 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| Family ID | F083761 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 112 |
| Average Sequence Length | 38 residues |
| Representative Sequence | HQEQVFGELPVHYDNVGHWLQTDAGKGTVDVLLDFK |
| Number of Associated Samples | 100 |
| Number of Associated Scaffolds | 112 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 98.21 % |
| % of genes from short scaffolds (< 2000 bps) | 91.96 % |
| Associated GOLD sequencing projects | 98 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.38 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (66.964 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (25.000 % of family members) |
| Environment Ontology (ENVO) | Unclassified (30.357 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (45.536 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 25.00% Coil/Unstructured: 75.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.38 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 112 Family Scaffolds |
|---|---|---|
| PF02540 | NAD_synthase | 18.75 |
| PF01171 | ATP_bind_3 | 11.61 |
| PF13349 | DUF4097 | 5.36 |
| PF00106 | adh_short | 0.89 |
| PF11008 | DUF2846 | 0.89 |
| COG ID | Name | Functional Category | % Frequency in 112 Family Scaffolds |
|---|---|---|---|
| COG0171 | NH3-dependent NAD+ synthetase | Coenzyme transport and metabolism [H] | 18.75 |
| COG0037 | tRNA(Ile)-lysidine synthase TilS/MesJ | Translation, ribosomal structure and biogenesis [J] | 11.61 |
| COG0301 | Adenylyl- and sulfurtransferase ThiI (thiamine and tRNA 4-thiouridine biosynthesis) | Translation, ribosomal structure and biogenesis [J] | 11.61 |
| COG0482 | tRNA U34 2-thiouridine synthase MnmA/TrmU, contains the PP-loop ATPase domain | Translation, ribosomal structure and biogenesis [J] | 11.61 |
| COG0519 | GMP synthase, PP-ATPase domain/subunit | Nucleotide transport and metabolism [F] | 11.61 |
| COG0603 | 7-cyano-7-deazaguanine synthase (queuosine biosynthesis) | Translation, ribosomal structure and biogenesis [J] | 11.61 |
| COG1606 | ATP-utilizing enzyme, PP-loop superfamily | General function prediction only [R] | 11.61 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 66.96 % |
| All Organisms | root | All Organisms | 33.04 % |
| Visualization |
|---|
| Powered by ApexCharts |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 25.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 19.64% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 7.14% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 4.46% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 4.46% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.57% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.57% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 3.57% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 2.68% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.68% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.68% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 1.79% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.79% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.79% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 1.79% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.79% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.79% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.89% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 0.89% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.89% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.89% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.89% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.89% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.89% |
| Biofilm | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm | 0.89% |
| Plant Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots | 0.89% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.89% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.89% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002914 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm | Environmental | Open in IMG/M |
| 3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
| 3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
| 3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
| 3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
| 3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009641 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_150 | Environmental | Open in IMG/M |
| 3300009700 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG | Environmental | Open in IMG/M |
| 3300010325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_0_1 metaG | Environmental | Open in IMG/M |
| 3300010326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014152 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_60_metaG | Environmental | Open in IMG/M |
| 3300015089 | Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G8A, Adjacent to main proglacial river, end of transect (Watson river)) | Environmental | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300016702 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300017822 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2 | Environmental | Open in IMG/M |
| 3300017823 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3 | Environmental | Open in IMG/M |
| 3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
| 3300017995 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1 | Environmental | Open in IMG/M |
| 3300017998 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_150 | Environmental | Open in IMG/M |
| 3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300019789 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300020062 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2a1 | Environmental | Open in IMG/M |
| 3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021046 | Soil microbial communities from Shale Hills CZO, Pennsylvania, United States - 90cm depth | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Host-Associated | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021476 | Biofilm microbial communities from the roof of an iron ore cave, State of Minas Gerais, Brazil - TC_06 Biofilm (v2) | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300024330 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300026317 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 (SPAdes) | Environmental | Open in IMG/M |
| 3300026475 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-12-A | Environmental | Open in IMG/M |
| 3300026548 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes) | Environmental | Open in IMG/M |
| 3300026555 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300027565 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028036 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE2 | Host-Associated | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028746 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N3_1 | Environmental | Open in IMG/M |
| 3300028776 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E2_1 | Environmental | Open in IMG/M |
| 3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300029882 | III_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300031027 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E3_3 | Environmental | Open in IMG/M |
| 3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031748 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
| 3300032089 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23 | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032895 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3 | Environmental | Open in IMG/M |
| 3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| 3300033982 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB22AY SIP fraction | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI25617J43924_103135061 | 3300002914 | Grasslands Soil | LDKLQTHEEQIFGELPLHYETVGHWLQTDAAKATVXVLLDFK* |
| Ga0062590_1009056151 | 3300004157 | Soil | INLQSHPAEIFGELPVHYDTVGHWLRTDADKHLVDVLLDFK* |
| Ga0066688_106372462 | 3300005178 | Soil | TKLQSHQELVFGELPVHYDNVGHWLQTDAAKGTVDVLLDFK* |
| Ga0066675_108491301 | 3300005187 | Soil | TKLQLHQEQIFGELPLHYESVGHWLQADANTGTVDVLLDFK* |
| Ga0066704_102595262 | 3300005557 | Soil | LQSHQELVFGELPVHYDNVGHWLQTDTAKGTVDVLLDFK* |
| Ga0066704_107772321 | 3300005557 | Soil | QTHQEQVFGELPLHYENVGHWLQTDASKGTVDVLLDFK* |
| Ga0066691_104356262 | 3300005586 | Soil | AKLQTHQEQVFGELPVHYENVGHWLQTDAGKNTVDVLLDFK* |
| Ga0070717_111336042 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | NRSRDIFGDLPVHYDSVGHWLRPDAAKGTVDVLLDFK* |
| Ga0075028_1007977302 | 3300006050 | Watersheds | LTKLQMHQEQVFGELPLHYENVGHWLQTDAGKGTVDVLLDFK* |
| Ga0099791_105966331 | 3300007255 | Vadose Zone Soil | HQEQVFGELPVHYDNVGHWLQTDPSKGTVDVLLDFK* |
| Ga0099793_103066232 | 3300007258 | Vadose Zone Soil | EQVFGELPVHYETVGHFLQTDPGKRTVDVLLDFK* |
| Ga0066710_1030385181 | 3300009012 | Grasslands Soil | TKLQSHQELVFGELPVHYDNVGHWLQTDAAKGTVDVLLDFK |
| Ga0099829_115463251 | 3300009038 | Vadose Zone Soil | LQSHREQVFGELPVHYETVGHFLQTDPDKRTVDVLLDFK* |
| Ga0099828_108831882 | 3300009089 | Vadose Zone Soil | HREQVFGELPVHYETVGHFLQTDPGKRAVDVLLDFK* |
| Ga0116120_10648001 | 3300009641 | Peatland | KKSTAIFGDLPVHYEQVGHWLRTNPDTRTVDILLDFK* |
| Ga0116217_102508472 | 3300009700 | Peatlands Soil | LNRLEIHRDTIFKDLPLHYDTVGHWLQTDPARSTVDVLLDFK* |
| Ga0134064_104858502 | 3300010325 | Grasslands Soil | HQEQIFGELPLHYESVGHWLQADANTGTVDVLLDFK* |
| Ga0134065_105124161 | 3300010326 | Grasslands Soil | KDIFGDLPVHYDSVGHWLRPDAAQGRVDVLLDFK* |
| Ga0126370_104926042 | 3300010358 | Tropical Forest Soil | AQIFGDLPVHYENVGHWLRTDPTKGTVDVLLDFK* |
| Ga0126370_117457801 | 3300010358 | Tropical Forest Soil | KPAQIFGDLPVHYQEVGHWLRADPAKGTVDVLLDFK* |
| Ga0126376_127807051 | 3300010359 | Tropical Forest Soil | QEHSKDIFGDLPIHYENVGHYLRPDPAKGTVDVLLDFK* |
| Ga0136449_1024490221 | 3300010379 | Peatlands Soil | KPTMEIFSDIPVHYSQMGHWLRTDPEKHTVDVLLDFK* |
| Ga0137391_102380511 | 3300011270 | Vadose Zone Soil | HQEQVFGVLPVHYENVGHWLQTDAGKNTVDVLLDFK* |
| Ga0137391_113848912 | 3300011270 | Vadose Zone Soil | QTHQEQVFGELPLHYDNVGHWLQTDASKGTVDVLLDFK* |
| Ga0137364_109400001 | 3300012198 | Vadose Zone Soil | HQELVFGELPVHYDNVGHWLQTDTAKGTVDVLLDFK* |
| Ga0137382_102228611 | 3300012200 | Vadose Zone Soil | HQEQVFGELPVHYENVGHWLQTDAGSGTVDVLLDFR* |
| Ga0137382_104070111 | 3300012200 | Vadose Zone Soil | QEQVFGELPVHYENVGHWLQTDAGSGTVDVLLDFK* |
| Ga0137363_110499501 | 3300012202 | Vadose Zone Soil | QEQVFGELPLHYENVGHWLQTDASKGTVDVLLDFK* |
| Ga0137399_117401062 | 3300012203 | Vadose Zone Soil | LESHRETIFKELPVHYDTVGHFLQTDPAKGTVEVLLDFK* |
| Ga0137362_103245463 | 3300012205 | Vadose Zone Soil | LETHPEKIFGDLPVHYENVGHWVRMDAGMGVADVLLDFK* |
| Ga0137387_108933792 | 3300012349 | Vadose Zone Soil | KLQLHQEQVFGELPLHYETVGHWLQPDSNTRTVDVLLDFK* |
| Ga0137371_100961791 | 3300012356 | Vadose Zone Soil | KLQTHQEQIFGELPLHYETVGHWLQTDAAKATVDVLLDFK* |
| Ga0137371_113004192 | 3300012356 | Vadose Zone Soil | HQGEGCGGLAVHYENVGHWLQTDAGSGTVDVLLDFK* |
| Ga0137360_104715861 | 3300012361 | Vadose Zone Soil | HRGTIFKDLPVHYDTVGHFLQTDPAKGTVEVLLDFK* |
| Ga0137361_113701491 | 3300012362 | Vadose Zone Soil | QTHEEQIFGELPLHYETVGHWLQTDAAKATVDVLLDFK* |
| Ga0137361_117200731 | 3300012362 | Vadose Zone Soil | AHQEQVFGELPVHYENVGHWLQPDASKNTVDVLLDFR* |
| Ga0137390_112212831 | 3300012363 | Vadose Zone Soil | QEQVFGELPVHYDNVGHWLQTDAGKGTVDVLLDFK* |
| Ga0137358_102160783 | 3300012582 | Vadose Zone Soil | YRLESHRETIFKELPVHYDTVGHFLQTDPAKGTGEVLLDFK* |
| Ga0137398_106896131 | 3300012683 | Vadose Zone Soil | KLQTHQEQVFGELPLHYENVGHWLQTDASKGTVDVLLDFK* |
| Ga0137395_105608121 | 3300012917 | Vadose Zone Soil | QAHKEQIFVDLPVHYESVGHWLQTDAETGMVDVLLDFK* |
| Ga0137404_101876831 | 3300012929 | Vadose Zone Soil | SRSKDIFGDLPVHYDSVGHWLRPDAAKATVDVLLDFK* |
| Ga0137407_107552771 | 3300012930 | Vadose Zone Soil | HQEQVFGELPVHYDNVGHWLQTDAGKGTVDVLLDFK* |
| Ga0157372_103811221 | 3300013307 | Corn Rhizosphere | KDIFGSLPVHYDNVGHWVQPNDAQHTVDVLLDFK* |
| Ga0181533_10455273 | 3300014152 | Bog | NRLEIHRETIFKDLPLHYDNVGHWLQTDPAKSTVDVLLDFK* |
| Ga0167643_10730081 | 3300015089 | Glacier Forefield Soil | ETRPAKIFGDLPLHFDSVGHYLQTNAKESTVDVLLDFKH* |
| Ga0182041_113817512 | 3300016294 | Soil | HQEQIFGELPLHYETVGHWLQPDARTGTVDVLLDFK |
| Ga0182039_111500611 | 3300016422 | Soil | REAIFRDLPVHYDTVGHWLQTEPAKGTVDVLLDFK |
| Ga0181511_10802171 | 3300016702 | Peatland | LDSHRDSIFKDLPVHYETVGHWLQADPQSGTVDALLDFK |
| Ga0187802_102044062 | 3300017822 | Freshwater Sediment | HPAEIFGELPLHYDTVGHWLRTDPAKQSVDVLLDFK |
| Ga0187818_101952921 | 3300017823 | Freshwater Sediment | RETIFKDLPLHYDTVGHWLQTDPAKSTVDVLLDFK |
| Ga0187783_108399072 | 3300017970 | Tropical Peatland | ENHRETIFKDVPVHYDSVGHWLQPNSDGDMVDVLLDFK |
| Ga0187777_108972552 | 3300017974 | Tropical Peatland | LTKLKLHQAQIFGELPLHYDNVGHWLQTDPEKATVDVLLDFK |
| Ga0187816_101095353 | 3300017995 | Freshwater Sediment | RLESHRDSIFKDLPVHYDTVGHWLQTDPDKGTVDALIDFK |
| Ga0187870_10494763 | 3300017998 | Peatland | EIHRDTIFKDLPLHYDTVGHWLQTDPAKSTVDVLLDFK |
| Ga0187766_112627962 | 3300018058 | Tropical Peatland | VFEDFLFRLESHRETIFGELPVHYDTVGHFLQTDADKGTVEVLLDFK |
| Ga0187765_112786471 | 3300018060 | Tropical Peatland | ELLNKLQSHREKVFGDLPVHYDTVGHWLQTDAAHGTVDILLDFK |
| Ga0187772_108398701 | 3300018085 | Tropical Peatland | LESKREAIFHDSPVHYDTVGHYLQTDPAKGTVEVLLDFK |
| Ga0066667_118342022 | 3300018433 | Grasslands Soil | LQSHSKDVFGELPIHYENVGHWLREDAAKGTVDVLLDFK |
| Ga0137408_13038952 | 3300019789 | Vadose Zone Soil | NKPAQIFGDLPVHYDNVGHWLRTDPAKGTVDVLLDFK |
| Ga0193724_10941212 | 3300020062 | Soil | SQDIFGDLPVHYDSVGHWLRADPAKGTVDVLLDFK |
| Ga0179592_104749122 | 3300020199 | Vadose Zone Soil | QNKPAQIFGDLPVHYENVGHWLRTDPAKGIVDVLLDFK |
| Ga0210403_104400252 | 3300020580 | Soil | KLQMHQEQVFGELPLHYENVGHWLQTDAGKGTVDVLLDFK |
| Ga0210401_103420002 | 3300020583 | Soil | LTKLQVHPERIFGDLPIHYDTVGHWLQTDATKGTVDVLLDFK |
| Ga0210401_112556462 | 3300020583 | Soil | LEHHHEAVFREVPVHYDTVGHYIQPDPAKKTVDVLLDFK |
| Ga0215015_108312871 | 3300021046 | Soil | ETHPEKIFGDLPVHYENVGHWVRTDAEMGIADVLLDFK |
| Ga0210405_108895011 | 3300021171 | Soil | RHRETIFKELPVHYDDVGHFLQTDAAKGTVEVLLDFK |
| Ga0213876_107819101 | 3300021384 | Plant Roots | PEQIFVDLPIHYRTVGHWLQRDEAAGTVDVLLDFQ |
| Ga0210393_103035481 | 3300021401 | Soil | PADIFGDLPVHYDTVGHWLRTDQDKHSVDVLLDFK |
| Ga0210389_103287031 | 3300021404 | Soil | QTRPTKIFGDLPVHFDTVGHYLQTDPKESTVDVLLDFKH |
| Ga0210383_101273051 | 3300021407 | Soil | LQSQPADIFGDLPVHYDTVGHWLRTDAVKRSVDVLLDFK |
| Ga0210390_110319571 | 3300021474 | Soil | KRLHYHRETIFKELPVHYDDVGHFLQTDPAKGTVEVLLDFK |
| Ga0187846_103869741 | 3300021476 | Biofilm | KGAKQSFGDLPVHFDEIGHWLRTNPKTSTVDVLLDFH |
| Ga0210402_101177714 | 3300021478 | Soil | QEQVFGEMPVHYDNVGHWLQTDANKSTVDVLLDFN |
| Ga0210410_116071811 | 3300021479 | Soil | RLHYHRETIFKELPVHYDDVGHFLQTDPAKGTVEVLLDFK |
| Ga0210409_114414802 | 3300021559 | Soil | TKLETHPGEVFGDSPVHYDNIGHWLQTDAEKSTVDALLDFK |
| Ga0126371_104924453 | 3300021560 | Tropical Forest Soil | SHREAIFRDLPVHYDTVGHWLQTDPAKGTVDVLLDFK |
| Ga0126371_109786471 | 3300021560 | Tropical Forest Soil | RLEAHRESIFHELPVHYDSVGHWLQTDTDKGTVDVLLDFK |
| Ga0137417_10578041 | 3300024330 | Vadose Zone Soil | LAKLQTHQEQVFGELPAVHYENVGHWLQTDTSKNTVDVLLDFK |
| Ga0209154_12975111 | 3300026317 | Soil | QELVFGELPVHYDNVGHWLQTDTAKGTVDVLLDFK |
| Ga0209154_13216202 | 3300026317 | Soil | LQTHQEQVFGELPVHYENVGHWLQTDAGKNTVDVLLDFK |
| Ga0257147_10242561 | 3300026475 | Soil | VFEDFLFRLESHRETIFKELPVHYDTVGHFLQTDAEKGTVEVLLDFK |
| Ga0209161_101839481 | 3300026548 | Soil | AKLQTHQEQVFGELPVHYENVGHWLQTDAGSGTVDVLLDFK |
| Ga0179593_13052356 | 3300026555 | Vadose Zone Soil | MHQEQVFGELPLHYENVGHWLQTDARRGTVDVLLDFK |
| Ga0209219_11217871 | 3300027565 | Forest Soil | LDSHRETVFKDLPVHYDTVGHFLQTDPAKGTVEVLLDFK |
| Ga0265355_10219981 | 3300028036 | Rhizosphere | SHPAEIFGELPVHYDTVGHWLRTDADKHTVDVLLDFK |
| Ga0209526_107397862 | 3300028047 | Forest Soil | LQSHPAEIFGELPVHYDTVGHWLRTDPDKHTVDVLLDFK |
| Ga0302233_103873872 | 3300028746 | Palsa | QPSKVFRDLPLHYDHVGHWLQTDAAKSTVDVLLDFQ |
| Ga0302303_100234661 | 3300028776 | Palsa | PAKIFGDLPVHYDSVGHWLQTDPKQGTVDVLLDFRH |
| Ga0222749_103034712 | 3300029636 | Soil | QEQVFGELPLHYENVGHWLQTDAGKGTVDVLLDFK |
| Ga0222749_105919121 | 3300029636 | Soil | THPSEIFGELPVHYETVGHWLRTDPAKHSVDVLLDFK |
| Ga0311368_104897031 | 3300029882 | Palsa | LLAKLETHPSKIFGDLPLHYDSVGHWLQTDPQQGTVDVLLDFKH |
| Ga0302308_107443012 | 3300031027 | Palsa | SKIFGDLPLHYDSVGHWLQTDPQQGTVDVLLDFKH |
| Ga0170834_1094792771 | 3300031057 | Forest Soil | LESHRELIFKELPVHYDTVGHFLQTDPAKGTVEVLLDFK |
| Ga0170824_1087421771 | 3300031231 | Forest Soil | KLESHRELIFKELPVHYDTVGHFLQTDPAKGTVEVLLDFK |
| Ga0318492_106712671 | 3300031748 | Soil | LQLHQEQIFGELPLHYESVGHWLEPDAGTGTVDVLLDFK |
| Ga0307478_105802401 | 3300031823 | Hardwood Forest Soil | HQEQIFGELPVHYDSVGHWLQTDPAKSTVDILLDFK |
| Ga0310917_110872532 | 3300031833 | Soil | ESHREAIFRELPVHYDTVGHWLQTEPAKGTVDVLLDFK |
| Ga0306919_114694272 | 3300031879 | Soil | LESHREAIFRDLPVHYDTVGHWLQTDPAKGTVDVLLDFK |
| Ga0306921_100155288 | 3300031912 | Soil | REAIFRDLPVHYDTVGHWLQTDPAKGTVDVLLDFK |
| Ga0310912_105734601 | 3300031941 | Soil | HRETIFRDLPVHYDTVGHWLQTDAAKGTVDVLLDFK |
| Ga0310916_103657211 | 3300031942 | Soil | LTQLESHREAIFRDLPVHYDTVGHWLQTDPAKGTVDVLLDFK |
| Ga0318533_103054961 | 3300032059 | Soil | SKDIFGELPVHYEGVGHWLRPDTAKRTVDVLLDFK |
| Ga0318533_106936932 | 3300032059 | Soil | ESHREAIFRDLPVHYDTVGHWLQTDPAKGTVDVLLDFK |
| Ga0318525_100900703 | 3300032089 | Soil | LESHREAIFRDLPVHYDTEGHWLQTDPAKGTVDVLLDFK |
| Ga0307470_104377021 | 3300032174 | Hardwood Forest Soil | VEDFLYRLERHRETIFKELPVHYDTVGHFLQTDPAKGTVEVLLDFK |
| Ga0307471_1015478012 | 3300032180 | Hardwood Forest Soil | GLQNRSKDIFGDLPVHYDSVGHWLRPDAAKGTVDVLLDFK |
| Ga0307471_1020750952 | 3300032180 | Hardwood Forest Soil | HQEQVFGELPVHYDNVGHWLQTDAAKGTVDALLDFK |
| Ga0335074_107965671 | 3300032895 | Soil | RESVFKDLPVHYDTVGHWLQTDPQDGTVDALLDFK |
| Ga0335084_101152421 | 3300033004 | Soil | RDTIFKGLPVHYDTVGHWLQTDADKGTVEVLLDFK |
| Ga0335077_111885872 | 3300033158 | Soil | HRETIFKELPVHYDSVGHWLQNNQDNATVDVLLDFK |
| Ga0310914_110446341 | 3300033289 | Soil | HREAIFRDLPVHYDTVGHWLQTDPAKGTVDVLLDFK |
| Ga0371487_0321211_568_690 | 3300033982 | Peat Soil | RLEIHRETIFKDLPLHYDNVGHWLQTDPAKSTVDVLLDFK |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |