NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F083364

Metagenome / Metatranscriptome Family F083364

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F083364
Family Type Metagenome / Metatranscriptome
Number of Sequences 113
Average Sequence Length 43 residues
Representative Sequence RAPELYFRLDRAEQEKARVEELLARAKKRNKARKESGGKKA
Number of Associated Samples 99
Number of Associated Scaffolds 113

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 98.23 %
% of genes from short scaffolds (< 2000 bps) 85.84 %
Associated GOLD sequencing projects 94
AlphaFold2 3D model prediction Yes
3D model pTM-score0.42

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (99.115 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(14.159 % of family members)
Environment Ontology (ENVO) Unclassified
(28.319 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(53.982 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 49.28%    β-sheet: 0.00%    Coil/Unstructured: 50.72%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.42
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 113 Family Scaffolds
PF01368DHH 64.60
PF02272DHHA1 26.55
PF13231PMT_2 3.54
PF02033RBFA 0.88
PF08071RS4NT 0.88
PF00557Peptidase_M24 0.88
PF00583Acetyltransf_1 0.88
PF01558POR 0.88

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 113 Family Scaffolds
COG0858Ribosome-binding factor RbfATranslation, ribosomal structure and biogenesis [J] 0.88
COG1014Pyruvate:ferredoxin oxidoreductase or related 2-oxoacid:ferredoxin oxidoreductase, gamma subunitEnergy production and conversion [C] 0.88
COG1471Ribosomal protein S4ETranslation, ribosomal structure and biogenesis [J] 0.88

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms99.12 %
UnclassifiedrootN/A0.88 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000567|JGI12270J11330_10258137All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae558Open in IMG/M
3300001471|JGI12712J15308_10008248All Organisms → cellular organisms → Bacteria2848Open in IMG/M
3300002245|JGIcombinedJ26739_100365234All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter1324Open in IMG/M
3300002568|C688J35102_119148972All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis645Open in IMG/M
3300004080|Ga0062385_10124313All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter1292Open in IMG/M
3300004091|Ga0062387_100000128All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter12527Open in IMG/M
3300004635|Ga0062388_102700318All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae523Open in IMG/M
3300005542|Ga0070732_10755066All Organisms → cellular organisms → Bacteria593Open in IMG/M
3300005566|Ga0066693_10010222All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter2626Open in IMG/M
3300005921|Ga0070766_11316843All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae501Open in IMG/M
3300006034|Ga0066656_10042021All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2602Open in IMG/M
3300006052|Ga0075029_100010617All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae5069Open in IMG/M
3300006052|Ga0075029_100022721All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae3522Open in IMG/M
3300007982|Ga0102924_1042919All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2767Open in IMG/M
3300007982|Ga0102924_1345323All Organisms → cellular organisms → Bacteria577Open in IMG/M
3300009522|Ga0116218_1109304All Organisms → cellular organisms → Bacteria1258Open in IMG/M
3300009623|Ga0116133_1091065All Organisms → cellular organisms → Bacteria771Open in IMG/M
3300009624|Ga0116105_1235546All Organisms → cellular organisms → Bacteria516Open in IMG/M
3300009698|Ga0116216_10640247All Organisms → cellular organisms → Bacteria640Open in IMG/M
3300009764|Ga0116134_1329226All Organisms → cellular organisms → Bacteria524Open in IMG/M
3300009824|Ga0116219_10826537All Organisms → cellular organisms → Bacteria505Open in IMG/M
3300010343|Ga0074044_10601928All Organisms → cellular organisms → Bacteria717Open in IMG/M
3300010375|Ga0105239_10587828All Organisms → cellular organisms → Bacteria1269Open in IMG/M
3300010379|Ga0136449_100421934All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2355Open in IMG/M
3300010398|Ga0126383_10989461All Organisms → cellular organisms → Bacteria929Open in IMG/M
3300012924|Ga0137413_10474344All Organisms → cellular organisms → Bacteria915Open in IMG/M
3300012971|Ga0126369_10154297All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis2163Open in IMG/M
3300012971|Ga0126369_12198141All Organisms → cellular organisms → Bacteria639Open in IMG/M
3300013296|Ga0157374_12773112All Organisms → cellular organisms → Bacteria518Open in IMG/M
3300014164|Ga0181532_10621041All Organisms → cellular organisms → Bacteria586Open in IMG/M
3300014657|Ga0181522_10352864All Organisms → cellular organisms → Bacteria876Open in IMG/M
3300016341|Ga0182035_10677765All Organisms → cellular organisms → Bacteria896Open in IMG/M
3300017933|Ga0187801_10105938All Organisms → cellular organisms → Bacteria1070Open in IMG/M
3300017970|Ga0187783_10047741All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae3163Open in IMG/M
3300017972|Ga0187781_10373887All Organisms → cellular organisms → Bacteria1016Open in IMG/M
3300018013|Ga0187873_1301295All Organisms → cellular organisms → Bacteria588Open in IMG/M
3300018038|Ga0187855_10436416All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae763Open in IMG/M
3300018044|Ga0187890_10687178All Organisms → cellular organisms → Bacteria577Open in IMG/M
3300018085|Ga0187772_10890884All Organisms → cellular organisms → Bacteria646Open in IMG/M
3300018090|Ga0187770_10490345All Organisms → cellular organisms → Bacteria971Open in IMG/M
3300018433|Ga0066667_10069413All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2221Open in IMG/M
3300020580|Ga0210403_11490357All Organisms → cellular organisms → Bacteria509Open in IMG/M
3300020581|Ga0210399_10142810All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis1977Open in IMG/M
3300020583|Ga0210401_10967994All Organisms → cellular organisms → Bacteria710Open in IMG/M
3300021170|Ga0210400_11380004All Organisms → cellular organisms → Bacteria562Open in IMG/M
3300021401|Ga0210393_11040075All Organisms → cellular organisms → Bacteria662Open in IMG/M
3300021402|Ga0210385_10462637All Organisms → cellular organisms → Bacteria959Open in IMG/M
3300021402|Ga0210385_10469926All Organisms → cellular organisms → Bacteria951Open in IMG/M
3300021420|Ga0210394_11771038All Organisms → cellular organisms → Bacteria516Open in IMG/M
3300021432|Ga0210384_10340498All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis1351Open in IMG/M
3300021433|Ga0210391_10916902All Organisms → cellular organisms → Bacteria683Open in IMG/M
3300021433|Ga0210391_11410636All Organisms → cellular organisms → Bacteria535Open in IMG/M
3300021474|Ga0210390_10399953All Organisms → cellular organisms → Bacteria1161Open in IMG/M
3300021477|Ga0210398_10932125All Organisms → cellular organisms → Bacteria695Open in IMG/M
3300021560|Ga0126371_11329143All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae852Open in IMG/M
3300021860|Ga0213851_1017250All Organisms → cellular organisms → Bacteria528Open in IMG/M
3300022724|Ga0242665_10033209All Organisms → cellular organisms → Bacteria1283Open in IMG/M
3300023250|Ga0224544_1024435All Organisms → cellular organisms → Bacteria841Open in IMG/M
3300025320|Ga0209171_10224080All Organisms → cellular organisms → Bacteria1045Open in IMG/M
3300025916|Ga0207663_10548016All Organisms → cellular organisms → Bacteria904Open in IMG/M
3300025922|Ga0207646_10492783All Organisms → cellular organisms → Bacteria1104Open in IMG/M
3300025939|Ga0207665_11505129All Organisms → cellular organisms → Bacteria535Open in IMG/M
3300026305|Ga0209688_1048841All Organisms → cellular organisms → Bacteria798Open in IMG/M
3300026335|Ga0209804_1292677All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae559Open in IMG/M
3300026557|Ga0179587_10451624All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium841Open in IMG/M
3300027109|Ga0208603_1002186All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae3242Open in IMG/M
3300027502|Ga0209622_1053683All Organisms → cellular organisms → Bacteria732Open in IMG/M
3300027516|Ga0207761_1116800All Organisms → cellular organisms → Bacteria519Open in IMG/M
3300027521|Ga0209524_1097447All Organisms → cellular organisms → Bacteria617Open in IMG/M
3300027625|Ga0208044_1162397All Organisms → cellular organisms → Bacteria614Open in IMG/M
3300027768|Ga0209772_10132932All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae776Open in IMG/M
3300027842|Ga0209580_10209838All Organisms → cellular organisms → Bacteria967Open in IMG/M
3300027853|Ga0209274_10424880All Organisms → cellular organisms → Bacteria687Open in IMG/M
3300027867|Ga0209167_10009500All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis4639Open in IMG/M
3300028016|Ga0265354_1010664All Organisms → cellular organisms → Bacteria878Open in IMG/M
3300028017|Ga0265356_1017858All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae767Open in IMG/M
3300028795|Ga0302227_10226286All Organisms → cellular organisms → Bacteria718Open in IMG/M
3300028877|Ga0302235_10242168All Organisms → cellular organisms → Bacteria787Open in IMG/M
3300030007|Ga0311338_10397288All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1481Open in IMG/M
3300030007|Ga0311338_11919772All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae529Open in IMG/M
3300030043|Ga0302306_10088096All Organisms → cellular organisms → Bacteria1206Open in IMG/M
3300030054|Ga0302182_10426281All Organisms → cellular organisms → Bacteria554Open in IMG/M
3300030503|Ga0311370_11334761All Organisms → cellular organisms → Bacteria764Open in IMG/M
3300030509|Ga0302183_10066029All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis1431Open in IMG/M
3300030878|Ga0265770_1140537All Organisms → cellular organisms → Bacteria523Open in IMG/M
3300031090|Ga0265760_10041393All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis1373Open in IMG/M
3300031231|Ga0170824_118970327All Organisms → cellular organisms → Bacteria731Open in IMG/M
3300031231|Ga0170824_128314340All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae572Open in IMG/M
3300031525|Ga0302326_13195876All Organisms → cellular organisms → Bacteria553Open in IMG/M
3300031680|Ga0318574_10680925All Organisms → cellular organisms → Bacteria603Open in IMG/M
3300031708|Ga0310686_103927354All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis1627Open in IMG/M
3300031708|Ga0310686_112903265All Organisms → cellular organisms → Bacteria736Open in IMG/M
3300031715|Ga0307476_10199588All Organisms → cellular organisms → Bacteria1452Open in IMG/M
3300031718|Ga0307474_10247647All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis1364Open in IMG/M
3300031720|Ga0307469_11855348All Organisms → cellular organisms → Bacteria583Open in IMG/M
3300031753|Ga0307477_10714036All Organisms → cellular organisms → Bacteria670Open in IMG/M
3300031754|Ga0307475_10458380All Organisms → cellular organisms → Bacteria1024Open in IMG/M
3300031823|Ga0307478_10036713All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis3570Open in IMG/M
3300031823|Ga0307478_10306058All Organisms → cellular organisms → Bacteria1302Open in IMG/M
3300031823|Ga0307478_10521240All Organisms → cellular organisms → Bacteria991Open in IMG/M
3300031823|Ga0307478_11213660All Organisms → cellular organisms → Bacteria628Open in IMG/M
3300031833|Ga0310917_10982859All Organisms → cellular organisms → Bacteria566Open in IMG/M
3300031962|Ga0307479_11180692All Organisms → cellular organisms → Bacteria729Open in IMG/M
3300031962|Ga0307479_11902195All Organisms → cellular organisms → Bacteria545Open in IMG/M
3300032074|Ga0308173_11151870All Organisms → cellular organisms → Bacteria724Open in IMG/M
3300032076|Ga0306924_10472904All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis1430Open in IMG/M
3300032160|Ga0311301_10451272All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1936Open in IMG/M
3300032205|Ga0307472_101905510All Organisms → cellular organisms → Bacteria593Open in IMG/M
3300032828|Ga0335080_11263987All Organisms → cellular organisms → Bacteria739Open in IMG/M
3300032828|Ga0335080_12374105All Organisms → cellular organisms → Bacteria506Open in IMG/M
3300032895|Ga0335074_10238795All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter2155Open in IMG/M
3300032954|Ga0335083_10421231All Organisms → cellular organisms → Bacteria1136Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil14.16%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil10.62%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa7.96%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil6.19%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland4.42%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil4.42%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil3.54%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil3.54%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil3.54%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil3.54%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil3.54%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland2.65%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland2.65%
Iron-Sulfur Acid SpringEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring2.65%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil2.65%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere2.65%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog1.77%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds1.77%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil1.77%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil1.77%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil1.77%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil1.77%
RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere1.77%
WatershedsEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds0.89%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment0.89%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.89%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil0.89%
Bog Forest SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil0.89%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.89%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.89%
SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Soil0.89%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.89%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.89%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000567Peat soil microbial communities from Weissenstadt, Germany - SII-2010EnvironmentalOpen in IMG/M
3300001471Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2EnvironmentalOpen in IMG/M
3300002245Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027)EnvironmentalOpen in IMG/M
3300002568Grasslands soil microbial communities from Hopland, California, USA - 2EnvironmentalOpen in IMG/M
3300004080Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3EnvironmentalOpen in IMG/M
3300004091Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3EnvironmentalOpen in IMG/M
3300004635Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3EnvironmentalOpen in IMG/M
3300005542Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1EnvironmentalOpen in IMG/M
3300005566Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142EnvironmentalOpen in IMG/M
3300005921Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6EnvironmentalOpen in IMG/M
3300006034Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105EnvironmentalOpen in IMG/M
3300006052Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013EnvironmentalOpen in IMG/M
3300007982Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPM 11 metaGEnvironmentalOpen in IMG/M
3300009522Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaGEnvironmentalOpen in IMG/M
3300009623Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_10EnvironmentalOpen in IMG/M
3300009624Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_10EnvironmentalOpen in IMG/M
3300009698Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaGEnvironmentalOpen in IMG/M
3300009764Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_40EnvironmentalOpen in IMG/M
3300009824Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaGEnvironmentalOpen in IMG/M
3300010343Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1EnvironmentalOpen in IMG/M
3300010375Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaGHost-AssociatedOpen in IMG/M
3300010379Sb_50d combined assemblyEnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300012924Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300013296Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaGHost-AssociatedOpen in IMG/M
3300014164Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaGEnvironmentalOpen in IMG/M
3300014657Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaGEnvironmentalOpen in IMG/M
3300016341Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170EnvironmentalOpen in IMG/M
3300017933Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1EnvironmentalOpen in IMG/M
3300017970Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300017972Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300018013Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_100EnvironmentalOpen in IMG/M
3300018038Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_10EnvironmentalOpen in IMG/M
3300018044Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_10EnvironmentalOpen in IMG/M
3300018085Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018090Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300018433Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116EnvironmentalOpen in IMG/M
3300020580Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-MEnvironmentalOpen in IMG/M
3300020581Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-MEnvironmentalOpen in IMG/M
3300020583Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-MEnvironmentalOpen in IMG/M
3300021170Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-MEnvironmentalOpen in IMG/M
3300021401Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-OEnvironmentalOpen in IMG/M
3300021402Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-OEnvironmentalOpen in IMG/M
3300021420Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-MEnvironmentalOpen in IMG/M
3300021432Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-MEnvironmentalOpen in IMG/M
3300021433Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-OEnvironmentalOpen in IMG/M
3300021474Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-OEnvironmentalOpen in IMG/M
3300021477Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-OEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300021860Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2014 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300022724Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-17-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300023250Peat soil microbial communities from Stordalen Mire, Sweden - 717 P1 10-14EnvironmentalOpen in IMG/M
3300025320Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025916Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025922Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025939Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026305Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142 (SPAdes)EnvironmentalOpen in IMG/M
3300026335Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 (SPAdes)EnvironmentalOpen in IMG/M
3300026557Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungalEnvironmentalOpen in IMG/M
3300027109Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF008 (SPAdes)EnvironmentalOpen in IMG/M
3300027502Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_M2 (SPAdes)EnvironmentalOpen in IMG/M
3300027516Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 34 (SPAdes)EnvironmentalOpen in IMG/M
3300027521Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300027625Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027768Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM1 (SPAdes)EnvironmentalOpen in IMG/M
3300027842Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027853Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes)EnvironmentalOpen in IMG/M
3300027867Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300028016Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1Host-AssociatedOpen in IMG/M
3300028017Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4Host-AssociatedOpen in IMG/M
3300028795Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N1_1EnvironmentalOpen in IMG/M
3300028877Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N3_3EnvironmentalOpen in IMG/M
3300030007I_Palsa_E1 coassemblyEnvironmentalOpen in IMG/M
3300030043Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E3_1EnvironmentalOpen in IMG/M
3300030054Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_1EnvironmentalOpen in IMG/M
3300030503III_Palsa_E3 coassemblyEnvironmentalOpen in IMG/M
3300030509Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_2EnvironmentalOpen in IMG/M
3300030878Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031090Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031231Coassembly Site 11 (all samples) - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031525Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3EnvironmentalOpen in IMG/M
3300031680Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22EnvironmentalOpen in IMG/M
3300031708FICUS49499 Metagenome Czech Republic combined assemblyEnvironmentalOpen in IMG/M
3300031715Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05EnvironmentalOpen in IMG/M
3300031718Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05EnvironmentalOpen in IMG/M
3300031720Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515EnvironmentalOpen in IMG/M
3300031753Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515EnvironmentalOpen in IMG/M
3300031754Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515EnvironmentalOpen in IMG/M
3300031823Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05EnvironmentalOpen in IMG/M
3300031833Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178EnvironmentalOpen in IMG/M
3300031962Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515EnvironmentalOpen in IMG/M
3300032074Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R1EnvironmentalOpen in IMG/M
3300032076Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2)EnvironmentalOpen in IMG/M
3300032160Sb_50d combined assembly (MetaSPAdes)EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300032828Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4EnvironmentalOpen in IMG/M
3300032895Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3EnvironmentalOpen in IMG/M
3300032954Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI12270J11330_1025813723300000567Peatlands SoilHLRRAPELYFRLDRAEQDKARVEELLAREKKRNKTRKEPR*
JGI12712J15308_1000824833300001471Forest SoilELYFRLDRAEREKARVEQLLERAKKRNKAHSDAGRRKA*
JGIcombinedJ26739_10036523433300002245Forest SoilLYFRLDRAEREKARVEQLLERAKKRNKAHSDAGRRKA*
C688J35102_11914897223300002568SoilAPELIFRLDRAELDKARVEELLGRAKKRAKARKQSSGEKA*
Ga0062385_1012431313300004080Bog Forest SoilLRRAPELHFRLDRSEREKARVEELLERSKKRMKAHTKTSEKKA*
Ga0062387_100000128133300004091Bog Forest SoilRRAPELVFRLDHAEREKARVEELLARAKKRNKARREPGAEKASAKE*
Ga0062388_10270031813300004635Bog Forest SoilRHELVERLRRRRAPELYFRLDRSDREKARVEELLARAKKRIKARTGSSSQKKA*
Ga0070732_1075506613300005542Surface SoilELVERLRLRRAPELYFRLDRAEQEKARVEELLARAKKRAKAHKDTGGKKA*
Ga0066693_1001022213300005566SoilHELVERLRIRRAPELFFRLDRAEQAKARVEQLLQRSRKRANIRKQSGGEKA*
Ga0070766_1131684323300005921SoilRHELVERLRIRRAPELYFRLDRAEQAKARVEELLQREKRRRKPHKESSGEQA*
Ga0066656_1004202133300006034SoilELVERLRIRRAPELFFRLDRAEQAKARVEQLLQRSRKRANIRKQSGGEKA*
Ga0075029_10001061763300006052WatershedsDRLRLRRSPELVFRLDRSEHEKARVEELLARTKKRSKTAKKARK*
Ga0075029_10002272113300006052WatershedsVERLRIRRAPELYFRLDRAEQDKARVEELLGRAKKRRKARKQSSQERA*
Ga0102924_104291913300007982Iron-Sulfur Acid SpringRLRLRRAPELYFRLDRSEREKARGEELLARAKKRMKSHAKPGAGKA*
Ga0102924_134532313300007982Iron-Sulfur Acid SpringAPELYFRLDRAEQEKARVEQLLARAKKRSKAPKEPGGKKA*
Ga0116218_110930423300009522Peatlands SoilPELYFRLDRAEQEKARVEELLARAKKRSKTRKEPSGEKRP*
Ga0116133_109106513300009623PeatlandDRSEREKARVEELLARAKKRMKAHAASAAKSEKKA*
Ga0116105_123554623300009624PeatlandFRLDRAEQEKARVEELLARAKKRNKIRKDPGGKKA*
Ga0116216_1064024723300009698Peatlands SoilRLDRSEREKARVEELLARAKRRSKARKEPGAKKA*
Ga0116134_132922613300009764PeatlandLRRAPELYFRLDRAEQDKARVEELLAREKKRKKTRKEPR*
Ga0116219_1082653713300009824Peatlands SoilRRAPELYFRLDRAEQDKARVEELLAREKKRNKTRKEPR*
Ga0074044_1060192823300010343Bog Forest SoilRLDRSERKKARVEELLARAKKRMKTRTGSGEKKA*
Ga0105239_1058782813300010375Corn RhizospherePELFFRLDRAEQAKGRVEQLLQRSRKRGNSRKERGGEKA*
Ga0136449_10042193433300010379Peatlands SoilRAPELFFRLDRSEREKARVEELLARAKKRMKSRTKTGGEKV*
Ga0126383_1098946113300010398Tropical Forest SoilRLRIRRAPELSFRLDRAEQAKARVEELLQRAKRRSKQT*
Ga0137413_1047434413300012924Vadose Zone SoilLYFRLDRSEREKARVEELLARAKKRIKARAKSGEKKA*
Ga0126369_1015429733300012971Tropical Forest SoilYFRLDRAEQDKARVEELLERAKKRNKNRKPSSEERA*
Ga0126369_1219814113300012971Tropical Forest SoilRLRIRRAPELYFRLDRAEQAKARVEELLERTKKKRNKTQKDASGNQA*
Ga0157374_1277311213300013296Miscanthus RhizospherePELFFRLDRAEQAKARVEELLQRSRKRGNIRKERGGGKA*
Ga0181532_1062104113300014164BogPELIFRLDRAELEKARVETLLERARKRSKRKDAGGQKT*
Ga0181522_1035286423300014657BogELVERLHLRRAPELYFRLDRAEQDKARVEELLARQKKRNKPRKEPGGKNQ*
Ga0182035_1067776513300016341SoilIRHELVERLRIRRAPELNFRLDRAEQAKARVEELLERARRRSKPRKESSGQQG
Ga0187801_1010593823300017933Freshwater SedimentLRIRRAPELYFRLDRAEQAKARVDELLERAKKRSKAHKESSGGQA
Ga0187783_1004774133300017970Tropical PeatlandAPELYFRLDRAEQAKARVEELLERARKRAKAHKEASGDKA
Ga0187781_1037388723300017972Tropical PeatlandLRRAPELFFRLDRAERDKARIEELLERAKRRSKVRKESGGEKA
Ga0187873_130129523300018013PeatlandLYFRLDRAEQEKARVEELLARAKKRSKARKEPSGKKA
Ga0187855_1043641623300018038PeatlandHELVERLRRRRAPELYFRLDRAEREKARVEELLARAKKRMKSKTKAGGEKA
Ga0187890_1068717813300018044PeatlandRLDRSEREKARVEELLARAKKRMKAHAASAAKSEKKA
Ga0187772_1089088413300018085Tropical PeatlandLRRAPELFFRLDREERDKARVEELLERAKNRSKARREPGKEASGEKA
Ga0187772_1148790913300018085Tropical PeatlandIRHELAERLRLRRAPELFFRLDRAERDKARVEELLERAGKKHKARREPSKENSGETA
Ga0187770_1049034513300018090Tropical PeatlandHELVERLHLRRAPELYFRLDRAEQDKARVEELLERAKKRTKARKKEASGDMA
Ga0066667_1006941333300018433Grasslands SoilHELVERLRIRRAPELYFRLDRAEEAKARVEELLQRSRKRANIRKQSGGEKA
Ga0210403_1149035713300020580SoilRRAPELVFRLDRAELEKARVEELLARAKKRDKARKDSGGKKA
Ga0210399_1014281033300020581SoilYFRLDRAEQEKARVEELLARAKKRNKARKESGGKKA
Ga0210401_1096799423300020583SoilRAPELYFRLDRAEQEKARVEELLARAKKRNKARKESGGKKA
Ga0210400_1138000423300021170SoilRAPELYFRLDRSEREKARVEELLARAKKRMKSRSTPGTGKA
Ga0210393_1104007523300021401SoilLYFRLDRSEREKARVEELLARAKKRMKSRSGPGEKKA
Ga0210385_1046263723300021402SoilLVFRLDRAELEKARVEELLARAKKRDKARKDSGGKKA
Ga0210385_1046992613300021402SoilRLRRARELYFRLDRSEREKARVEELQARAKKRMKSHPGAGEKKA
Ga0210394_1177103823300021420SoilYFRLDRAEQDKARVEELLNRSKKRMKARKDASGKKS
Ga0210384_1034049833300021432SoilPELYFRLDRSEREKARVEELLARAKKRMKSRTRTNGEKA
Ga0210391_1091690223300021433SoilFRLDRAEQEKARVEELLARAKKRSKVRKEPGGKKP
Ga0210391_1141063623300021433SoilPELHFRLDRSEREKARVEELLARAKKRMKPRAKPDQEKA
Ga0210390_1039995323300021474SoilRIRRAPELYFRLDRAEQAKARVEELLQREKRRRKPHKESSGEQA
Ga0210398_1093212513300021477SoilAPELYFRLDRAEQEKARVEELLARAKKRSKTGKASSGKKA
Ga0126371_1132914323300021560Tropical Forest SoilHEVADRLRLRRAPELFFRLDRSEREKARVEELLDRVKKRSKPHKGTGGENA
Ga0213851_101725013300021860WatershedsIRHELADRLRLRRSPALVFRLDRSAREKARVEELLARAKKRAKTAKKPRK
Ga0242665_1003320913300022724SoilGEPPELYFRLDRAEQAKARVEELLQREKRRRKPHKESSGEQA
Ga0224544_102443513300023250SoilERLRIRRAPELFFRLDRSEREKARVEELLARAKKRMKSHAGPGEKKA
Ga0209171_1022408023300025320Iron-Sulfur Acid SpringELVERLHLRRAPELYFRLDRAEQEKARVEELLARAKKRNKARKESGGKKA
Ga0207663_1054801623300025916Corn, Switchgrass And Miscanthus RhizosphereFRLDRAEQSKARVEELLDRAKRRRKPHKESSGEQA
Ga0207646_1049278323300025922Corn, Switchgrass And Miscanthus RhizosphereLHLRRAPELYFRLDRMEQEKARVEELLARAKKRIKARKEPGGKKA
Ga0207665_1150512923300025939Corn, Switchgrass And Miscanthus RhizospherePELYFRLDRAELDKARVEELLARTQKRNKARKDARGDKA
Ga0209688_104884123300026305SoilHELVERLRIRRAPELFFRLDRAEQAKARVEQLLQRSRKRANIRKQSGGEKA
Ga0209804_129267713300026335SoilEYIKHELVERLRRRRAPELYFRLDRSEREKARVEELLARAKKRMKARANPGEKKA
Ga0179587_1045162423300026557Vadose Zone SoilVERLRLRKAPELIFRLDRAELEKARVEELLARAKKRNKARKQNESTKA
Ga0208603_100218613300027109Forest SoilRRAPELYFRLDRSEREKARVEELLARAKKRMKTRTGSGEKKA
Ga0209622_105368313300027502Forest SoilLYFRLDRAEQAKARVEELLQREKRRRKPRKESSGDQA
Ga0207761_111680013300027516Tropical Forest SoilRLRRAPELIFRLDRAEQEKARVEELLARAKKRSKSGKENSGEKA
Ga0209524_109744713300027521Forest SoilPELYFRLDRAEQEKARVEELLARAKKRSKARKEPGGKKA
Ga0208044_116239723300027625Peatlands SoilLRRAPELYFRLDRAEQEKARVEELLARAKKRSKTRKEPSGEKRP
Ga0209772_1013293223300027768Bog Forest SoilRHELVERLRRRRAPELYFRLDRSEREKARVEELLARAKKRMKSHAKSGVKKR
Ga0209580_1020983813300027842Surface SoilLYFRLDRAEQEKARVEELLARAKKRTKAQKDSGGKKA
Ga0209274_1042488023300027853SoilPELYFRLDRSEREKARVEELLARAKKRMKSRAKPGLEKA
Ga0209167_1000950063300027867Surface SoilRLRIRRAPELYFRLDRSEREKARVEELLERAKKRTKTRAAAGKKKA
Ga0265354_101066413300028016RhizosphereLRRRRAPELYFRLDRSEREKARVEELLARAKKRMKSRSGPGEKKA
Ga0265356_101785823300028017RhizosphereIRHELVERLRRRRAPELYFRLDRSEREKARVEELLARAKKRAKAHLSSGEKKKA
Ga0302227_1022628623300028795PalsaAPELHFRLDRSEREKARVEELLARAKKRMKTRAGSSEKKA
Ga0302235_1024216823300028877PalsaERLRLRRAPELYFRLDRSEREKARVEELLARAKKRMKSRTKPGAEKA
Ga0311338_1039728843300030007PalsaLRRAPELVFRLDRAELEKARVEELLARAKKRNKARKESR
Ga0311338_1191977223300030007PalsaELVERLRLRRAPELLFRLDRAEREKARVEQLLERAKKRNKARKDASGGKA
Ga0302306_1008809623300030043PalsaELVERLRLRRAPELVFRLDRAELEKARVEELLARAKKRNKTRKETGGKKA
Ga0302182_1042628113300030054PalsaAPELYFRLDRSEREKARVEELLARAKKRMKSRAGPGKKKA
Ga0311370_1133476123300030503PalsaLRLRRAPELIFRLDRAELEKARVEELLARTKKRDKARKAAGSKKA
Ga0302183_1006602933300030509PalsaRAPELYFRLDRSEREKARVEELLARAKKRMKSRAGPGKKKA
Ga0265770_114053723300030878SoilRAPELVFRLDRAELEKARVEELLARAKKRDKARKDSGGKKA
Ga0265760_1004139333300031090SoilVERLRLRRAPELYFRLDRAEREKARVEQLLERAKKRNKARADAGERKA
Ga0170824_11897032713300031231Forest SoilPELYFRLDRAELDKARVEELLDRSKKRSKQRKDASAGKP
Ga0170824_12831434023300031231Forest SoilRHELVERLRLRRAPELYFRLDRSEREKARVEELLARAKKRMKARSKASGEKA
Ga0302326_1319587623300031525PalsaELVERLRLRRAPELYFRLDRAEREKARVEQLLERAKKRNKACADAGKRKA
Ga0318574_1068092523300031680SoilELYFRLDRAEQDKARVEELLERAKKRSKPRKDASGKKA
Ga0310686_10392735433300031708SoilERLRRRRAPELYFRLDRSEREKARVEELLARAKKRAKAHANPSEKKKA
Ga0310686_11290326523300031708SoilELADRLRLRRAPELHFRLDRSEREKARVEELLARAKKRMKPRTRPGQEKV
Ga0307476_1019958813300031715Hardwood Forest SoilVFRLDRAEQDKARVEQLLDRAKKRNKARKEARGEKA
Ga0307474_1024764713300031718Hardwood Forest SoilAPELYFRLDRSEREKARVEELLARAKKRTKSRTGSNDKKA
Ga0307469_1185534823300031720Hardwood Forest SoilFRLDRAEQAKARVEELLGRTKKRNKTRKGTSGHQT
Ga0307477_1071403623300031753Hardwood Forest SoilAPELYFRLDRAEQEKARVEELLARAKKRAKAHKDTGGKKA
Ga0307475_1045838023300031754Hardwood Forest SoilLDRSEREKARVEELLARAKKRMKSHVGSGEKKAEKKA
Ga0307478_1003671313300031823Hardwood Forest SoilRLRRRRAPELYFRLDRSEREKARVEELLARAKKRLKARAEPGEKKA
Ga0307478_1030605833300031823Hardwood Forest SoilLVERLRIRRAPELYFRLDRAEQAKARVEELLQREKRRRKPHKESSGEQA
Ga0307478_1052124013300031823Hardwood Forest SoilERLRLRRAPELYFRLDRSEREKARVEELLARAKKRMKSHTNQGAKKA
Ga0307478_1121366023300031823Hardwood Forest SoilERLRIRRAPELYFRLDRAEQDKARVEQLLERSKKRKKSRGETSGKKA
Ga0310917_1098285923300031833SoilIRHELVERLRIRRAPELYFRLDRAEQAKARVEELLQRTKKRSKQA
Ga0307479_1118069213300031962Hardwood Forest SoilHELVERLRIRRAPELYFRLDRAEQAKARVEELLQREKRRRKPHKESSGEQA
Ga0307479_1190219513300031962Hardwood Forest SoilVERLHLRRAPELYFRLDRAEQEKARVEELLARAKKRDKARKEPGGKKE
Ga0308173_1115187023300032074SoilLFFRLDRAEQAKARVEELLQRSRKRANMRKERGGEKA
Ga0306924_1047290413300032076SoilKAPELYFRLDRAEQDKARVEELLERAKKRSKPRKDASGKKA
Ga0311301_1045127213300032160Peatlands SoilLRLRRAPELFFRLDRSEREKARVEELLARAKRRSKARKEPGAKKA
Ga0307472_10190551013300032205Hardwood Forest SoilELVERLRIRRAPELYFRLDRAEQSKARVEELLDRAKRRRKPHKESSGEQA
Ga0335080_1126398723300032828SoilLVERLRIRRAPELYFRLDRAEQDKARVEELLERTKKRNKVRKESSEERA
Ga0335080_1237410513300032828SoilAPELYFRLDRAEQDKARVEELLERAKKRNKARKEARGDQA
Ga0335074_1023879533300032895SoilPELFFRLDRSEREKARVEELLARAKKRSKSILGGNQKKA
Ga0335083_1042123113300032954SoilVERLRIRRAPELIFRLDRAEQAKARVEELLERSKKRSKPRKDASGTKP

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.