Basic Information | |
---|---|
Family ID | F083480 |
Family Type | Metagenome |
Number of Sequences | 112 |
Average Sequence Length | 38 residues |
Representative Sequence | QAVEVDRIDAAVLAEELAEIYSTPTPKGWPEPKK |
Number of Associated Samples | 57 |
Number of Associated Scaffolds | 112 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Unclassified |
% of genes with valid RBS motifs | 0.93 % |
% of genes near scaffold ends (potentially truncated) | 87.50 % |
% of genes from short scaffolds (< 2000 bps) | 93.75 % |
Associated GOLD sequencing projects | 57 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.37 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Unclassified (93.750 % of family members) |
NCBI Taxonomy ID | N/A |
Taxonomy | N/A |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Miscanthus Phyllosphere (93.750 % of family members) |
Environment Ontology (ENVO) | Unclassified (94.643 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant surface (94.643 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 20.97% β-sheet: 0.00% Coil/Unstructured: 79.03% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.37 |
Powered by PDBe Molstar |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
Unclassified | root | N/A | 93.75 % |
All Organisms | root | All Organisms | 6.25 % |
Visualization |
---|
Powered by ApexCharts |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Miscanthus Phyllosphere | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Miscanthus Phyllosphere | 93.75% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.68% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.89% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.89% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.89% |
Switchgrass Phyllosphere | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere | 0.89% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Host-Associated | Open in IMG/M |
3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Host-Associated | Open in IMG/M |
3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Host-Associated | Open in IMG/M |
3300015267 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015269 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015274 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015275 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015276 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015277 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015279 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015281 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015282 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015285 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015286 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015287 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015288 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015295 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015296 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015300 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015302 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015303 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015305 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015307 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015308 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015313 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015314 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015321 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015322 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015323 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015341 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015342 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015344 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015345 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015346 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015351 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015355 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015361 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017404 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017407 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017409 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017410 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017411 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017413 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017417 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_07NOV2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017424 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017425 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017430 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017433 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017436 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017438 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017442 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017443 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017683 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017684 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017690 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
Ga0070673_1013676271 | 3300005364 | Switchgrass Rhizosphere | VEVDRIDAAILAEELTEIYSTPTPKGWPEPKKVIDFVFD* |
Ga0070672_1015116511 | 3300005543 | Miscanthus Rhizosphere | VEVDRIDAAILAEELTEIYSTPTPKGWLEPKKVN*PVFD |
Ga0157378_115757082 | 3300013297 | Miscanthus Rhizosphere | VVQQAVEVDRIDVAILAEELAKIYSTPTPKGWSELKK* |
Ga0157378_123201501 | 3300013297 | Miscanthus Rhizosphere | YLQQAVEVDQIDAGVLAKELAEIYSTITPKGWPEPKK* |
Ga0157377_115643491 | 3300014745 | Miscanthus Rhizosphere | AVEVDRIDAVILAEELAEIYSTPTPKGWPEPKNN* |
Ga0182122_10403621 | 3300015267 | Miscanthus Phyllosphere | GTYRQAVEVDRIDAAVLAEELVEIYSTPTPKGWSEPKK* |
Ga0182113_10424261 | 3300015269 | Miscanthus Phyllosphere | HDGTYRQAVEVDRIDAAVLAEELAEIYSTPTPKGWPKPKKVIEFVFN* |
Ga0182188_10347631 | 3300015274 | Miscanthus Phyllosphere | QQAVEVDRIDAAVLAEELTEIYSTPTPKRWPESKK* |
Ga0182188_10474621 | 3300015274 | Miscanthus Phyllosphere | P*LYLQQAVEVDWIDAAVLAEELAEIYSTPTPKGWPEPKK* |
Ga0182172_10343971 | 3300015275 | Miscanthus Phyllosphere | YLQQAVEVDRIDAAVLAEELAEIYSTPTPKGWPEPKK* |
Ga0182172_10364082 | 3300015275 | Miscanthus Phyllosphere | YLQQAVKVDRIDAAVPAKELAEIYSTPTPKGWPEPKK* |
Ga0182172_10645641 | 3300015275 | Miscanthus Phyllosphere | IQVVEVYRIDATVLAEELTEIYSTPTPKGWPEPKK* |
Ga0182170_10374522 | 3300015276 | Miscanthus Phyllosphere | VEVDRIDAAILAEELVEIYSTPTPKGWPEPKKVIDFVFD* |
Ga0182170_10554881 | 3300015276 | Miscanthus Phyllosphere | RYLQQAVEVDRIDATVLAEELAEIYSTPTPKGWLEPKK* |
Ga0182128_10061721 | 3300015277 | Miscanthus Phyllosphere | TYRQAVEVDRIDAAILAEELAKIYSTPTPKGWPEQKKSN* |
Ga0182174_10352101 | 3300015279 | Miscanthus Phyllosphere | DRIDAAVLAEELVEIYSTPTPKGWPEPKKVIDLYLID* |
Ga0182160_10458571 | 3300015281 | Miscanthus Phyllosphere | GTYRQAVEVDRIDAAILAEELAEIYSTPTPKGWLKPKK* |
Ga0182124_10467721 | 3300015282 | Miscanthus Phyllosphere | LQQAVEVDQINADVLAEELTEIYSTPTPKGWLEPKKK* |
Ga0182124_10571732 | 3300015282 | Miscanthus Phyllosphere | YRQAVEVNRIDAAVLAEELAEIYSTPTPKGCPEPKKVN* |
Ga0182186_10004784 | 3300015285 | Miscanthus Phyllosphere | YRQAMEVNRIDAAVLAEELVEIYSTPTPKGWSEPKKSK* |
Ga0182176_10318921 | 3300015286 | Miscanthus Phyllosphere | RQAVEVDRIDAAILAEELAEIYSTPTPKGWLEPKKVIDLY* |
Ga0182171_10321832 | 3300015287 | Miscanthus Phyllosphere | TYRQAVEVDRIDVAILAEELVEIYSTPTPKGWPEPKK* |
Ga0182173_10067231 | 3300015288 | Miscanthus Phyllosphere | QQAVEVNRIDAVVLAEKLAEIYSTPTPKGWPKEKK* |
Ga0182173_10566712 | 3300015288 | Miscanthus Phyllosphere | IDAAVLAEELAEIYSTPTPKRWPEPKKVIAFVFD* |
Ga0182173_10800651 | 3300015288 | Miscanthus Phyllosphere | QQAVEVDQIDAAILAVELTEIYSTPTPKGWPEPKK* |
Ga0182175_10494731 | 3300015295 | Miscanthus Phyllosphere | TYRQVVEVVRIDAAVLAEELARIYSTPTPKGWPEPKKVNN* |
Ga0182175_10638111 | 3300015295 | Miscanthus Phyllosphere | LQQAVEVDWIDVAILAEELTEIYSTPTPKGLSEPKK* |
Ga0182175_10656302 | 3300015295 | Miscanthus Phyllosphere | QAVDVDRIDAAVLAEELAEIYSTPTPKGWPEPKK* |
Ga0182175_10885901 | 3300015295 | Miscanthus Phyllosphere | VEVDWIDAAVLAEELAEIYSTPTPKGWLEPKKVFDFVFD* |
Ga0182157_10226591 | 3300015296 | Miscanthus Phyllosphere | TCRQAVEVDRIDVAILAEELTEIYSTPTSKGWPEPKKIN* |
Ga0182157_10665842 | 3300015296 | Miscanthus Phyllosphere | EVNWIDVAILAEELAEIYSAPTPKGWPKPKKVIDFVFV* |
Ga0182108_10271871 | 3300015300 | Miscanthus Phyllosphere | VEVDRIDAAVLAEELTEIYSTPTPKGWLEPKKSN* |
Ga0182108_10682661 | 3300015300 | Miscanthus Phyllosphere | LTYTRVAVEVDRIDAAVLAEELAEIYSTPTPKGWPEPKK* |
Ga0182108_10972791 | 3300015300 | Miscanthus Phyllosphere | SQQAVEVDRIDTAVLAKELAKINSTPTPKGWPEPKK* |
Ga0182143_10321131 | 3300015302 | Miscanthus Phyllosphere | MEVYQIDTTILAEELTEIYSTPTPKGWPEPKKKVIDFVFDWFMSLQ* |
Ga0182143_10563711 | 3300015302 | Miscanthus Phyllosphere | RQAVEVDRIDTAVLAEELTEIYSTPTPKGWPEPKKSN* |
Ga0182143_10924962 | 3300015302 | Miscanthus Phyllosphere | VEVDRIDAAVLAEELTEIYSTSTPKGWPEPKKIN* |
Ga0182123_10268851 | 3300015303 | Miscanthus Phyllosphere | LQQAVEVNRIDAAILAEELAEIYSTPTPKGWPKPKK* |
Ga0182158_10102232 | 3300015305 | Miscanthus Phyllosphere | VEVDRIDAAVLAEELAEIYSTPTPKGWLEPKKVIDLYLD* |
Ga0182144_10761262 | 3300015307 | Miscanthus Phyllosphere | VEVDRIDATVVAEELAEIYSTPTPKGWPEPKKVIDFVFD* |
Ga0182144_10776141 | 3300015307 | Miscanthus Phyllosphere | LQQAVEVDQIDAAVLAEELAEIYSTPTPKGWPEPKK* |
Ga0182142_10233272 | 3300015308 | Miscanthus Phyllosphere | QAVEVDRIDVVVLAEELAEIYSTPTPKGWPEPKK* |
Ga0182142_10340361 | 3300015308 | Miscanthus Phyllosphere | QAVEVDRIDAAIVAKEFSEIYSTPTLKGWSEPKK* |
Ga0182164_10301161 | 3300015313 | Switchgrass Phyllosphere | VEVDRIDAAILAEELAEIYSTPTPKGWPKPKKVIDFVFD* |
Ga0182140_10070771 | 3300015314 | Miscanthus Phyllosphere | DGTCRQAVEVDRIDVAILAEKLTEIYSTPTSKGWPEPKKIN* |
Ga0182127_10391841 | 3300015321 | Miscanthus Phyllosphere | QAVEVDRINVVVLAKELAKIYSTPTPKGWPEPKK* |
Ga0182110_10869661 | 3300015322 | Miscanthus Phyllosphere | QAVEVDRIDAAVLAEELIEIYSTPTPKGWPEPKK* |
Ga0182110_11035701 | 3300015322 | Miscanthus Phyllosphere | GTYKQAVEVDRIDVVVLAEELTEIYSTPTPKGWPEPK* |
Ga0182110_11260831 | 3300015322 | Miscanthus Phyllosphere | VDQIDAAVLAEELAEIYSTPTPKGWPEPKKVIDLY* |
Ga0182129_10820422 | 3300015323 | Miscanthus Phyllosphere | VEVDQIDAAVLAEELAEIYSTPTPKGWLELKKVIDLY* |
Ga0182187_10369531 | 3300015341 | Miscanthus Phyllosphere | VEVDRIDAAILAEELTEIYSTPTLKGCPEPKKIN* |
Ga0182187_11196341 | 3300015341 | Miscanthus Phyllosphere | VEVDRIDVAVLIEELAEIYSTPTPKGWPELKKVSNLYLID |
Ga0182109_11461051 | 3300015342 | Miscanthus Phyllosphere | AVEVDRIDAAILAEELAEIYSTPTPKGWPEPKKK* |
Ga0182109_11522411 | 3300015342 | Miscanthus Phyllosphere | VEVDRIDAAILAEELAKIYSTPTPKGWLEPKKVIDLY* |
Ga0182109_11836242 | 3300015342 | Miscanthus Phyllosphere | TYRQAVEVDRIDAAVLAEELAEIYSTPTPKGRPKPKK* |
Ga0182109_12032662 | 3300015342 | Miscanthus Phyllosphere | GTYRQAVEVDRIDAAVLAEELIEIYSTPTPKGWPKPKKVNN* |
Ga0182109_12114671 | 3300015342 | Miscanthus Phyllosphere | AVKVDRIDAAVVAEELVEIYSTPTPKGWPEPKKVN* |
Ga0182189_10018604 | 3300015344 | Miscanthus Phyllosphere | TYRQAVEVNRIDAAVLAEELAEIYYTPTPKGWPEPKK* |
Ga0182189_11286591 | 3300015344 | Miscanthus Phyllosphere | QAVEVDRIDAVVLAEELAKIYSTPTPKGWTEPKK* |
Ga0182189_11804041 | 3300015344 | Miscanthus Phyllosphere | QVVEVDRIDAAILAEELAEIYSTPTPKGWLEPKK* |
Ga0182189_11854251 | 3300015344 | Miscanthus Phyllosphere | YLQQAVEVDRIDAAILPEELAKIYSTPTPNGWPKPKK* |
Ga0182189_12205001 | 3300015344 | Miscanthus Phyllosphere | YLQQEVEVDRIDATVLAEELTEIYSTPTPKGWQEPKK* |
Ga0182111_10611001 | 3300015345 | Miscanthus Phyllosphere | QAVEVDRIDAAVLAEELAEIYSTPTPKGWPEPKK* |
Ga0182111_11888211 | 3300015345 | Miscanthus Phyllosphere | VEVDRIDAAILAEELAEIYSTPTPKGWLETKKVIDLY* |
Ga0182139_12286641 | 3300015346 | Miscanthus Phyllosphere | YRQAVEVDWIDAAILAEELTEIYSTPTPKGWPEPKR* |
Ga0182161_10823871 | 3300015351 | Miscanthus Phyllosphere | YLQQAVEVDRIDAAILAEELTEIYSTPTPKGWPEPKK* |
Ga0182161_12406262 | 3300015351 | Miscanthus Phyllosphere | VEVDRIDAAVLAEELAEIYSTPTPKGWPEPKKVIDLYCID* |
Ga0182159_13315152 | 3300015355 | Miscanthus Phyllosphere | MMVLRQAVEVDRIDAVVLAEELAEIYCTPTPKGCPEQKKNK* |
Ga0182145_10881002 | 3300015361 | Miscanthus Phyllosphere | QQTVEVDRIDAAVLAEELAEIYSTPTPKGWPEPKKVIDLY* |
Ga0182145_10976831 | 3300015361 | Miscanthus Phyllosphere | VEVDRIDAAVLAEELAEIYSTPTPKGWPEPKKVIDLY |
Ga0182145_11273501 | 3300015361 | Miscanthus Phyllosphere | GTYRQAVEVDRIDAAILAEELAEIYSTSTPKRWPEPKKVIDFVFD* |
Ga0182203_10465771 | 3300017404 | Miscanthus Phyllosphere | TYRQAVEVDRIDAAILAEELAKIYSTPTPKGWPEPKK |
Ga0182203_10535791 | 3300017404 | Miscanthus Phyllosphere | VEVDRIDAAILAEELAEIYSTPTPKGWPKPKKVIDFVFD |
Ga0182203_11243931 | 3300017404 | Miscanthus Phyllosphere | YKQAVQVDWIDAAVLAKELIEIYSTPTPKGWLKPKK |
Ga0182220_10618081 | 3300017407 | Miscanthus Phyllosphere | YLQQAVEVDRIDAVVLAEEHTEIYSTPTPMGWPKPKK |
Ga0182220_10648281 | 3300017407 | Miscanthus Phyllosphere | GINHDRTYRQAAEVDRIDVAILAEELTEIYSTPTPKGWPEPKK |
Ga0182220_10904001 | 3300017407 | Miscanthus Phyllosphere | YRQAVEVDRIDAAVLAEELADIYSTPTPKGWPEPKK |
Ga0182204_10534471 | 3300017409 | Miscanthus Phyllosphere | PXWYLQQAVEVDRIDAAVLAEELAEINSTPTPKGXPEPKK |
Ga0182207_10327791 | 3300017410 | Miscanthus Phyllosphere | QQAVEVDRIDAAVLAEELTEIYSTPTPKGWPEPKR |
Ga0182208_10631831 | 3300017411 | Miscanthus Phyllosphere | GTYRQAVEVDRIDAAVLAEELAEIYSTPTPKGWPKPKK |
Ga0182222_10874941 | 3300017413 | Miscanthus Phyllosphere | LQQAVEVDRINATVLAEELTEIYSTPTPKGWPEPKKCN |
Ga0182230_10489871 | 3300017417 | Miscanthus Phyllosphere | VEVNRIDAAVLAEELAEIYSTPTPKGWPEPKKVIDFVFD |
Ga0182219_10611231 | 3300017424 | Miscanthus Phyllosphere | KQAVEVDRIDAAVLAEELAEIYSTPTPKGWPEPKKVIDFVFD |
Ga0182219_10857941 | 3300017424 | Miscanthus Phyllosphere | YLQQAVEVDWIDAVVLAEELAEIYSTPTPKGWPEPKK |
Ga0182219_11140072 | 3300017424 | Miscanthus Phyllosphere | TYRQAVEVDLIYTTILAEERAEIYSTPTPKGWPKPKK |
Ga0182224_10486482 | 3300017425 | Miscanthus Phyllosphere | RQAVEVDRIDTVVLAEELTEIYSTPTPKGWPEPKK |
Ga0182224_10529123 | 3300017425 | Miscanthus Phyllosphere | RIDAAILAEELAEIYSTPTPKGWLEPKKVIDLYLD |
Ga0182224_10737501 | 3300017425 | Miscanthus Phyllosphere | LQQAVEVDRIDAAVLAKELAEIYSTPIPKGWSDPKK |
Ga0182192_10542631 | 3300017430 | Miscanthus Phyllosphere | IQVVEVDGIDAAVLAEELAEIYSTTPKGWPELKKVNNFVFD |
Ga0182206_10400392 | 3300017433 | Miscanthus Phyllosphere | YRQAVEVDRIDATILAEELAEIYYTPTLKGWLEPKKVI |
Ga0182206_10996771 | 3300017433 | Miscanthus Phyllosphere | AVEVDRIDAAVLAEEQAEIYSTPTPKGWPEPKKVIDLYLID |
Ga0182206_11060321 | 3300017433 | Miscanthus Phyllosphere | VEVDQSDAAILAEELTEIYCTPTPKGWPDPKKVIDFVFDWLM |
Ga0182209_10413832 | 3300017436 | Miscanthus Phyllosphere | YLQQAVEVDRIDAAVFAEELAEIYSTPTPKGWLEPKK |
Ga0182209_10733582 | 3300017436 | Miscanthus Phyllosphere | YLQQAVEVDRIDAAILAKELTEIYSTPTPKGWPELKK |
Ga0182209_11157032 | 3300017436 | Miscanthus Phyllosphere | QAVEVDRIDTAVLAEELTEIYSTHTPKGWPEPKKSN |
Ga0182191_11269721 | 3300017438 | Miscanthus Phyllosphere | QQAVEVDWINAVILAKELAEIYSTPTPKGWLEPKK |
Ga0182191_11426021 | 3300017438 | Miscanthus Phyllosphere | SHDGTYRQAVKVDRIDVAVLAEELVEIYSTPTPKGWSEPKK |
Ga0182191_11695351 | 3300017438 | Miscanthus Phyllosphere | VEVDQIDAVVHAEELAEIYPTPTPKGWPEPKKVNN |
Ga0182221_11276172 | 3300017442 | Miscanthus Phyllosphere | LQQAVEVDRIDTTVLDEELAEIYSTPTPKGWPEPKK |
Ga0182221_11347761 | 3300017442 | Miscanthus Phyllosphere | QQAVEVDQIDVAILAEELTDIYSTPTPKGWPEPKK |
Ga0182221_11368961 | 3300017442 | Miscanthus Phyllosphere | RQAVEVDRIDVAVLAEELVEIYSTPTPKGWPEPKKVIDLYLD |
Ga0182221_11436472 | 3300017442 | Miscanthus Phyllosphere | LQQAVEVDRIDAAILGEELTEIYSTPTPKGWPEPKK |
Ga0182193_11425061 | 3300017443 | Miscanthus Phyllosphere | RQAVEVDRIDAAVLAEELAKIYSTPTPKGWPEPKK |
Ga0182193_11611691 | 3300017443 | Miscanthus Phyllosphere | QQAVEVDRIDAAVLAEELVEIYSTPTPKVWPEPKK |
Ga0182193_11889381 | 3300017443 | Miscanthus Phyllosphere | RQAVEVNRIDAAVLAEELVGIYSTPTPKGWPERKKVIDFVFD |
Ga0182218_10754361 | 3300017683 | Miscanthus Phyllosphere | QQAVVVDQIDAAVLAEELAEIYSTPTPKGWPEPKK |
Ga0182218_10875951 | 3300017683 | Miscanthus Phyllosphere | KVAVEVDRIDAAVLAIELAEIYSTPTPKGWPEPKK |
Ga0182225_10519391 | 3300017684 | Miscanthus Phyllosphere | DGTYRQAVDVDRLDVAVLAEELVEIYSTPTPKGWSEPKK |
Ga0182225_11058161 | 3300017684 | Miscanthus Phyllosphere | RYLQQAVEVDRIDVAVLAEELTEIYSTPTPKGWPEPKK |
Ga0182223_10824952 | 3300017690 | Miscanthus Phyllosphere | LQQAVEVDQIDAALLSKELAEIYSTPTPKGWLEPKK |
Ga0182223_10866131 | 3300017690 | Miscanthus Phyllosphere | RYLQQAVKVDRIDAAVLAEELTEIYSTPTSKGWPEPKK |
Ga0207677_114485772 | 3300026023 | Miscanthus Rhizosphere | VEVDRIDAAVLAEELAEIYSTPTPKGWPEPKKVIDFVFD |
⦗Top⦘ |