Basic Information | |
---|---|
Family ID | F083919 |
Family Type | Metagenome |
Number of Sequences | 112 |
Average Sequence Length | 37 residues |
Representative Sequence | MGYEPPLEDDIALDKDIEEEDDGYQEPDRMWGDE |
Number of Associated Samples | 70 |
Number of Associated Scaffolds | 112 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Viruses |
% of genes with valid RBS motifs | 77.14 % |
% of genes near scaffold ends (potentially truncated) | 16.07 % |
% of genes from short scaffolds (< 2000 bps) | 70.54 % |
Associated GOLD sequencing projects | 64 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.15 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Duplodnaviria (45.536 % of family members) |
NCBI Taxonomy ID | 2731341 |
Taxonomy | All Organisms → Viruses → Duplodnaviria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake (22.321 % of family members) |
Environment Ontology (ENVO) | Unclassified (45.536 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (64.286 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 0.00% Coil/Unstructured: 100.00% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.15 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 112 Family Scaffolds |
---|---|---|
PF02467 | Whib | 28.57 |
PF01381 | HTH_3 | 20.54 |
PF13830 | DUF4192 | 6.25 |
PF12224 | Amidoligase_2 | 1.79 |
PF07659 | DUF1599 | 0.89 |
PF01391 | Collagen | 0.89 |
PF13155 | Toprim_2 | 0.89 |
PF12705 | PDDEXK_1 | 0.89 |
PF06067 | DUF932 | 0.89 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 83.93 % |
Unclassified | root | N/A | 16.07 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000558|Draft_10112883 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 870 | Open in IMG/M |
3300000558|Draft_10170088 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 938 | Open in IMG/M |
3300000756|JGI12421J11937_10007164 | All Organisms → Viruses → Predicted Viral | 4372 | Open in IMG/M |
3300000756|JGI12421J11937_10100418 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 791 | Open in IMG/M |
3300000882|FwDRAFT_10122669 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 781 | Open in IMG/M |
3300002161|JGI24766J26685_10017235 | All Organisms → Viruses → Predicted Viral | 1857 | Open in IMG/M |
3300002408|B570J29032_109944049 | All Organisms → Viruses → Predicted Viral | 4036 | Open in IMG/M |
3300003404|JGI25920J50251_10066776 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 897 | Open in IMG/M |
3300005517|Ga0070374_10109806 | All Organisms → Viruses → Predicted Viral | 1436 | Open in IMG/M |
3300005517|Ga0070374_10312307 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 797 | Open in IMG/M |
3300005527|Ga0068876_10036447 | All Organisms → Viruses → Predicted Viral | 3045 | Open in IMG/M |
3300005527|Ga0068876_10102271 | All Organisms → Viruses → Predicted Viral | 1707 | Open in IMG/M |
3300005527|Ga0068876_10318877 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 879 | Open in IMG/M |
3300005527|Ga0068876_10358075 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 819 | Open in IMG/M |
3300005527|Ga0068876_10591301 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 602 | Open in IMG/M |
3300005528|Ga0068872_10135606 | All Organisms → Viruses → Predicted Viral | 1445 | Open in IMG/M |
3300005581|Ga0049081_10092222 | All Organisms → Viruses → Predicted Viral | 1133 | Open in IMG/M |
3300005581|Ga0049081_10141014 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 886 | Open in IMG/M |
3300005581|Ga0049081_10190378 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 738 | Open in IMG/M |
3300005581|Ga0049081_10204975 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 706 | Open in IMG/M |
3300005584|Ga0049082_10157790 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 785 | Open in IMG/M |
3300005662|Ga0078894_10004395 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 10778 | Open in IMG/M |
3300005662|Ga0078894_10533038 | All Organisms → Viruses → Predicted Viral | 1051 | Open in IMG/M |
3300005662|Ga0078894_10552621 | All Organisms → Viruses → Predicted Viral | 1029 | Open in IMG/M |
3300005805|Ga0079957_1000567 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 33069 | Open in IMG/M |
3300005805|Ga0079957_1017753 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5076 | Open in IMG/M |
3300006030|Ga0075470_10150907 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 679 | Open in IMG/M |
3300006802|Ga0070749_10526050 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 642 | Open in IMG/M |
3300006805|Ga0075464_10072389 | All Organisms → Viruses → Predicted Viral | 1943 | Open in IMG/M |
3300006805|Ga0075464_10115239 | All Organisms → Viruses → Predicted Viral | 1556 | Open in IMG/M |
3300006805|Ga0075464_10349645 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 894 | Open in IMG/M |
3300006863|Ga0075459_1006908 | All Organisms → Viruses → Predicted Viral | 1843 | Open in IMG/M |
3300006863|Ga0075459_1082983 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 547 | Open in IMG/M |
3300007622|Ga0102863_1167967 | Not Available | 646 | Open in IMG/M |
3300007974|Ga0105747_1250785 | Not Available | 592 | Open in IMG/M |
3300008055|Ga0108970_10128864 | All Organisms → Viruses → Predicted Viral | 3346 | Open in IMG/M |
3300008055|Ga0108970_11762554 | All Organisms → Viruses → Predicted Viral | 1022 | Open in IMG/M |
3300008107|Ga0114340_1007480 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 8858 | Open in IMG/M |
3300008107|Ga0114340_1014226 | All Organisms → Viruses → Predicted Viral | 3841 | Open in IMG/M |
3300008107|Ga0114340_1022032 | All Organisms → Viruses → Predicted Viral | 2993 | Open in IMG/M |
3300008107|Ga0114340_1022328 | All Organisms → Viruses → Predicted Viral | 2970 | Open in IMG/M |
3300008107|Ga0114340_1135558 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 929 | Open in IMG/M |
3300008107|Ga0114340_1136911 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 922 | Open in IMG/M |
3300008110|Ga0114343_1008649 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5095 | Open in IMG/M |
3300008110|Ga0114343_1025770 | All Organisms → Viruses → Predicted Viral | 2520 | Open in IMG/M |
3300008110|Ga0114343_1078509 | All Organisms → Viruses → Predicted Viral | 1191 | Open in IMG/M |
3300008113|Ga0114346_1063329 | All Organisms → Viruses → Predicted Viral | 4107 | Open in IMG/M |
3300008113|Ga0114346_1301512 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 551 | Open in IMG/M |
3300008114|Ga0114347_1265376 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 515 | Open in IMG/M |
3300008116|Ga0114350_1022438 | All Organisms → Viruses → Predicted Viral | 2603 | Open in IMG/M |
3300008120|Ga0114355_1007787 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6223 | Open in IMG/M |
3300008120|Ga0114355_1014517 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 8497 | Open in IMG/M |
3300008259|Ga0114841_1120186 | All Organisms → Viruses → Predicted Viral | 1101 | Open in IMG/M |
3300008448|Ga0114876_1009742 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5576 | Open in IMG/M |
3300009151|Ga0114962_10151900 | All Organisms → Viruses → Predicted Viral | 1391 | Open in IMG/M |
3300009165|Ga0105102_10088142 | All Organisms → Viruses → Predicted Viral | 1437 | Open in IMG/M |
3300009194|Ga0114983_1136757 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 527 | Open in IMG/M |
3300009419|Ga0114982_1202431 | Not Available | 615 | Open in IMG/M |
3300012665|Ga0157210_1014651 | All Organisms → Viruses → Predicted Viral | 1319 | Open in IMG/M |
3300013004|Ga0164293_10037778 | All Organisms → Viruses → Predicted Viral | 3973 | Open in IMG/M |
3300013004|Ga0164293_10411094 | Not Available | 909 | Open in IMG/M |
3300013004|Ga0164293_10885090 | Not Available | 562 | Open in IMG/M |
3300013006|Ga0164294_10507519 | Not Available | 821 | Open in IMG/M |
3300017723|Ga0181362_1076077 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 679 | Open in IMG/M |
3300017778|Ga0181349_1131434 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 914 | Open in IMG/M |
3300017785|Ga0181355_1328718 | Not Available | 567 | Open in IMG/M |
3300019784|Ga0181359_1035115 | All Organisms → Viruses → Predicted Viral | 1941 | Open in IMG/M |
3300019784|Ga0181359_1048188 | All Organisms → Viruses → Predicted Viral | 1645 | Open in IMG/M |
3300020172|Ga0211729_11293653 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 618 | Open in IMG/M |
3300020205|Ga0211731_10403405 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 918 | Open in IMG/M |
3300021962|Ga0222713_10225082 | All Organisms → Viruses → Predicted Viral | 1238 | Open in IMG/M |
3300022190|Ga0181354_1021641 | All Organisms → Viruses → Predicted Viral | 2045 | Open in IMG/M |
3300025896|Ga0208916_10185749 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 898 | Open in IMG/M |
3300027586|Ga0208966_1115950 | Not Available | 727 | Open in IMG/M |
3300027642|Ga0209135_1135645 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 802 | Open in IMG/M |
3300027644|Ga0209356_1070709 | All Organisms → Viruses → Predicted Viral | 1053 | Open in IMG/M |
3300027712|Ga0209499_1001143 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 18928 | Open in IMG/M |
3300027769|Ga0209770_10326666 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 580 | Open in IMG/M |
3300027797|Ga0209107_10085850 | All Organisms → Viruses → Predicted Viral | 1710 | Open in IMG/M |
3300027797|Ga0209107_10422877 | Not Available | 604 | Open in IMG/M |
3300027805|Ga0209229_10270466 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 753 | Open in IMG/M |
3300027805|Ga0209229_10467340 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 541 | Open in IMG/M |
3300027816|Ga0209990_10194674 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 942 | Open in IMG/M |
3300027892|Ga0209550_10671306 | Not Available | 600 | Open in IMG/M |
3300028025|Ga0247723_1005745 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 5532 | Open in IMG/M |
3300028025|Ga0247723_1050419 | All Organisms → Viruses → Predicted Viral | 1193 | Open in IMG/M |
3300031707|Ga0315291_10288872 | All Organisms → Viruses → Predicted Viral | 1615 | Open in IMG/M |
3300031758|Ga0315907_10143152 | All Organisms → Viruses → Predicted Viral | 2030 | Open in IMG/M |
3300031758|Ga0315907_10476659 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 992 | Open in IMG/M |
3300031787|Ga0315900_10873099 | Not Available | 609 | Open in IMG/M |
3300031857|Ga0315909_10081894 | All Organisms → Viruses → Predicted Viral | 2844 | Open in IMG/M |
3300031857|Ga0315909_10513832 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 823 | Open in IMG/M |
3300031857|Ga0315909_10960718 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 520 | Open in IMG/M |
3300031951|Ga0315904_10867243 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 733 | Open in IMG/M |
3300031951|Ga0315904_11039041 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 645 | Open in IMG/M |
3300031999|Ga0315274_10083577 | All Organisms → Viruses → Predicted Viral | 4194 | Open in IMG/M |
3300032050|Ga0315906_10553906 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 959 | Open in IMG/M |
3300032093|Ga0315902_10671039 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 851 | Open in IMG/M |
3300033995|Ga0335003_0304059 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 715 | Open in IMG/M |
3300034018|Ga0334985_0032508 | All Organisms → Viruses → Predicted Viral | 3976 | Open in IMG/M |
3300034062|Ga0334995_0117123 | All Organisms → Viruses → Predicted Viral | 1983 | Open in IMG/M |
3300034095|Ga0335022_0491088 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 642 | Open in IMG/M |
3300034120|Ga0335056_0337311 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 826 | Open in IMG/M |
3300034279|Ga0335052_0618339 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 541 | Open in IMG/M |
3300034283|Ga0335007_0219849 | All Organisms → Viruses → Predicted Viral | 1303 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 22.32% |
Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 15.18% |
Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 10.71% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 9.82% |
Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 7.14% |
Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 5.36% |
Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater And Sediment | 5.36% |
Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment | 2.68% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 1.79% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 1.79% |
Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake | 1.79% |
Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 1.79% |
Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 1.79% |
Deep Subsurface Sediment | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment | 1.79% |
Estuary | Host-Associated → Plants → Leaf → Unclassified → Unclassified → Estuary | 1.79% |
Hydrocarbon Resource Environments | Engineered → Wastewater → Industrial Wastewater → Petrochemical → Unclassified → Hydrocarbon Resource Environments | 1.79% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.89% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 0.89% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 0.89% |
Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 0.89% |
Freshwater And Marine | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater And Marine | 0.89% |
Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 0.89% |
Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 0.89% |
Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 0.89% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000558 | Wastewater microbial communities from Syncrude, Ft. McMurray, Alberta - West In Pit SyncrudeMLSB2011 | Engineered | Open in IMG/M |
3300000756 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011 | Environmental | Open in IMG/M |
3300000882 | Freshwater microbial communities from the Columbia River | Environmental | Open in IMG/M |
3300002161 | Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA | Environmental | Open in IMG/M |
3300002408 | Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123) | Environmental | Open in IMG/M |
3300003404 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.DCMD | Environmental | Open in IMG/M |
3300005517 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (version 4) | Environmental | Open in IMG/M |
3300005527 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG | Environmental | Open in IMG/M |
3300005528 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaG | Environmental | Open in IMG/M |
3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
3300005584 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG HU45MSRF | Environmental | Open in IMG/M |
3300005662 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4) | Environmental | Open in IMG/M |
3300005805 | Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USA | Environmental | Open in IMG/M |
3300006030 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_<0.8_DNA | Environmental | Open in IMG/M |
3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
3300006805 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA | Environmental | Open in IMG/M |
3300006863 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_>0.8_DNA | Environmental | Open in IMG/M |
3300007622 | Estuarine microbial communities from the Columbia River estuary - metaG 1449A-02 | Environmental | Open in IMG/M |
3300007974 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460C_0.2um | Environmental | Open in IMG/M |
3300008055 | Metatranscriptomes of the Eelgrass leaves and roots. Combined Assembly of Gp0128390, Gp0128391, Gp0128392, and Gp0128393 | Host-Associated | Open in IMG/M |
3300008107 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NA | Environmental | Open in IMG/M |
3300008110 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-3-NA | Environmental | Open in IMG/M |
3300008113 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-3-NA | Environmental | Open in IMG/M |
3300008114 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-C-NA | Environmental | Open in IMG/M |
3300008116 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-3-NA | Environmental | Open in IMG/M |
3300008120 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-3-NA | Environmental | Open in IMG/M |
3300008259 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0132-C-NA | Environmental | Open in IMG/M |
3300008448 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - August 4, 2014 all contigs | Environmental | Open in IMG/M |
3300009151 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG | Environmental | Open in IMG/M |
3300009165 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015 | Environmental | Open in IMG/M |
3300009194 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 RT | Environmental | Open in IMG/M |
3300009419 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 FT | Environmental | Open in IMG/M |
3300012665 | Freshwater microbial communities from Talbot River, Ontario, Canada - S11 | Environmental | Open in IMG/M |
3300013004 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaG | Environmental | Open in IMG/M |
3300013006 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES005 metaG | Environmental | Open in IMG/M |
3300017723 | Freshwater viral communities from Lake Michigan, USA - Su13.ND.MM110.S.N | Environmental | Open in IMG/M |
3300017778 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.D | Environmental | Open in IMG/M |
3300017784 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.D.N | Environmental | Open in IMG/M |
3300017785 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.N | Environmental | Open in IMG/M |
3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
3300020172 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_102 megahit1 | Environmental | Open in IMG/M |
3300020205 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_103 megahit1 | Environmental | Open in IMG/M |
3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
3300022190 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.N | Environmental | Open in IMG/M |
3300025896 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
3300027586 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG HU45MSRF (SPAdes) | Environmental | Open in IMG/M |
3300027642 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.SD (SPAdes) | Environmental | Open in IMG/M |
3300027644 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
3300027712 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130208_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027769 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.DD (SPAdes) | Environmental | Open in IMG/M |
3300027797 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011 (SPAdes) | Environmental | Open in IMG/M |
3300027805 | Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA (SPAdes) | Environmental | Open in IMG/M |
3300027816 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG (SPAdes) | Environmental | Open in IMG/M |
3300027892 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
3300028025 | Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 5H_FC | Environmental | Open in IMG/M |
3300031707 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_20 | Environmental | Open in IMG/M |
3300031758 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 | Environmental | Open in IMG/M |
3300031787 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114 | Environmental | Open in IMG/M |
3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
3300031951 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120 | Environmental | Open in IMG/M |
3300031999 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_20 | Environmental | Open in IMG/M |
3300032050 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA122 | Environmental | Open in IMG/M |
3300032093 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA117 | Environmental | Open in IMG/M |
3300033995 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23May2014-rr0056 | Environmental | Open in IMG/M |
3300034018 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME04Jul2014-rr0021 | Environmental | Open in IMG/M |
3300034062 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Jul2012-rr0045 | Environmental | Open in IMG/M |
3300034095 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Feb2014D0-rr0091 | Environmental | Open in IMG/M |
3300034120 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2014-rr0172 | Environmental | Open in IMG/M |
3300034279 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jul2014-rr0163 | Environmental | Open in IMG/M |
3300034283 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2003-rr0061 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
Draft_101128832 | 3300000558 | Hydrocarbon Resource Environments | MGYEPPLEDDIALDKDIEEEDDGYQEPDRMWGDE* |
Draft_101700882 | 3300000558 | Hydrocarbon Resource Environments | MGYEPPLEDDITLDKEIEVEDDGYQEPDRMWGDE* |
JGI12421J11937_100071645 | 3300000756 | Freshwater And Sediment | MSYEPPLDDDIALGKDEEEDEGYQEPDEMWEDHFND* |
JGI12421J11937_100972333 | 3300000756 | Freshwater And Sediment | MSYEPRLDDDIALGIELEEEEEDDFDGPDRMWGDEDE* |
JGI12421J11937_101004183 | 3300000756 | Freshwater And Sediment | MSYEPRLEDDIALGLDEEEVDDGYQEPDRMWGDE* |
FwDRAFT_101226691 | 3300000882 | Freshwater And Marine | MSYEPPLEDDVALDKDTEEEDDGYQEPDRMWGDE* |
JGI24766J26685_100172357 | 3300002161 | Freshwater And Sediment | MMTQSTYYEGETMSYEPPLEDDIALGKDEEEDGYEEPDRMWDDD* |
B570J29032_1099440497 | 3300002408 | Freshwater | MGYEPPLEDDIALDKDIEDEDEGYQEPDRMWGDE* |
JGI25920J50251_100667761 | 3300003404 | Freshwater Lake | SLGHMTEPRLEDDIALGLDEEDDEGYQEPDQMWEDHFND* |
Ga0070374_101098066 | 3300005517 | Freshwater Lake | GHMTEPRLEDDIALGLDEEDDEGYQEPDQMWEDHFND* |
Ga0070374_103123071 | 3300005517 | Freshwater Lake | MTEPRLEDDIALGLDEEDDEGYQEPDQMWEDHFND* |
Ga0068876_100364477 | 3300005527 | Freshwater Lake | MGYEPPLEDDIALDKDIEEEEDGYQEPDRMWGDE* |
Ga0068876_101022714 | 3300005527 | Freshwater Lake | MGYEPPLEDDIALGKDIEEDDSDIYTEPDRMWGDE* |
Ga0068876_103188773 | 3300005527 | Freshwater Lake | FMYYEGETMSYEPPLEDDIALGKDIEDDSDVYTEPDRMWDDE* |
Ga0068876_103580754 | 3300005527 | Freshwater Lake | FMYYEGETMSYEPPLEDDIALGKDIEDDSDVYTEPDRMWGDE* |
Ga0068876_105913011 | 3300005527 | Freshwater Lake | MGYEPPLEDDIALDKDIDEEEDGYQEPDRMWGDE* |
Ga0068872_101356064 | 3300005528 | Freshwater Lake | MMTRFMYYEGETMSYEPPLEDDIALGKDIEDDSDVYTEPDRMWGDE* |
Ga0049081_100922223 | 3300005581 | Freshwater Lentic | MSYEPRLDDDIALDIELEEEDDGYQEPDRMWGDD* |
Ga0049081_101410143 | 3300005581 | Freshwater Lentic | MSYEPPLDDDIALDKNTEDDSDVYTEPDRMWDDE* |
Ga0049081_101903782 | 3300005581 | Freshwater Lentic | MPYEPRLEDDVALGLDEEEVDDGYQEPDRMWGDE* |
Ga0049081_102049752 | 3300005581 | Freshwater Lentic | MPYEPRLEDDIALGLDEEEELDDGYQEPDRMWGDE* |
Ga0049082_101577901 | 3300005584 | Freshwater Lentic | GKLVIMSYEPRLEDDIALGLDEEDDEGYQEPDEMWEDHLND* |
Ga0078894_100043957 | 3300005662 | Freshwater Lake | MSYEPTLEDDVALDKDTEEEDDGYQEPDRMWGDE* |
Ga0078894_105330382 | 3300005662 | Freshwater Lake | MGYEPPLEDDIALDKDIEDDSDVYTEPDRMWGDE* |
Ga0078894_105526212 | 3300005662 | Freshwater Lake | MGYEPPLEDDIALDKNVEDDSDIYTEPDRMWGDE* |
Ga0079957_100056718 | 3300005805 | Lake | MSYEPPLEDDIALGKDEEEDDDGYQEPDRMWGDD* |
Ga0079957_10177534 | 3300005805 | Lake | MSYEPPLDDDIALGKDEEEEEDEGYQEPDRMWGDD* |
Ga0075470_101509071 | 3300006030 | Aqueous | MSYEPPLEDDIALDKEIEDEDDGYQEPDRMWGDE* |
Ga0070749_105260502 | 3300006802 | Aqueous | MTYEPPLDDDVALDKDIEEEDDGYQEPDRMWGDE* |
Ga0075464_100723893 | 3300006805 | Aqueous | MGYEPRLEDDIALGLDEEEDEGYQEPDEMWEDHFND* |
Ga0075464_101152395 | 3300006805 | Aqueous | MSYEPPLEDDIALGKDEEEEDDGGYQEPDRMWGDD* |
Ga0075464_103496455 | 3300006805 | Aqueous | MPYEPRLEDDIALGLDEEENDDGYQEPDRMWGDE* |
Ga0075459_10069084 | 3300006863 | Aqueous | MTYEPPLDDDVALDKNIEEEDDGYQEPDRMWGDE* |
Ga0075459_10829832 | 3300006863 | Aqueous | MSYEPPLEDDVALDKDIEEEDDGYQEPDRMWGDE* |
Ga0102863_11679671 | 3300007622 | Estuarine | MGYEPRLEDDIALGLDEEEDEGYQEPDQMWEDHFND* |
Ga0105747_12507852 | 3300007974 | Estuary Water | MSYEPRLEDDIALGLDEEDDEGYQEPDQMWEDHFND* |
Ga0108970_101288642 | 3300008055 | Estuary | MSYEPPLEDDVALDKDTEEKDDGYQEPDRMWGDE* |
Ga0108970_117625542 | 3300008055 | Estuary | MSYEPPLEDDIALDKDIEEQDDGYQEPDRMWGDE* |
Ga0114340_10074807 | 3300008107 | Freshwater, Plankton | MSYEPRLDDDIALGIELEEEEDDTGEPDRMWGDD* |
Ga0114340_10142266 | 3300008107 | Freshwater, Plankton | MGYEPPLEDDIALDKDIEDEDDGYQEPDRMWGDE* |
Ga0114340_10220326 | 3300008107 | Freshwater, Plankton | MSYEPQLEDDFALGKYDDEEEDEDMGEPDRMWGDD* |
Ga0114340_10223285 | 3300008107 | Freshwater, Plankton | MSYEPPLEDDVALDKDIEDEDDGYQEPDRMWGDE* |
Ga0114340_11355583 | 3300008107 | Freshwater, Plankton | MSYEPPLEDDIALDKDIEDDSDVYTEPDRMWGDE* |
Ga0114340_11369114 | 3300008107 | Freshwater, Plankton | MMTQYMYHEGETMSYEPPLEDDIALDKDIEDDSDVYTEPDRMWGDE* |
Ga0114343_10086493 | 3300008110 | Freshwater, Plankton | MSYEPPLDDDIALGKDEEEEDEGYQEPDRMWGDD* |
Ga0114343_10257701 | 3300008110 | Freshwater, Plankton | MYYKGGEMGYEPPLEDDIALDKDIEDEGYQEPDRMWGDE* |
Ga0114343_10785092 | 3300008110 | Freshwater, Plankton | MTHYTYHEGDIMGYEPPLEDDIALDKDIEEDDSDVYTEPDRMWGDE* |
Ga0114346_10633297 | 3300008113 | Freshwater, Plankton | MSYEPRLDDDIALDIELEEEDDDGYQEPDRMWGDD* |
Ga0114346_13015121 | 3300008113 | Freshwater, Plankton | MYHEGETMSYEPPLEDDIALDKDIEDDSDVYTEPDRMWGDE* |
Ga0114347_12653761 | 3300008114 | Freshwater, Plankton | MMTQYMYHEGETMSYDPPLEDAIALGKDIEEEDDSDIYTEPDRMWGDE* |
Ga0114350_10060059 | 3300008116 | Freshwater, Plankton | MTEPRLEDDIALDIEEEEELDDTDPGDGPDRMWGDEN* |
Ga0114350_10224388 | 3300008116 | Freshwater, Plankton | MGYEPPFEDDIALGKDIEEEDDSDIYTEPDRMWGDE* |
Ga0114355_100778713 | 3300008120 | Freshwater, Plankton | MGYEPPLEDDIALGKDIEEEDDSDIYTEPDRMWGDE* |
Ga0114355_10145176 | 3300008120 | Freshwater, Plankton | MTEPRLEDDIALDIEEEELDDTDPGDGPDRMWGDEN* |
Ga0114841_11201861 | 3300008259 | Freshwater, Plankton | MMTQYMYHEGETMSYEPPLEDDIALGKDIEEEDDSDIYTEPDRMWGDE* |
Ga0114876_10097426 | 3300008448 | Freshwater Lake | MSYEPPLDDDIALGKDEEEEDEGYHEPDRMWGDDD* |
Ga0114962_101519003 | 3300009151 | Freshwater Lake | MSYEPPLDDDVALDIELEEEDDDGYQEPDRMWGDD* |
Ga0105102_100881424 | 3300009165 | Freshwater Sediment | MGYEPPLEDDIALDKDIKDDSDVYTEPDRMWGDE* |
Ga0114983_11367572 | 3300009194 | Deep Subsurface | GYEPPLEDDIALGKDIEEDDSDIYTEPDRMWGDE* |
Ga0114982_12024312 | 3300009419 | Deep Subsurface | MSYEPRLEDDIALGLDEEEDEDDTGEPDRMWGDE* |
Ga0157210_10146514 | 3300012665 | Freshwater | MSYEPPLDDDIALGKDEEENEDEGYQEPDRMWGDE* |
Ga0164293_1003777810 | 3300013004 | Freshwater | MGYEPPLEDDIALDKDVEDDSDIYTEPDRMWGDE* |
Ga0164293_104110943 | 3300013004 | Freshwater | MYYKGGEMGYEPPLEDDIALGKDEEDDSDVYTEPDRMFGDE* |
Ga0164293_108850903 | 3300013004 | Freshwater | MRDPRLEDDIALGLDEEEEELDDGYQEPDRMWGDD* |
Ga0164294_105075191 | 3300013006 | Freshwater | MSEPRLEDDIALGLDEEDDEGYQEPDQMWEDHFND* |
Ga0181362_10760773 | 3300017723 | Freshwater Lake | MTEPRLEDDIALGLDEEEDEGYQEPDQMWEDHFND |
Ga0181349_11314344 | 3300017778 | Freshwater Lake | ARKGRTMSYEPRLEDDVALGLDEEEVDDGYQEPDRMWGDE |
Ga0181348_11879751 | 3300017784 | Freshwater Lake | MSYEPRLDDDIALGIELEEEDDFDGPDRMWGDEDD |
Ga0181355_13287181 | 3300017785 | Freshwater Lake | SLGLMTEPRLEDDIALGLDEEDDEGYQEPDQMWEDHFND |
Ga0181359_10351154 | 3300019784 | Freshwater Lake | MSYEPPLDDDIALGKDEEEDEGYQEPDQMWEDHFND |
Ga0181359_10481883 | 3300019784 | Freshwater Lake | MSYEPRLEDDIALGLDEEDDEGYQEPDEMWEDHLND |
Ga0211729_112936532 | 3300020172 | Freshwater | QSRRGGRMSYEPPLEDDIALDKETEEDDGYQEPDRMWGDE |
Ga0211731_104034052 | 3300020205 | Freshwater | MSEPRLEDDIALGLDEEEEDEGYQEPDQMWEDHFND |
Ga0222713_102250822 | 3300021962 | Estuarine Water | MMTQSTYYEGETMSYEPPLEDDIALGKDIEEEDDSDVYTEPDRMWGDE |
Ga0181354_10216418 | 3300022190 | Freshwater Lake | RRKKMPYEPRLEDDIALGLDEEEDDGYQEPDRMWGDE |
Ga0181354_11584621 | 3300022190 | Freshwater Lake | MSYEPRLDDDIALGIELEDEDDFEGPDRMWGDEDD |
Ga0208916_101857493 | 3300025896 | Aqueous | MSYEPPLEDDIALGKDEEEEDDGGYQEPDRMWGDD |
Ga0208966_11159501 | 3300027586 | Freshwater Lentic | GKLVIMSYEPRLEDDIALGLDEEDDEGYQEPDEMWEDHLND |
Ga0209135_11356451 | 3300027642 | Freshwater Lake | HMTEPRLEDDIALGLDEEDDEGYQEPDQMWEDHFND |
Ga0209356_10707094 | 3300027644 | Freshwater Lake | MSYEPPLDDDIALGKDEEEDEGYQEPDEMWEDHFND |
Ga0209499_10011437 | 3300027712 | Freshwater Lake | MSYEPPLDDDVALDIELEEEDDDGYQEPDRMWGDD |
Ga0209770_103266661 | 3300027769 | Freshwater Lake | MWKEETMSYEPTLEDDVALDKDTEEEDDGYQEPDRMWGDE |
Ga0209107_100858504 | 3300027797 | Freshwater And Sediment | MGYEPRLEDDIALGLDEEEDEGYQEPDQMWEDHFND |
Ga0209107_101082914 | 3300027797 | Freshwater And Sediment | MSYEPRLDDDIALGIELEEEEDDFDGPDRMWGDEDE |
Ga0209107_104228773 | 3300027797 | Freshwater And Sediment | KTMRDPRLEDDIALGLDEEEEEELDDGYQEPDRMWGDE |
Ga0209229_102704661 | 3300027805 | Freshwater And Sediment | MLARRRRIMGYEPPLDDDVALDKDIEEEDDGYQEPDRMWGDE |
Ga0209229_104673401 | 3300027805 | Freshwater And Sediment | MMTQSTYYEGETMSYEPPLEDDIALGKDEEEDGYEEPDRMWDDD |
Ga0209990_101946743 | 3300027816 | Freshwater Lake | MMTRFMYYEGETMSYEPPLEDDIALGKDIEDDSDVYTEPDRMWDDE |
Ga0209550_106713061 | 3300027892 | Freshwater Lake | GHMTEPRLEDDIALGLDEEDDEGYQEPDQMWEDHFND |
Ga0247723_10057456 | 3300028025 | Deep Subsurface Sediment | MGYEPPLDDDIALGKDEEEDEDEGYQEPDRMWGDE |
Ga0247723_10504192 | 3300028025 | Deep Subsurface Sediment | MGYEPPLEDDIALGKDIEENDSDIYTEPDRMWGDE |
Ga0315291_102888724 | 3300031707 | Sediment | MSEPRLEDDIALGLDEEDDEGYQEPDQMWEDHFND |
Ga0315907_100982301 | 3300031758 | Freshwater | MTEPRLEDDIALDIEEEEELDDTDPGDGPDRMWGDEN |
Ga0315907_101431525 | 3300031758 | Freshwater | MGYEPPLEDDIALGKDIEEDDSDIYTEPDRMWGDE |
Ga0315907_104766592 | 3300031758 | Freshwater | MGYEPPFEDDIALGKDIEEEDDSDIYTEPDRMWGDE |
Ga0315900_105674712 | 3300031787 | Freshwater | MTEPRLEDDIALDIEEEELDDTDPGDGPDRMWGDEN |
Ga0315900_108730993 | 3300031787 | Freshwater | NKLMPYEPRLEDDIALGIDEEEEDDTGEPDRMWGDE |
Ga0315909_100818949 | 3300031857 | Freshwater | MYYKGGKMGYEPPLEDDIALNKDTEDEGYQEPDRMWGDE |
Ga0315909_105138323 | 3300031857 | Freshwater | METKCMYYKGGEMGYEPPLEDDIALDKDIEDEGYQEPDRMWGDE |
Ga0315909_109607182 | 3300031857 | Freshwater | VCMETRCMYYKGGKMGYEPPLEDDIALDKDTEDEGYQEPDRMWGDE |
Ga0315904_108672431 | 3300031951 | Freshwater | MMTRFMYYEGETMSYEPPLEDDIALDKDIEDDSDVYTEPDRMWGDE |
Ga0315904_110390412 | 3300031951 | Freshwater | MSYEPPLEDDIALGKDIEEEDDSDIYTEPDRMWGDE |
Ga0315274_100835776 | 3300031999 | Sediment | MKKRWKMPYEPRLEDDVALGLDEEEVDDGYQEPDRMWGDE |
Ga0315906_105539063 | 3300032050 | Freshwater | METRCMYYKGGKMGYEPPLEDDIALNKDTEDEGYQEPDRMWGDE |
Ga0315902_106710393 | 3300032093 | Freshwater | MGYEPPLEDDIALGKDIEEEDDSDIYTEPDRMWGDE |
Ga0335003_0304059_10_120 | 3300033995 | Freshwater | MMSEPRLEDDIALGLDEEEEELDDGYQEPDRMWGDE |
Ga0334985_0032508_1352_1477 | 3300034018 | Freshwater | MYYKGGKMGYEPPLEDDIALDKDIEDDSDVYTEPDRMWGDE |
Ga0334995_0117123_1812_1952 | 3300034062 | Freshwater | METKCMYYKGGKMGYEPPLEDDIALDKDIEDDSDVYTEPDRMWGDE |
Ga0335022_0491088_449_556 | 3300034095 | Freshwater | MSEPRLEDDIALGLDEEEEELDDGYQEPDRMWGDE |
Ga0335056_0337311_3_122 | 3300034120 | Freshwater | MYYKGGKMGYEPPLEDDIALDKDIEDDSDVYTEPDRMWGD |
Ga0335052_0618339_132_257 | 3300034279 | Freshwater | MYYKGGEMGYEPPLEDDIALDKDIEDDSNVYTEPDRMWGDE |
Ga0335007_0219849_972_1079 | 3300034283 | Freshwater | MSYEPRLDDDIALDIELEEEEDDGYQEPDRMWGDD |
⦗Top⦘ |