1.77%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil1.77%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil1.77%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil1.77%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere1.77%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.77%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere1.77%
Wetland SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment0.89%
SoilEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil0.89%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands0.89%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.89%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.89%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.89%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil0.89%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil0.89%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil0.89%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil0.89%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil0.89%
Natural And Restored WetlandsEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands0.89%
Groundwater SandEnvironmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand0.89%
Volcano-Associated FumaroleEnvironmental → Terrestrial → Volcanic → Fumaroles → Unclassified → Volcano-Associated Fumarole0.89%
Host-AssociatedHost-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated0.89%
Corn, Switchgrass And Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.89%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.89%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.89%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere0.89%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2199352025Soil microbial communities from Rothamsted, UK, for project Deep Soil - DEEP SOILEnvironmentalOpen in IMG/M
3300000880Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A35-65cm-20A)- 1 week illuminaEnvironmentalOpen in IMG/M
3300001536Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A15-65cm-8A)- 1 week illuminaEnvironmentalOpen in IMG/M
3300001978Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6Host-AssociatedOpen in IMG/M
3300003453Combined Assembly of Gp0111477, Gp0111476EnvironmentalOpen in IMG/M
3300004081Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2)EnvironmentalOpen in IMG/M
3300004153Grasslands soil microbial communities from Hopland, California, USA (version 2)EnvironmentalOpen in IMG/M
3300004479Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAsEnvironmentalOpen in IMG/M
3300004643Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3EnvironmentalOpen in IMG/M
3300004801Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300004808Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare1FreshEnvironmentalOpen in IMG/M
3300005176Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128EnvironmentalOpen in IMG/M
3300005177Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139EnvironmentalOpen in IMG/M
3300005181Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127EnvironmentalOpen in IMG/M
3300005205Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleC_D2EnvironmentalOpen in IMG/M
3300005335Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaGHost-AssociatedOpen in IMG/M
3300005434Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaGEnvironmentalOpen in IMG/M
3300005438Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaGEnvironmentalOpen in IMG/M
3300005447Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138EnvironmentalOpen in IMG/M
3300005536Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaGEnvironmentalOpen in IMG/M
3300005542Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1EnvironmentalOpen in IMG/M
3300005545Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaGEnvironmentalOpen in IMG/M
3300005546Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaGEnvironmentalOpen in IMG/M
3300005556Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156EnvironmentalOpen in IMG/M
3300006034Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105EnvironmentalOpen in IMG/M
3300006163Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaGEnvironmentalOpen in IMG/M
3300006175Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaGEnvironmentalOpen in IMG/M
3300006791Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102EnvironmentalOpen in IMG/M
3300006845Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5Host-AssociatedOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009089Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaGEnvironmentalOpen in IMG/M
3300009094Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009147Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)Host-AssociatedOpen in IMG/M
3300009176Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaGHost-AssociatedOpen in IMG/M
3300009545Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaGHost-AssociatedOpen in IMG/M
3300010147Soil microbial communities from California, USA to study soil gas exchange rates - BB-CA-RED metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010322Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010375Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaGHost-AssociatedOpen in IMG/M
3300010379Sb_50d combined assemblyEnvironmentalOpen in IMG/M
3300010401Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1EnvironmentalOpen in IMG/M
3300010403Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3EnvironmentalOpen in IMG/M
3300011119Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaGHost-AssociatedOpen in IMG/M
3300011269Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaGEnvironmentalOpen in IMG/M
3300012008Permafrost microbial communities from Nunavut, Canada - A39_80cm_12MEnvironmentalOpen in IMG/M
3300012198Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012208Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012210Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012363Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaGEnvironmentalOpen in IMG/M
3300012469Combined assembly of Soil carbon rhizosphereHost-AssociatedOpen in IMG/M
3300012914Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S028-104C-2EnvironmentalOpen in IMG/M
3300012958Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MGEnvironmentalOpen in IMG/M
3300012977Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300012986Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MGEnvironmentalOpen in IMG/M
3300012989Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MGEnvironmentalOpen in IMG/M
3300013296Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaGHost-AssociatedOpen in IMG/M
3300013308Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaGHost-AssociatedOpen in IMG/M
3300013766Permafrost microbial communities from Nunavut, Canada - A26_65cm_6MEnvironmentalOpen in IMG/M
3300013768Permafrost microbial communities from Nunavut, Canada - A35_65cm_0MEnvironmentalOpen in IMG/M
3300013770Permafrost microbial communities from Nunavut, Canada - A15_5cm_18MEnvironmentalOpen in IMG/M
3300014295Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Joice_CattailNLB_D1EnvironmentalOpen in IMG/M
3300014827Permafrost microbial communities from Nunavut, Canada - A3_80cm_18MEnvironmentalOpen in IMG/M
3300017654Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300017792Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaGHost-AssociatedOpen in IMG/M
3300018051Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_b1EnvironmentalOpen in IMG/M
3300018429Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 TEnvironmentalOpen in IMG/M
3300018432Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 550 TEnvironmentalOpen in IMG/M
3300018468Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111EnvironmentalOpen in IMG/M
3300019867Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3m1EnvironmentalOpen in IMG/M
3300020005Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3m2EnvironmentalOpen in IMG/M
3300020022Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1s2EnvironmentalOpen in IMG/M
3300021078Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_coex redoEnvironmentalOpen in IMG/M
3300021080Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redoEnvironmentalOpen in IMG/M
3300022694Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_coexEnvironmentalOpen in IMG/M
3300024330Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300025581Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-3 deep-072012 (SPAdes)EnvironmentalOpen in IMG/M
3300025903Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025913Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025928Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026041Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026067Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026078Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300027379Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_10_20 (SPAdes)EnvironmentalOpen in IMG/M
3300028589Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glucose_Day1EnvironmentalOpen in IMG/M
3300028710Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_380EnvironmentalOpen in IMG/M
3300028713Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_184EnvironmentalOpen in IMG/M
3300028714Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_196EnvironmentalOpen in IMG/M
3300028716Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_198EnvironmentalOpen in IMG/M
3300028720Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_357EnvironmentalOpen in IMG/M
3300028722Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_368EnvironmentalOpen in IMG/M
3300028791Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_144EnvironmentalOpen in IMG/M
3300028796Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_141EnvironmentalOpen in IMG/M
3300028799Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_123EnvironmentalOpen in IMG/M
3300028814Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183EnvironmentalOpen in IMG/M
3300028875Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_143EnvironmentalOpen in IMG/M
3300028876Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_140EnvironmentalOpen in IMG/M
3300028878Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117EnvironmentalOpen in IMG/M
3300031096Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_194 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031200Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 9_SEnvironmentalOpen in IMG/M
3300031228Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT153D57EnvironmentalOpen in IMG/M
3300031716Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3EnvironmentalOpen in IMG/M
3300031912Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2)EnvironmentalOpen in IMG/M
3300032001Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2)EnvironmentalOpen in IMG/M
3300032179Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D2EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M
3300034681Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_121 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
deepsgr_007813902199352025SoilMSAFIITRIQTGDYETWRPMFDQDRPLAREKATRQRIFRKVDDPNHVFIFLEFGSVADAEEARGRLEG
AL20A1W_114197423300000880PermafrostMSAFIITRIQTGDYDRWRRMFDQDLPRAREKALLQRVLRSTDDPNEVFIYL
A1565W1_1002054723300001536PermafrostMSAFIITRIQVGDYDTWRPMFDQDRPHAREKAKVQRVFRSVDDPNHVFILLEFASVEDAQEGQRRL
JGI24747J21853_105092013300001978Corn, Switchgrass And Miscanthus RhizosphereMAAFIITRIQTGDYERWRPMFDQDRPLAREKATRQRIFRKVDDPNHVFLLLEFDSVADAEEARGRLEES
ERB_101166913300003453Volcano-Associated FumaroleMATYIITRIQTGDYDKWRPMFDQDRPRAREKAQTQRVLRSVDDPNEVFNLPRVRKP*
Ga0063454_10068796013300004081SoilVTAFIITRIHVGDYDAWRPMFDQDRPRAREAAKVQRVFRGADDPDHVFILLEFDSLEDARTAEQR
Ga0063455_10104331313300004153SoilVPAFIITRIQTGDYETWRPMFDQDRPLARAKATRQRIFRKVDDPNDVFVYLEFDSV
Ga0062595_10240530523300004479SoilMSAFIITRIHVGDYDAWRPMFDQDRPRAREKARVQRVFRNVDDPNHVFIFLEFAS
Ga0062591_10108159723300004643SoilMPAFIITRIHVGDYDAWRPMFDQDRPLAREKAKVQRVFRNVDDPNHVFVFLEFESVEEAQEA
Ga0058860_1223027613300004801Host-AssociatedMAAFIITRIQTGDYERWRPMFDQDRPLAREKATRQRIFRKVDDPNHV
Ga0062381_1005248633300004808Wetland SedimentMSAFIITRIQVGDYDAWRPMFDQDRPQAREKARVQSVFRGIDDPNHVFIFLEFDSVEDAREAQQRLLAS
Ga0066679_1016087813300005176SoilMSAFIITRIHVGDYDAWRPMFEQDRPQAREKARVQRIFRNVDDPNH
Ga0066690_1029682023300005177SoilVSAYIITRIQVGDYDSWRPMFDQDRPRAREDAISRRVFQTADDPNHVFIFLEFESLE
Ga0066678_1024677213300005181SoilVSVPAFIITRIQVGDYDAWRPMFDQDRPQAREKATVQRVFRAADDADHVFVFLEFP
Ga0066678_1028193033300005181SoilVSAFIITRIQVGDYDSWRPMFDQDRPRAREKAIVQRVFRSADDRDHVFIFLEFAS
Ga0068999_1013357313300005205Natural And Restored WetlandsMPAFIITRIHVGDYEAWRPMFDQDQPRAREKATLQRVYRGVDDPNH
Ga0070666_1045452413300005335Switchgrass RhizosphereMAAFIITRIQTGDYERWRPMFDQDRPLAREKATRQRIFRKVDDPNHVFLLLEF
Ga0070709_1001456973300005434Corn, Switchgrass And Miscanthus RhizosphereVAGFIITRIHVGDYDAWRPMFEQDRPRAREQATVQRVFRDADDPNH
Ga0070701_1057402823300005438Corn, Switchgrass And Miscanthus RhizosphereMSAFIITRIHVGDYETWRRLYDQDVPRARENATLQRVLRMVDDPNHVFVYLEFASRD
Ga0066689_1072470513300005447SoilVSAFVITRIHVGDYDTWRPRFDQDLPRAREKAKVQRVFRKVDDPNHVFVFLEFDSVEDAQEAERR
Ga0070697_10115662023300005536Corn, Switchgrass And Miscanthus RhizosphereMSAFIITRIQVGDYDAWRPMFDQDRPQAREKATVQRVFRDVDDPNQVFI
Ga0070732_1094006723300005542Surface SoilMSAVIITRIQTRDYDTWRPMFDQDRPRAREKATSQRVFRNTDDPNMVFIQLEFDSNDD
Ga0070695_10115584223300005545Corn, Switchgrass And Miscanthus RhizosphereMAAFIITRIHVGDYDAWRPMFDQDRPSAREKAKVQRIFRNVDDPNHVFIFLEF
Ga0070696_10109460513300005546Corn, Switchgrass And Miscanthus RhizosphereMAAFIITRIQTGDYDTWRPMFDQDRPLARAKATRQRIFRKVDDPNHVFVFLEFDSVADAQ
Ga0066707_1038938813300005556SoilMAAFIITRIHVGDYDAWRPMFDQDRPRAREKAKVQRIFRNVDDPNHVFIFLEFESIDD
Ga0066707_1083458423300005556SoilMSTFIITRIQVGDYDTWRRMFEQDRPQAREKATVQRIFRKVEDPNHVFVFLEF
Ga0066656_1017070143300006034SoilMSAFIITRIHVGDYDTWRPMFDQDRPQARKKAKVQRVFRNVDDPNHVFVFLEFGSLEEAEEAQRR
Ga0066656_1034651713300006034SoilMAAFIITRIHVGDYDAWRPMFDQDRPRAREKAKVQRIFRNVDDPNHIFIFLEFESIDDANEARHRLVESGV
Ga0070715_1104198723300006163Corn, Switchgrass And Miscanthus RhizosphereVAGFIITRIHVGDYDAWRPMFEQDRPRAREQATVQRVFRDADDPNHVFIFLEFESLE
Ga0070712_10152617513300006175Corn, Switchgrass And Miscanthus RhizosphereMSAFIITRIQTGDYEKWRPMFDQDRPRAREKATLERVLRSTDDPDEVFIYLEFES
Ga0066653_1074684613300006791SoilVAAFIITRIQTGDYDTWRPMFDQDKPGTRENALVQRVLRSVNDPDEVF
Ga0075421_10166612413300006845Populus RhizosphereMAAFIITRIQVGDYDTWRQMFDQDRPQAREKATVKRVFRGLHDPNEVFIFLE
Ga0066710_10467124013300009012Grasslands SoilMSAFIITSIQVGDYDTWRAMFDQDRPGARERAQTQRVFRAVDDPNH
Ga0099828_1034959513300009089Vadose Zone SoilMSAFIITRIQVGDYDAWRPMFEQDRPQAREKAKVQRVFRKVDDPNHVFVFLEFASVDDAEEARQRLVESGV
Ga0111539_1218260623300009094Populus RhizosphereMSAFIITRIQVGDYDTWRALYDRDVPRARENATAQRVFRRVDDPNHVFVFLEFASVEDA
Ga0114129_1112371633300009147Populus RhizosphereMSAFIITRIHVGDYDTWRPMFDQDRPKAREHAKVQRILRSVDDPNHVFIYLEFA
Ga0105242_1171789913300009176Miscanthus RhizosphereMSAFIITRIHVRDYETWRRLYDQDVPRARENATLQRVLRMVDDPNHVFVYLE
Ga0105237_1137411923300009545Corn RhizosphereMSAFIITRIHVGDYETWRRLYDQDVPRARENATLQRVLRMVDDPNHVFVYLEFASRDDAE
Ga0126319_117286013300010147SoilMAAFIITRIQTGDYETWRPMFDQDRPLARAKATRQRVFRKVDDPNHVFLFLEFD
Ga0134084_1013349413300010322Grasslands SoilMPAFIITRIQVGDYDAWRPMFDQDRPRAREKATVQRVFRGVDDP
Ga0126377_1086754713300010362Tropical Forest SoilMGAFIITRIQVGDYDAWRPMFDQDRPRARERAKVQRVFRDVDDPSQVFIVLEFESVVDAQEAQRR
Ga0105239_1030062513300010375Corn RhizosphereMAASIITRIQVGDYDTWRALFDKDVPRAREKATAVRVLRTVDDPNHVFVYLDFASVA
Ga0136449_10412313323300010379Peatlands SoilMPAFIITRIQTGDYDRWRPMFDQDQPRAREKAQVQRVLRSVDDP
Ga0134121_1110431423300010401Terrestrial SoilMAAFIITRIQTGDYERWRPMFDQDRPLAREKATRQRIFRKVDDPNHVF
Ga0134123_1172702213300010403Terrestrial SoilMSAFIITRIQVGDYDTWRPLYDRDVPRARENATAQRVFRRVDDPNHVF
Ga0105246_1171453113300011119Miscanthus RhizosphereMSAFIITRIQVGDYDTWRALYDRDVPRARENATAQRVFRRVDDPNHVFVFLE
Ga0137392_1073218413300011269Vadose Zone SoilMSAFIITRIHVGDYDAWRPMFDQDRPQAREKASVQRIFRNVDDPNHVFVF
Ga0120174_107101223300012008PermafrostMPAFVITRIQTGDYETWRPMFDQDRPGAREKATAQRVFQSVDDPNHVFILLEFSSVDDANGGARSPREVGCARPLRGQAR
Ga0137364_1132731233300012198Vadose Zone SoilMSAFIITRIHVGDYDAWRPMFDQDRPQARDKATVQRVFRDADDADHVFVFLEFPSLEDAREAK
Ga0137376_1158124913300012208Vadose Zone SoilVSAYIITRIQVGDYETWRPMFDQDRPRAREGAISQRVFRTADDPNHVF
Ga0137378_1056781613300012210Vadose Zone SoilVPGFIITRIQTGNYDVWRPMFDQDRPRAREKATTQRVLRSVDDPNEVFIFLEF
Ga0137390_1187030113300012363Vadose Zone SoilMSAFIITRIQVGDYDTWRAMFDQDRPRAREKAKAQRVFRGVDDPNHVFIQLDFDSVEEANEAKRRL
Ga0150984_12267320323300012469Avena Fatua RhizosphereMAAFIITRIQTGDYETWRPMFDQDRPLAREKATRQRIFRKVDDP
Ga0157297_1040207723300012914SoilMSAFIITRIQVGDYDTWRALYDRDVPRARESATAQRVFRRVDDP
Ga0164299_1022164933300012958SoilMSAFIITRIHVGDYDRWRPMFEQDRPLAREKAKVQRIFRDVDDPNHVFVFLEFESTEDA
Ga0134087_1044888313300012977Grasslands SoilVAGFIITRIHVVDYDTWRPMFDQDRPRAREHATVQRVFRDADDPNHVFIYLEFPTL
Ga0164304_1087280913300012986SoilMPAFIITRIHVGDYDTWRPMFDQDRPLAREKAKVQRVFRNVDDPDHVFVFL
Ga0164305_1035993213300012989SoilMSAFIITRIDVGDYDAWRPMFDQDRPRAREKATTQRVFRGVDEPNQ
Ga0157374_1096404123300013296Miscanthus RhizosphereMAAFIITRIQTGDYERWRPMFDQDRPLAREKATRQRIFRKVDDPNHVFLLLEFDSVADAE
Ga0157374_1102458123300013296Miscanthus RhizosphereMTAFIITRIQTGDYEKWRPMFDQDRPRTREKARVQRVLRNTDDPDEMFIYLEYE
Ga0157375_1237240423300013308Miscanthus RhizosphereMSAFIITRIHVGDYETWRRLYDQDVPRARENATLQRVLRMVDDPNHVFVYLEFAS
Ga0120181_113755413300013766PermafrostMSAFIITRIQVGDYDTWRPMFDQDRPHAREKAKVQRVFRSVDDPNHVFILLEFASVEDAQEG
Ga0120155_114008713300013768PermafrostMPAFVITRIQTGDYETWRPMFDQDRPGAREKATAQRVFQSVDDPNHVFI
Ga0120123_101054113300013770PermafrostMSAFIITRIQVGDYDTWRPMFDQDRPQAREKATAQRVFRKADDPN
Ga0075305_108264913300014295Natural And Restored WetlandsMAAFIVTRIQVGDYDAWRPMFDQDHPRAREKAKTQRVFRSVDDPNHVFILLEFTSAEDADEARTRL
Ga0120171_108592313300014827PermafrostMSAFIITRIHVGDYEAWRGTFDQDRPGAREKATAVQVFRGADDPGQVFIVLKFASLDDANESRRRLL
Ga0134069_116482223300017654Grasslands SoilVSAFIITRIQVGDYDAWRPMFDQDRPRAREKAKVQRIFRNVDDPNHVFIL
Ga0163161_1048546043300017792Switchgrass RhizosphereMSAFIITRIQVGDYDTWRPLYDRDVPRARENATAQRVFRRVDDPNHVFVF
Ga0184620_1018732713300018051Groundwater SedimentMSAFIITRIQVGDYDTWRQMFDQDQPRAREQAKVKRVFRNVDDPNHVFIFLEFESLDDANESRRRLLES
Ga0190272_1240216313300018429SoilVSAFIITRIQTGDYDTWRRMFDQDRPQAREKASVKRVFRDVDDPNHV
Ga0190275_1331327823300018432SoilMSAFIITRIQTGDYDTWRPMFDQDRPQARAKATVQRVLRSVDDPNEVFIFLEF
Ga0066662_1266509913300018468Grasslands SoilVSAFIVTRIHVGDYEAWRPMFDQDRPAAREKAKAQRVFRNVDDPNHVFIFLEFASLEDANEARRRL
Ga0193704_104872813300019867SoilMSGFIITRIQTGDYDTWRPMFDQDRPGAREQATAQRVFRRVDDPNHVFVFLEFDSLDDAKEAER
Ga0193697_104440413300020005SoilMAAFIITRIQTGDYDTWRPMFDQDRPLARAKATRQRIFRKVDDPNHVFVL
Ga0193733_105358233300020022SoilMSAFIITRIHVGDYDRWRPMFEQDRPQARETAKVQRIFRDVDDPNHVFIFLEFESTEDAR
Ga0210381_1011423213300021078Groundwater SedimentMSAFIITRIRVGDYDTWRPMFDQDRPQAREKAKVQRVFRNVDDPNHVFVLLEFASVEDAQEARGRLLESG
Ga0210381_1029431113300021078Groundwater SedimentMSGFIITRIQTGDYDTWRPMFDQDRPGAREQATAQRVFRRVDDPNHVFVFLEFDSLDDAKEAERRLLDS
Ga0210382_1057095823300021080Groundwater SedimentMSAFIITRIQVGDYETWRPMFDQDRPRAREKAKVQRVFRNVDDPNHVFVFLEFASV
Ga0222623_1023306713300022694Groundwater SedimentMSGFIITRIQTGDYDTWRPMFDQDRPGAREQATAQRVFRRVDDPNHVFVFLEFDSIDDAKEAERRLLDSGV
Ga0137417_1397249103300024330Vadose Zone SoilMSRSSYPDPGGDYDTWRPMFDQDRPRAREKAKVQRVFRSVDDPNHVFIFLEFASLVALEESLR
Ga0208355_104579943300025581Arctic Peat SoilVAAFIITRIQTGDYDKWRPMFDQDQPRAREKAQVQRVLQSVDDP
Ga0207680_1094698413300025903Switchgrass RhizosphereMAAFIITRIQTGDYERWRPMFDQDRPLAREKATRQRIFRKVDDPNHVFLLLEFDSVADADEAPFEYVRP
Ga0207695_1117480113300025913Corn RhizosphereMSAFIITRIQVGDYDSWRPMFDQDRPGAREKATVQRVFRDVDDPNHVFVFLEFDSADDANEARGRL
Ga0207700_1024326153300025928Corn, Switchgrass And Miscanthus RhizosphereMTAFIITRIQTGDYEKWRPMFDQDRPRTREKARVERVLRNTDDP
Ga0207639_1197898313300026041Corn RhizosphereMSAWIITRIQTGDYDRWRPQYDQDQPHTREKAIVQRVLRSVDDP
Ga0207678_1132596613300026067Corn RhizosphereMSAFIITRIQVGDYSSWRSMFDQDRPRAREKAQVQRVFRGVDDPNHVFIFLEF
Ga0207702_1226374513300026078Corn RhizosphereVSAFIVTRIHVGDYEAWRPLFDQDRPRAREQASVQRVLRDVDDPNHVFIYLEFA
Ga0209842_106800413300027379Groundwater SandMSAFIITRLHVGDYDTWRPMFDQDHPRAREKAKVQRVFRKVDDPDHVFIFLEFDSVEDAQ
Ga0247818_1074386723300028589SoilMAASIITRIQVGDYDTWRALFDKDVPRAREKATAVRVLRTVDDPNHVFV
Ga0307322_1001179233300028710SoilMAAFIITRIQTGDYGTWRPMFDQDRPLARAKAMRQRVFRKVDDPNHVFVFLEFDSVAN
Ga0307303_1017828613300028713SoilMSAFIITRIQTGDYDTWRPLFDQDRPRARAKATAQRVLRGVDDPN
Ga0307309_1007656013300028714SoilMSAFIITRIQTGDYDRWRPMFDQDKPRARENAVIQRVLRSVDDPNEVFIY
Ga0307311_1023791323300028716SoilMSAFIITRIRVGDYGTWRPMFEQDRPQAREKAKVQRIFRDVDDPNHVFIFLEFESTENAREAQSRL
Ga0307317_1020951823300028720SoilMSAFIMTRIHVGDYDRWRPMFEQDRPLAREKAKVQRIFRDVDDPNHVFIFLEFESTEDAREAQSRL
Ga0307319_1032456423300028722SoilMSGFIITRIQTGDYDTWRPMFDQDRPGAREQATAQRVFRRVDDPNHVFVFLEFDSLDDAKEAERRLLDSG
Ga0307290_1020426813300028791SoilMSGFIITRIQTGDYDTWRPMFDQDRPGAREQATAQRVFRTVDDPNHVFVFLEFDS
Ga0307290_1033895623300028791SoilMSAFIITRIRVGDYGTWRPMFEQDRPQAREKAKVQRIFRDVDDPNHVFIFLEFESTEDAREA
Ga0307287_1000133153300028796SoilMSAFIITRIRVGDYDTWRPMFDQDRPQAREKAKVQRVFRNVDDPNHVFVLLELLP
Ga0307284_1000255313300028799SoilMSAFIITRIHVGDYDRWRPMFEQDRPQAREKAKVQRIFRDVDDPNHVFIFLEFESTEDAREAQGR
Ga0307302_1064643613300028814SoilMSAFIMTRIHVGDYDRWRPMFEQDRPLAREKAKVQRIFRDVDDPNHVFIFLEFKSTE
Ga0307289_1000234313300028875SoilMAAFIITRIQTGDYETWRPMFEQDRPLARAKATRQRIFRKVDDPNHVFVFLEFD
Ga0307286_1038299723300028876SoilMAAFIITRIQTGDYDTWRPMFDQDRPLARAKAMRQRVFRKVDDPNHVFVFLEFDSVADAE
Ga0307278_1042024323300028878SoilMSAFIITRIQVGDYDTWREMFDQDRPGAREKAKVQRVFRGVADPNHVFI
Ga0308193_105603523300031096SoilMSGFIITRIQTGDYDTWRPMFDQDRPGAREQATAQRVFRTVDDPNHVFVFL
Ga0307496_1007861523300031200SoilMAAFIITRIQTGDYETGRPMFDQDRPLARAKATRQRVFRRVDDPNHVFVFLE
Ga0299914_1130273523300031228SoilMSAFIITRIQVGDYAAWRQMFDQDRPRAREKAKVQRVFRGVEDPDHVFVLLEFESV
Ga0310813_1001776113300031716SoilMSAFIITRIHVGDYETWRRLYDQDVPRARENATLQRVLRMVDDPNHVFVYLEF
Ga0306921_1128630723300031912SoilVSAFIITRIQVGDYDTWRPMFDQDLPRAREKATAQRVFRGADDPNHVFILLE
Ga0306922_1125406813300032001SoilMSAFIITRIQVGDYDAWRPMFDQDHPRAREKATAQRVFRGADDPSHVFILLEYASLEDARTAERRLLD
Ga0306922_1160180423300032001SoilVTAFIITRIQTGDYERWRPMFDQDQPRAREKARLQRVLRSTGDPNEV
Ga0310889_1005951113300032179SoilMSAFIITRIQVGDYDTWRPLYDRDVPRARENATAQRVFRRVDDPNHVFVFLEFASVED
Ga0306920_10072371433300032261SoilVSAFIITRIQVGDYDAWRPMFDQDLPRAREKATAQRVFRSADDPNQVFILLEFD
Ga0370546_025655_638_8083300034681SoilMSGFIITRIQTGDYDTWRPMFDQDRPGAREQATAQRVFRRVDDPNHVFVFLEFDSID


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.