NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F083333

Metagenome Family F083333

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F083333
Family Type Metagenome
Number of Sequences 113
Average Sequence Length 39 residues
Representative Sequence NLALNRKRPGDTVTVTLYRGGKKMDIPVKLGERTGN
Number of Associated Samples 95
Number of Associated Scaffolds 113

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 98.23 %
% of genes from short scaffolds (< 2000 bps) 92.92 %
Associated GOLD sequencing projects 90
AlphaFold2 3D model prediction Yes
3D model pTM-score0.46

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (97.345 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil
(32.743 % of family members)
Environment Ontology (ENVO) Unclassified
(36.283 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(42.478 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 0.00%    β-sheet: 25.00%    Coil/Unstructured: 75.00%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.46
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 113 Family Scaffolds
PF04028DUF374 56.64
PF13180PDZ_2 2.65
PF00486Trans_reg_C 1.77
PF07978NIPSNAP 1.77
PF13474SnoaL_3 1.77
PF14534DUF4440 1.77
PF13470PIN_3 0.88
PF00582Usp 0.88
PF10861DUF2784 0.88
PF13561adh_short_C2 0.88
PF07969Amidohydro_3 0.88
PF02590SPOUT_MTase 0.88
PF07676PD40 0.88
PF01791DeoC 0.88
PF13506Glyco_transf_21 0.88
PF12840HTH_20 0.88

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 113 Family Scaffolds
COG2121Uncharacterized conserved protein, lysophospholipid acyltransferase (LPLAT) superfamilyFunction unknown [S] 56.64
COG157623S rRNA pseudoU1915 N3-methylase RlmHTranslation, ribosomal structure and biogenesis [J] 0.88

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms97.35 %
UnclassifiedrootN/A2.65 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300004091|Ga0062387_101025239All Organisms → cellular organisms → Bacteria634Open in IMG/M
3300005177|Ga0066690_10336603All Organisms → cellular organisms → Bacteria1022Open in IMG/M
3300005343|Ga0070687_100791167All Organisms → cellular organisms → Bacteria671Open in IMG/M
3300005434|Ga0070709_10063411All Organisms → cellular organisms → Bacteria2360Open in IMG/M
3300005434|Ga0070709_11201541All Organisms → cellular organisms → Bacteria609Open in IMG/M
3300005436|Ga0070713_100511493All Organisms → cellular organisms → Bacteria1134Open in IMG/M
3300005537|Ga0070730_10318528All Organisms → cellular organisms → Bacteria1016Open in IMG/M
3300005554|Ga0066661_10323113All Organisms → cellular organisms → Bacteria948Open in IMG/M
3300005586|Ga0066691_10330138All Organisms → cellular organisms → Bacteria902Open in IMG/M
3300005610|Ga0070763_10721959All Organisms → cellular organisms → Bacteria585Open in IMG/M
3300005764|Ga0066903_102873390All Organisms → cellular organisms → Bacteria934Open in IMG/M
3300005844|Ga0068862_101130596All Organisms → cellular organisms → Bacteria779Open in IMG/M
3300006163|Ga0070715_10083453All Organisms → cellular organisms → Bacteria → Proteobacteria1455Open in IMG/M
3300006174|Ga0075014_100388126All Organisms → cellular organisms → Bacteria758Open in IMG/M
3300006903|Ga0075426_10989277All Organisms → cellular organisms → Bacteria636Open in IMG/M
3300007258|Ga0099793_10323892All Organisms → cellular organisms → Bacteria → Acidobacteria751Open in IMG/M
3300009038|Ga0099829_10707821All Organisms → cellular organisms → Bacteria837Open in IMG/M
3300009038|Ga0099829_11229729All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium620Open in IMG/M
3300009038|Ga0099829_11528417All Organisms → cellular organisms → Bacteria → Acidobacteria551Open in IMG/M
3300009088|Ga0099830_10226783All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1471Open in IMG/M
3300009088|Ga0099830_10295447All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1292Open in IMG/M
3300009088|Ga0099830_10499970All Organisms → cellular organisms → Bacteria992Open in IMG/M
3300009090|Ga0099827_11655893All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium557Open in IMG/M
3300009137|Ga0066709_100746423All Organisms → cellular organisms → Bacteria1412Open in IMG/M
3300009631|Ga0116115_1085749All Organisms → cellular organisms → Bacteria → Acidobacteria813Open in IMG/M
3300009698|Ga0116216_10113506All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1668Open in IMG/M
3300010046|Ga0126384_10815987All Organisms → cellular organisms → Bacteria → Acidobacteria836Open in IMG/M
3300010048|Ga0126373_12429612All Organisms → cellular organisms → Bacteria → Acidobacteria584Open in IMG/M
3300010339|Ga0074046_10591785All Organisms → cellular organisms → Bacteria → Acidobacteria657Open in IMG/M
3300010361|Ga0126378_10649609All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii1168Open in IMG/M
3300010403|Ga0134123_10981273All Organisms → cellular organisms → Bacteria → Acidobacteria859Open in IMG/M
3300011269|Ga0137392_10160763All Organisms → cellular organisms → Bacteria → Acidobacteria1819Open in IMG/M
3300011270|Ga0137391_10929396All Organisms → cellular organisms → Bacteria → Acidobacteria710Open in IMG/M
3300011270|Ga0137391_11236880All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium594Open in IMG/M
3300011271|Ga0137393_11406914All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium587Open in IMG/M
3300012096|Ga0137389_10988970All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium721Open in IMG/M
3300012096|Ga0137389_11240695All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium638Open in IMG/M
3300012189|Ga0137388_10603515All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1020Open in IMG/M
3300012189|Ga0137388_11268141All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium675Open in IMG/M
3300012202|Ga0137363_10916679All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium744Open in IMG/M
3300012205|Ga0137362_10180298All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1815Open in IMG/M
3300012205|Ga0137362_11757291All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae507Open in IMG/M
3300012206|Ga0137380_10278809All Organisms → cellular organisms → Bacteria1501Open in IMG/M
3300012356|Ga0137371_11028197All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium623Open in IMG/M
3300012361|Ga0137360_10801222All Organisms → cellular organisms → Bacteria → Acidobacteria811Open in IMG/M
3300012361|Ga0137360_10856169All Organisms → cellular organisms → Bacteria → Acidobacteria783Open in IMG/M
3300012362|Ga0137361_10060722All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium3161Open in IMG/M
3300012363|Ga0137390_10192934All Organisms → cellular organisms → Bacteria2023Open in IMG/M
3300012683|Ga0137398_10671823All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium719Open in IMG/M
3300012685|Ga0137397_10740713All Organisms → cellular organisms → Bacteria → Acidobacteria729Open in IMG/M
3300012922|Ga0137394_10483889All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1052Open in IMG/M
3300012924|Ga0137413_11716219All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium516Open in IMG/M
3300012925|Ga0137419_10176204All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1565Open in IMG/M
3300012929|Ga0137404_11102075All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium728Open in IMG/M
3300012930|Ga0137407_12039799All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium547Open in IMG/M
3300012944|Ga0137410_10425845All Organisms → cellular organisms → Bacteria → Acidobacteria1074Open in IMG/M
3300012949|Ga0153798_10120216Not Available1135Open in IMG/M
3300012971|Ga0126369_12564544All Organisms → cellular organisms → Bacteria595Open in IMG/M
3300013306|Ga0163162_10469930All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1389Open in IMG/M
3300015241|Ga0137418_10495735All Organisms → cellular organisms → Bacteria → Acidobacteria978Open in IMG/M
3300015358|Ga0134089_10352791All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium620Open in IMG/M
3300016270|Ga0182036_10159608All Organisms → cellular organisms → Bacteria → Acidobacteria1615Open in IMG/M
3300017928|Ga0187806_1173223All Organisms → cellular organisms → Bacteria → Acidobacteria721Open in IMG/M
3300017955|Ga0187817_10066466All Organisms → cellular organisms → Bacteria → Acidobacteria2238Open in IMG/M
3300017955|Ga0187817_10312148All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1003Open in IMG/M
3300017999|Ga0187767_10016796All Organisms → cellular organisms → Bacteria → Acidobacteria1530Open in IMG/M
3300018007|Ga0187805_10055802All Organisms → cellular organisms → Bacteria → Acidobacteria1774Open in IMG/M
3300018007|Ga0187805_10142203All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1090Open in IMG/M
3300018090|Ga0187770_11270424All Organisms → cellular organisms → Bacteria596Open in IMG/M
3300019360|Ga0187894_10250109All Organisms → cellular organisms → Bacteria → Acidobacteria840Open in IMG/M
3300021180|Ga0210396_10383551All Organisms → cellular organisms → Bacteria → Acidobacteria1236Open in IMG/M
3300021559|Ga0210409_11609267All Organisms → cellular organisms → Bacteria → Acidobacteria526Open in IMG/M
3300024288|Ga0179589_10369384All Organisms → cellular organisms → Bacteria → Acidobacteria654Open in IMG/M
3300024290|Ga0247667_1027368All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1091Open in IMG/M
3300025439|Ga0208323_1066378All Organisms → cellular organisms → Bacteria → Acidobacteria622Open in IMG/M
3300025906|Ga0207699_10077593All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2050Open in IMG/M
3300025906|Ga0207699_10541709All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium843Open in IMG/M
3300025938|Ga0207704_11748839All Organisms → cellular organisms → Bacteria → Acidobacteria535Open in IMG/M
3300026298|Ga0209236_1201504All Organisms → cellular organisms → Bacteria752Open in IMG/M
3300027738|Ga0208989_10177324All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium710Open in IMG/M
3300027825|Ga0209039_10151144All Organisms → cellular organisms → Bacteria → Acidobacteria966Open in IMG/M
3300027825|Ga0209039_10397822All Organisms → cellular organisms → Bacteria → Acidobacteria527Open in IMG/M
3300027846|Ga0209180_10461186All Organisms → cellular organisms → Bacteria → Acidobacteria715Open in IMG/M
3300027862|Ga0209701_10689610All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium528Open in IMG/M
3300027895|Ga0209624_10071614All Organisms → cellular organisms → Bacteria → Acidobacteria2237Open in IMG/M
3300028047|Ga0209526_10171308All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1514Open in IMG/M
3300028146|Ga0247682_1025678All Organisms → cellular organisms → Bacteria1039Open in IMG/M
3300031057|Ga0170834_110590394All Organisms → cellular organisms → Bacteria → Acidobacteria1367Open in IMG/M
3300031231|Ga0170824_107073390All Organisms → cellular organisms → Bacteria → Acidobacteria648Open in IMG/M
3300031231|Ga0170824_118921339Not Available863Open in IMG/M
3300031546|Ga0318538_10282191All Organisms → cellular organisms → Bacteria → Acidobacteria894Open in IMG/M
3300031668|Ga0318542_10417275All Organisms → cellular organisms → Bacteria → Acidobacteria694Open in IMG/M
3300031681|Ga0318572_10075033All Organisms → cellular organisms → Bacteria → Acidobacteria1870Open in IMG/M
3300031715|Ga0307476_10568851All Organisms → cellular organisms → Bacteria840Open in IMG/M
3300031740|Ga0307468_100634728All Organisms → cellular organisms → Bacteria → Acidobacteria879Open in IMG/M
3300031747|Ga0318502_10539616All Organisms → cellular organisms → Bacteria → Acidobacteria700Open in IMG/M
3300031754|Ga0307475_10556309All Organisms → cellular organisms → Bacteria → Acidobacteria920Open in IMG/M
3300031770|Ga0318521_10939799All Organisms → cellular organisms → Bacteria → Acidobacteria529Open in IMG/M
3300031799|Ga0318565_10626860All Organisms → cellular organisms → Bacteria → Acidobacteria516Open in IMG/M
3300031833|Ga0310917_10400950All Organisms → cellular organisms → Bacteria → Acidobacteria932Open in IMG/M
3300031890|Ga0306925_12135630All Organisms → cellular organisms → Bacteria → Acidobacteria523Open in IMG/M
3300031945|Ga0310913_10868216All Organisms → cellular organisms → Bacteria → Acidobacteria635Open in IMG/M
3300032180|Ga0307471_100495706All Organisms → cellular organisms → Bacteria → Acidobacteria1368Open in IMG/M
3300032180|Ga0307471_102552140All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium647Open in IMG/M
3300032180|Ga0307471_103842609All Organisms → cellular organisms → Bacteria → Acidobacteria531Open in IMG/M
3300032180|Ga0307471_104137473All Organisms → cellular organisms → Bacteria → Acidobacteria512Open in IMG/M
3300032205|Ga0307472_100985910All Organisms → cellular organisms → Bacteria → Acidobacteria788Open in IMG/M
3300032261|Ga0306920_103779249All Organisms → cellular organisms → Bacteria → Acidobacteria554Open in IMG/M
3300032829|Ga0335070_10271887All Organisms → cellular organisms → Bacteria → Acidobacteria1652Open in IMG/M
3300032954|Ga0335083_11093016All Organisms → cellular organisms → Bacteria623Open in IMG/M
3300033982|Ga0371487_0029023All Organisms → cellular organisms → Bacteria3570Open in IMG/M
3300033983|Ga0371488_0478325All Organisms → cellular organisms → Bacteria → Acidobacteria566Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil32.74%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil10.62%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil7.08%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere5.31%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment4.42%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil3.54%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil2.65%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil2.65%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil2.65%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil2.65%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil2.65%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland1.77%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil1.77%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil1.77%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland1.77%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil1.77%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Sediment0.89%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds0.89%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.89%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.89%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil0.89%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil0.89%
Bog Forest SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil0.89%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.89%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil0.89%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.89%
Microbial Mat On RocksEnvironmental → Terrestrial → Cave → Unclassified → Unclassified → Microbial Mat On Rocks0.89%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.89%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.89%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.89%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere0.89%
Switchgrass DegradingEngineered → Bioreactor → Unclassified → Unclassified → Unclassified → Switchgrass Degrading0.89%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300004091Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3EnvironmentalOpen in IMG/M
3300005177Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139EnvironmentalOpen in IMG/M
3300005343Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaGEnvironmentalOpen in IMG/M
3300005434Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaGEnvironmentalOpen in IMG/M
3300005436Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaGEnvironmentalOpen in IMG/M
3300005537Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1EnvironmentalOpen in IMG/M
3300005554Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110EnvironmentalOpen in IMG/M
3300005586Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140EnvironmentalOpen in IMG/M
3300005610Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3EnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005844Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2Host-AssociatedOpen in IMG/M
3300006163Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaGEnvironmentalOpen in IMG/M
3300006174Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014EnvironmentalOpen in IMG/M
3300006903Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5Host-AssociatedOpen in IMG/M
3300007258Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3EnvironmentalOpen in IMG/M
3300009038Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaGEnvironmentalOpen in IMG/M
3300009088Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaGEnvironmentalOpen in IMG/M
3300009090Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaGEnvironmentalOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009631Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_100EnvironmentalOpen in IMG/M
3300009698Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaGEnvironmentalOpen in IMG/M
3300010046Tropical forest soil microbial communities from Panama - MetaG Plot_36EnvironmentalOpen in IMG/M
3300010048Tropical forest soil microbial communities from Panama - MetaG Plot_11EnvironmentalOpen in IMG/M
3300010339Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3EnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010391Freshwater sediment microbial communities from Lake Superior, USA - Station SU-17. Combined Assembly of Gp0155404, Gp0155335, Gp0155336, Gp0155336, Gp0155403, Gp0155406EnvironmentalOpen in IMG/M
3300010403Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3EnvironmentalOpen in IMG/M
3300011269Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaGEnvironmentalOpen in IMG/M
3300011270Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaGEnvironmentalOpen in IMG/M
3300011271Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaGEnvironmentalOpen in IMG/M
3300012096Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaGEnvironmentalOpen in IMG/M
3300012189Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaGEnvironmentalOpen in IMG/M
3300012202Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaGEnvironmentalOpen in IMG/M
3300012205Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaGEnvironmentalOpen in IMG/M
3300012206Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaGEnvironmentalOpen in IMG/M
3300012356Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012361Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaGEnvironmentalOpen in IMG/M
3300012362Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaGEnvironmentalOpen in IMG/M
3300012363Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaGEnvironmentalOpen in IMG/M
3300012683Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaGEnvironmentalOpen in IMG/M
3300012685Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaGEnvironmentalOpen in IMG/M
3300012922Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaGEnvironmentalOpen in IMG/M
3300012924Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012925Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012929Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012930Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012944Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012949Switchgrass enrichment cultures co-assemblyEngineeredOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300013306Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaGHost-AssociatedOpen in IMG/M
3300015241Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015358Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300016270Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080EnvironmentalOpen in IMG/M
3300017928Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_1EnvironmentalOpen in IMG/M
3300017955Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2EnvironmentalOpen in IMG/M
3300017999Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP10_10_MGEnvironmentalOpen in IMG/M
3300018007Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5EnvironmentalOpen in IMG/M
3300018090Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300019360White microbial mat communities from a lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - GBC170108-1 metaGEnvironmentalOpen in IMG/M
3300021180Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-OEnvironmentalOpen in IMG/M
3300021559Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-MEnvironmentalOpen in IMG/M
3300024288Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungalEnvironmentalOpen in IMG/M
3300024290Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK08EnvironmentalOpen in IMG/M
3300025439Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_100 (SPAdes)EnvironmentalOpen in IMG/M
3300025906Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025938Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026298Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm (SPAdes)EnvironmentalOpen in IMG/M
3300027738Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300027825Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM1 (SPAdes)EnvironmentalOpen in IMG/M
3300027846Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027862Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027895Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes)EnvironmentalOpen in IMG/M
3300028047Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300028146Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK23EnvironmentalOpen in IMG/M
3300031057Oak Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031231Coassembly Site 11 (all samples) - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031546Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23EnvironmentalOpen in IMG/M
3300031668Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23EnvironmentalOpen in IMG/M
3300031681Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20EnvironmentalOpen in IMG/M
3300031715Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05EnvironmentalOpen in IMG/M
3300031740Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05EnvironmentalOpen in IMG/M
3300031747Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22EnvironmentalOpen in IMG/M
3300031754Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515EnvironmentalOpen in IMG/M
3300031770Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17EnvironmentalOpen in IMG/M
3300031799Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f21EnvironmentalOpen in IMG/M
3300031833Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178EnvironmentalOpen in IMG/M
3300031890Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2)EnvironmentalOpen in IMG/M
3300031945Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M
3300032829Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3EnvironmentalOpen in IMG/M
3300032954Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2EnvironmentalOpen in IMG/M
3300033982Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB22AY SIP fractionEnvironmentalOpen in IMG/M
3300033983Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB23AN SIP fractionEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Ga0062387_10102523923300004091Bog Forest SoilANQFDVNILLNHKRPGDKVTVAVYRGGKKVDLPITLSERPGSS*
Ga0066690_1033660333300005177SoilFDVNLVLNHHRPGDAVNVTIYRGGKKMDIPVKLGERDGN*
Ga0070687_10079116723300005343Switchgrass RhizosphereIDLNIALNRKRPGDTMTLTVYRGGKRMDIPVKLAERPVK*
Ga0070709_1006341113300005434Corn, Switchgrass And Miscanthus RhizosphereLDVNLALNKKRPGDVVDVTLFRGGKKMEVQVTLVERPGNS*
Ga0070709_1120154113300005434Corn, Switchgrass And Miscanthus RhizosphereVILNRKRPGDSVTVTVYRAGKKLDIPVKLGERTENQRQQ*
Ga0070713_10051149323300005436Corn, Switchgrass And Miscanthus RhizosphereLDVNLALNKKRPGDTVDVTLFRGGKKMDLQIKLAERPGNN*
Ga0070730_1031852813300005537Surface SoilVILNRKRPGDSVTVTVYRAGKKIDIPVKLGERTENQRQQ*
Ga0066661_1032311313300005554SoilSELDVNLVLNKKRPGESITVTAYRGGKKIEIPVKLGERPNA*
Ga0066691_1033013813300005586SoilILNHHRPGDKVTVTLYRGGKKMDVPVTLGERTGN*
Ga0070763_1072195923300005610SoilNLALNRKRPGDTVTVTLYRGGKKMDIPVKLGERTGN*
Ga0066903_10287339013300005764Tropical Forest SoilVAGQFDVNVILNRKRPGDTVTVSLYRGGKKIDIPVKLGERSGS*
Ga0068862_10113059613300005844Switchgrass RhizosphereLNKKRPGEEVTVTLFRGGKKMDVKAKLSERPQSD*
Ga0070715_1008345333300006163Corn, Switchgrass And Miscanthus RhizosphereLVLNKKRPGDSIEVTAYRGGKKIEIPVKLGERPGA*
Ga0075014_10038812623300006174WatershedsDVNVILNRKRPGDTVTITLYRGAKKLDIPVKLGERSGN*
Ga0075426_1098927723300006903Populus RhizosphereGQKVSSELDVNLVLNKKRPGDSIEVTAYRGGKKIEIPVKLGERPGA*
Ga0099793_1032389223300007258Vadose Zone SoilLLNRKRPGDTVTVSVYRGAKKVDVPVKLGERDGN*
Ga0099829_1070782113300009038Vadose Zone SoilQKTSSQLDLSLVLNHKRPGNTVAVTFYRGGRKMDAQVTLGERSE*
Ga0099829_1122972913300009038Vadose Zone SoilLNKKRPGDTITVTVYRGRQKMDVRVTLAERSARS*
Ga0099829_1152841713300009038Vadose Zone SoilQTVSSPLYLNLALNKKRPGDAVPVTLFRGGKKMDLQIKLAERPGNN*
Ga0099830_1022678333300009088Vadose Zone SoilILNRKRPGDTVNVTVYRGGKKMDIPVKLGERTGN*
Ga0099830_1029544733300009088Vadose Zone SoilVILNRKRPGDSVNVSLYRGGKKMDIPVKLGERPGN*
Ga0099830_1049997033300009088Vadose Zone SoilLNILLNRKRPGDAITLTIYRGGKKMKLPVKLGERPSS*
Ga0099827_1165589313300009090Vadose Zone SoilSQLDVNLALNHKRPGDNITVTLYRGGKKMDVPVKLGERTGN*
Ga0066709_10074642313300009137Grasslands SoilNRVDVDLMLNKKRPGDEVTITLFRGGKKMDVKVKLGERQQSN*
Ga0116115_108574923300009631PeatlandLDVNMLLNRKRPGDSIKLTIYRGGRRMELKATLGERAGKS*
Ga0116216_1011350613300009698Peatlands SoilVNVVLNRKRPGDTVKVSLYRGGKKMDIPVKLGESTGN*
Ga0126384_1081598723300010046Tropical Forest SoilDVNLILNKKRPGDEVTVTLYRGGKKMDVKAKLSERPQSD*
Ga0126373_1242961223300010048Tropical Forest SoilVVLNRKRPGDTVTVTLYRGAKKLDIPVKLGEREGN*
Ga0074046_1059178513300010339Bog Forest SoilILNRKRPGDSVTVTLYRGAKKMDVPVKLGEHDGN*
Ga0126378_1064960913300010361Tropical Forest SoilDVNLVLNHHRPGDTVHVSLYRGGKKMDLPVKLGENPGN*
Ga0136847_1249350553300010391Freshwater SedimentMNRLLNRKRPGERVRLTIYRGRQKTDVEVTLGER*
Ga0134123_1098127313300010403Terrestrial SoilLNIALNRKRPGDTMTLTVYRGGKRMDIPVKLAERPVK*
Ga0137392_1016076313300011269Vadose Zone SoilQKVASPFDLNILLNRKRPGDAITLNVYRGGKKMELPVKLGERPSS*
Ga0137391_1092939613300011270Vadose Zone SoilSPFDMNVILNRKRPGDTVKVSIYRGGKKMDIPVKLGERTGN*
Ga0137391_1123688013300011270Vadose Zone SoilASQLDVNLALNHKRPGDNITVTLYRGGKKMDLPVKLGERTSN*
Ga0137393_1140691413300011271Vadose Zone SoilVNVLLNRKRPGDTVKVTLYRGGKKMDIPVKLGERTGN*
Ga0137389_1098897013300012096Vadose Zone SoilVNVMLNRKRPGDTVTVTIYRGGKKMDIPVKLGERTGN*
Ga0137389_1124069533300012096Vadose Zone SoilDQKIGSPFDMNVILNRKRPGDTVKVSIYRGGKKMDIPVKLGERTGN*
Ga0137388_1060351523300012189Vadose Zone SoilQLDVNLALNHKRPGDNITVTLYRGGKKMDLPVKLGERTGN*
Ga0137388_1126814113300012189Vadose Zone SoilVNVVLNRKRPGDTVNVTVYRGGKKMDIPVKLGERTGN*
Ga0137363_1091667923300012202Vadose Zone SoilMNVILNRKRPGDMVKVSIYRGGKRMDIPVKLGERTGN*
Ga0137362_1018029833300012205Vadose Zone SoilPFDLNILLNRKRPGETVTLTIYRGAKKMDLPVKLAERPGA*
Ga0137362_1175729123300012205Vadose Zone SoilVNLALNKKRPGDTVDVALFRGGKKMNLQVKLAERPGNN*
Ga0137380_1027880943300012206Vadose Zone SoilGSPFDMNVILNRKRPGDTVKVSIYRGGKKMDIPVKLGERTGN*
Ga0137371_1102819733300012356Vadose Zone SoilFDMNVILNRKRPGDTVKVSIYRGGKKMDIPVKLGERTGN*
Ga0137360_1080122223300012361Vadose Zone SoilQLDINLVLNRKRPGDTVNVSLFRGGKKMDVPVKLGERPGND*
Ga0137360_1085616913300012361Vadose Zone SoilNVLLNRKRPGDTVTVSVYRGAKKVEVPVKLGERDGN*
Ga0137361_1006072243300012362Vadose Zone SoilVLNRKRPGDTITVTVYRGGKKMDIPVKLRERPGN*
Ga0137390_1019293413300012363Vadose Zone SoilPFDLNILLNRKRPGDAITLTIYRGGKKMELPVKLGERPSS*
Ga0137398_1067182323300012683Vadose Zone SoilVLNHKRPGDNVTVTVYRGGKKMDIPVKLGERTGN*
Ga0137397_1074071333300012685Vadose Zone SoilVNVVLNRKRPGDTVNVSVYRGGKKMDIPVKLGERTSN*
Ga0137394_1048388913300012922Vadose Zone SoilTGQLDVNVVLNRKRPGDTVNVSVYRGGKKIDIPVKLGERTGS*
Ga0137413_1171621923300012924Vadose Zone SoilLNIILNRKRPGDSVTLTVYRGGKKLDIPVKLGERNENTR*
Ga0137419_1017620433300012925Vadose Zone SoilVLNHKRPGDTVNVTLYRGGKKMDIPVKLGERTGN*
Ga0137404_1110207513300012929Vadose Zone SoilVNLALNHKRPGDNITVTVYRGGKKMDIPVKLGERTAK*
Ga0137407_1203979923300012930Vadose Zone SoilNVVLNRKRPGDTVNVSVYRGGKKIDIPVKLGERSGN*
Ga0137410_1042584523300012944Vadose Zone SoilDVNLVLNRKRPGDTVSVSLFRGGKKMDVPVKLGERPGNN*
Ga0153798_1012021613300012949Switchgrass DegradingVIFNNHKPGDKVTVTVDRDGKKLDIPVVLGEMPRE*
Ga0126369_1256454413300012971Tropical Forest SoilRILNHRRPGDTVNVTVYRGGQKTDIAVKRGELDRN*
Ga0163162_1046993013300013306Switchgrass RhizosphereKMSSPIDLNIALNRKRPGDTMTLTVYRGGKRMDIPVKLAERPVK*
Ga0137418_1049573533300015241Vadose Zone SoilDVNVVLNRKRPGDTVNVSVYRGGKKMDIPVKLGERTGN*
Ga0134089_1035279113300015358Grasslands SoilKIASPFDMNVILNRKRPGDTVKVSIYRGGKKMDIPVKLGERTGN*
Ga0182036_1015960833300016270SoilANQFDMNLLLNRKRPGDSVTITVYRGAKKMEIPVKLGERDGN
Ga0187806_117322313300017928Freshwater SedimentQFDINVILNRKRPGDTVTITLYRGAKKLDIPVKLGERDGN
Ga0187817_1006646613300017955Freshwater SedimentDINVILNRKRPGDTVTLTIYRGAKKLDITVKLGEHDGN
Ga0187817_1031214813300017955Freshwater SedimentMNVILNHKRPGDSVNVTLYRGGKKMDIAVKLGERSGNG
Ga0187767_1001679613300017999Tropical PeatlandEFDMNVLLNRKRPGDTVNITLYRGAKKLDIPVKLGEHDGN
Ga0187805_1005580213300018007Freshwater SedimentKVANQFDINVVLNRKRPGDTVTVTLYRGAKKVDIPVKLGERDGN
Ga0187805_1014220323300018007Freshwater SedimentLDMNVILNHKRPGESVNVTLYRGGKKMDIAVKLGERSGNS
Ga0187770_1127042423300018090Tropical PeatlandLDLGVLLNRHRPGDAVTLTIYRGSQKMELRATLGER
Ga0187894_1025010913300019360Microbial Mat On RocksDMNVVLNRKRPGDTIKVTIYRGGSKMNINVTLSELSGIT
Ga0210396_1038355113300021180SoilNVLLNRKRPGDSVTVSVYRGAKKVDIPVKLGERDGN
Ga0210409_1160926723300021559SoilNPMDLDIILNRKRPGDTVTLSVYRGAKKTDIPVKLGERTGN
Ga0179589_1036938423300024288Vadose Zone SoilDMNVLLNRKRPGDSVTVTVYRGAKKVDVPVKLGERDGN
Ga0247667_102736813300024290SoilDVKLVLNKKRPGESITVTAYRGGKKIEIPVKLGEREK
Ga0208323_106637813300025439PeatlandLDVNMLLNRKRPGDSIKLTIYRGGRRMELKATLGERAGKS
Ga0207699_1007759333300025906Corn, Switchgrass And Miscanthus RhizosphereDVNLALNKKRPGDVVDVTLFRGGKKMEVQVTLVERPGNS
Ga0207699_1054170923300025906Corn, Switchgrass And Miscanthus RhizosphereIALNRKRPGDIMTLTVYRGGKKMDVPVKLAERPGK
Ga0207704_1174883913300025938Miscanthus RhizosphereNIALNRKRPGDTMTLTVYRGGKRMDIPVKLAERPVK
Ga0209236_120150423300026298Grasslands SoilQKTASQLDLSLVLNHKRPGNTVAVTFYRGGRKMDAQVTLGERGE
Ga0208989_1017732413300027738Forest SoilLDVNLVLNHKRPGDSVTVTVYRGGKKMDIPVKLGERTGN
Ga0209039_1015114423300027825Bog Forest SoilDIDVNLILNRKRPGDSVTITLYRGAKKMDVPVKLGEHDGN
Ga0209039_1039782213300027825Bog Forest SoilVLLNRKRPGDTVTLTVYRGAKKVDVPVKLGEHDGN
Ga0209180_1046118613300027846Vadose Zone SoilVMLNRKRPGDTVTVSVYRGGKKMDIPVKLGERTGN
Ga0209701_1068961023300027862Vadose Zone SoilSPFDLNLILNHHRPGDKVTVTLYRDGKKMDVPLALGERTN
Ga0209624_1007161413300027895Forest SoilVVLNHKRPGDTVTVTLYRAGKKLDIPVKLGERTDNQRQQ
Ga0209526_1017130813300028047Forest SoilMDLNIALNRKRPGDTMTLTVYRSGKKMDVPVKLAERTGK
Ga0247682_102567833300028146SoilLDVNLVLNKKRPGDSIEVTVYRGGKKIEIPVKLGERPGA
Ga0170834_11059039413300031057Forest SoilVLLNRKRPGDSVTVTVYRGAKKVDVPVKLGERDGN
Ga0170824_10707339023300031231Forest SoilPLDVNLALNKKRPGDTVDVTIFRGGKKMDLQIKLAERPGNS
Ga0170824_11892133923300031231Forest SoilKIMNRKRPGDVVPVTLYRGGKKMDLQVKLAERTQK
Ga0318538_1028219113300031546SoilNVILNRKRPGDTVTVTLYRGAKKMDIPVKLGEREGN
Ga0318542_1041727523300031668SoilQKVANQFDMNVILNRKRPGDTVTVTLYRGAKKMDIPVKLGEREGN
Ga0318572_1007503333300031681SoilQFDMNVILNRKRPGDSVTVTVYRGAKKMDIAVKLGEREGN
Ga0307476_1056885123300031715Hardwood Forest SoilDLNVILNHKKPGETVRVTVFRGGKKMDFNVTLGEAAQSVSR
Ga0307468_10063472823300031740Hardwood Forest SoilDVNLVLNKKRPGDEVTVSLYRGGKKMDVKVKLSERPENN
Ga0318502_1053961623300031747SoilNVVLNRKRPGDTVTVTLYRGAKKLDIPVKLGEREGN
Ga0307475_1055630913300031754Hardwood Forest SoilNLVLNKKRPGDEVKVSLFRGGKKMDVEVKLGERPGS
Ga0318521_1093979923300031770SoilINVVLNRKRPGDTVTVTLYRGAKKLDIPVKLGEREGN
Ga0318565_1062686013300031799SoilNLVLNKKRPGEEVTVSLYRGGKAMEVKVKLGERKEN
Ga0310917_1040095013300031833SoilNQFDMNLLLNRKRPGDSVTITVYRGAKKMEIPVKLGERDGN
Ga0306925_1213563023300031890SoilDLNLVLNKKRPGDEVTVSLFRGGKAMEVKVKLGERKEI
Ga0310913_1086821623300031945SoilANQFDMNVILNRKRPGDTVTVTLYRGAKKMDIPVKLGEREGN
Ga0307471_10049570633300032180Hardwood Forest SoilVLLNRKRPGDTVTVSVYRGAKKVDVPVKLGERDGN
Ga0307471_10255214013300032180Hardwood Forest SoilDVNLALNHKRPGDTVTVALYRGGKKMDISVKLGERTGN
Ga0307471_10384260913300032180Hardwood Forest SoilMNVLLNRKRPGDTVAITVYRGAKKVDILVKLGERDGN
Ga0307471_10413747323300032180Hardwood Forest SoilQKVSNQFDLNVILNRKRPADMVSVTVYRGGKKMDVPVKLGERTGN
Ga0307472_10098591013300032205Hardwood Forest SoilTSPLDFNLALKKKRPGDTVNVTLFRGGKKMDLQIKLAERPGNS
Ga0306920_10377924923300032261SoilTQFDVNLVLNKKRPGDSVTVTVFRGGKKLDLPVKLGERPRG
Ga0335070_1027188713300032829SoilQFDVNVILNRKRPGDTVTVTIYRGAKKLDVPVKLGERDGN
Ga0335083_1109301613300032954SoilNTMDLSVVLNRKRPGDTVTVTLYRSGKKMDIPVKLGERTENQRQQ
Ga0371487_0029023_3442_35703300033982Peat SoilSNEIDINLILNRKRPGDNLTVTLYRGAKKMDVTVKLGEHDGN
Ga0371488_0478325_445_5643300033983Peat SoilFDVNVILNRKRPGETVTVTIYRGSKKLDIPVKLGEHDGN

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.