NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F084568

Metagenome / Metatranscriptome Family F084568

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F084568
Family Type Metagenome / Metatranscriptome
Number of Sequences 112
Average Sequence Length 42 residues
Representative Sequence LFTLAASSVMSAEGPVHGSNAAVKVAEEICKASRITTEGVLNVT
Number of Associated Samples 104
Number of Associated Scaffolds 112

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.91 %
% of genes near scaffold ends (potentially truncated) 94.64 %
% of genes from short scaffolds (< 2000 bps) 90.18 %
Associated GOLD sequencing projects 98
AlphaFold2 3D model prediction Yes
3D model pTM-score0.29

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (79.464 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(15.179 % of family members)
Environment Ontology (ENVO) Unclassified
(24.107 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(56.250 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: Yes Secondary Structure distribution: α-helix: 20.83%    β-sheet: 0.00%    Coil/Unstructured: 79.17%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.29
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 112 Family Scaffolds
PF05227CHASE3 70.54
PF00248Aldo_ket_red 17.86
PF13414TPR_11 0.89
PF00486Trans_reg_C 0.89
PF13442Cytochrome_CBB3 0.89
PF02927CelD_N 0.89
PF07589PEP-CTERM 0.89
PF10741T2SSM_b 0.89
PF04794YdjC 0.89
PF14238DUF4340 0.89
PF05598DUF772 0.89
PF00005ABC_tran 0.89
PF13964Kelch_6 0.89

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 112 Family Scaffolds
COG3394Chitooligosaccharide deacetylase ChbG, YdjC/CelG familyCarbohydrate transport and metabolism [G] 0.89

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms79.46 %
UnclassifiedrootN/A20.54 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300001154|JGI12636J13339_1002715All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii2956Open in IMG/M
3300001356|JGI12269J14319_10020285All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus4782Open in IMG/M
3300001593|JGI12635J15846_10598207Not Available642Open in IMG/M
3300002917|JGI25616J43925_10253341All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium661Open in IMG/M
3300004617|Ga0068955_1365290All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium639Open in IMG/M
3300004620|Ga0068957_1370221All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium605Open in IMG/M
3300005176|Ga0066679_10146203All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1476Open in IMG/M
3300005177|Ga0066690_10766585All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium631Open in IMG/M
3300005436|Ga0070713_100592639All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1052Open in IMG/M
3300005440|Ga0070705_101252275All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium613Open in IMG/M
3300005542|Ga0070732_10633403All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium650Open in IMG/M
3300005561|Ga0066699_10588171All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium799Open in IMG/M
3300005610|Ga0070763_10020831All Organisms → cellular organisms → Bacteria2891Open in IMG/M
3300005712|Ga0070764_10534269Not Available709Open in IMG/M
3300005844|Ga0068862_102372240All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium542Open in IMG/M
3300005921|Ga0070766_10668806All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium701Open in IMG/M
3300006028|Ga0070717_10841822All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium835Open in IMG/M
3300006028|Ga0070717_12017844All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium520Open in IMG/M
3300006041|Ga0075023_100290209Not Available670Open in IMG/M
3300006174|Ga0075014_100785660Not Available561Open in IMG/M
3300006800|Ga0066660_11688329All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium504Open in IMG/M
3300007982|Ga0102924_1353843Not Available567Open in IMG/M
3300009011|Ga0105251_10475833All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium581Open in IMG/M
3300009088|Ga0099830_10737616All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium812Open in IMG/M
3300009092|Ga0105250_10500925All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium551Open in IMG/M
3300009137|Ga0066709_100370600All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1975Open in IMG/M
3300009521|Ga0116222_1107498All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1201Open in IMG/M
3300009523|Ga0116221_1280439Not Available721Open in IMG/M
3300009523|Ga0116221_1301218All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium694Open in IMG/M
3300009545|Ga0105237_12277048All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium551Open in IMG/M
3300009631|Ga0116115_1157246All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium576Open in IMG/M
3300009665|Ga0116135_1162178Not Available840Open in IMG/M
3300009683|Ga0116224_10287815All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium782Open in IMG/M
3300010341|Ga0074045_10987748All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium530Open in IMG/M
3300010360|Ga0126372_10588571All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1065Open in IMG/M
3300010362|Ga0126377_13008743All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium544Open in IMG/M
3300010366|Ga0126379_11557770All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium766Open in IMG/M
3300010400|Ga0134122_11698956All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium659Open in IMG/M
3300011003|Ga0138514_100068617All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium740Open in IMG/M
3300011120|Ga0150983_12728619All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium644Open in IMG/M
3300012199|Ga0137383_10321732All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1133Open in IMG/M
3300012917|Ga0137395_10326906All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1090Open in IMG/M
3300012918|Ga0137396_10171157All Organisms → cellular organisms → Bacteria → Proteobacteria1588Open in IMG/M
3300012923|Ga0137359_11497478All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium563Open in IMG/M
3300012927|Ga0137416_10908315All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium783Open in IMG/M
3300012948|Ga0126375_10528960All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium885Open in IMG/M
3300012955|Ga0164298_10150413All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1306Open in IMG/M
3300013306|Ga0163162_10372381All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1561Open in IMG/M
3300014199|Ga0181535_10349109Not Available874Open in IMG/M
3300014489|Ga0182018_10229292All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1029Open in IMG/M
3300014492|Ga0182013_10454485All Organisms → cellular organisms → Bacteria676Open in IMG/M
3300014501|Ga0182024_11293090All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium846Open in IMG/M
3300015264|Ga0137403_10497649All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1090Open in IMG/M
3300017928|Ga0187806_1332919All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium541Open in IMG/M
3300017933|Ga0187801_10517029Not Available504Open in IMG/M
3300017935|Ga0187848_10332388All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium631Open in IMG/M
3300017946|Ga0187879_10113962All Organisms → cellular organisms → Bacteria1544Open in IMG/M
3300017975|Ga0187782_11136311All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium610Open in IMG/M
3300018018|Ga0187886_1371512All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium526Open in IMG/M
3300018038|Ga0187855_10697434Not Available591Open in IMG/M
3300018047|Ga0187859_10032988All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2794Open in IMG/M
3300018047|Ga0187859_10488811All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium684Open in IMG/M
3300019082|Ga0187852_1396763All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium538Open in IMG/M
3300019278|Ga0187800_1826313All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium505Open in IMG/M
3300020010|Ga0193749_1102400All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium510Open in IMG/M
3300020579|Ga0210407_10668759All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium806Open in IMG/M
3300020580|Ga0210403_10550562Not Available935Open in IMG/M
3300020581|Ga0210399_10096387All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2416Open in IMG/M
3300020581|Ga0210399_10230646All Organisms → cellular organisms → Bacteria1542Open in IMG/M
3300020582|Ga0210395_11197086Not Available558Open in IMG/M
3300021170|Ga0210400_10118592All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2110Open in IMG/M
3300021170|Ga0210400_11532170All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium528Open in IMG/M
3300021171|Ga0210405_10687649All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium791Open in IMG/M
3300021178|Ga0210408_10495954All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium971Open in IMG/M
3300021180|Ga0210396_10190565All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1834Open in IMG/M
3300021403|Ga0210397_11562548All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium512Open in IMG/M
3300021445|Ga0182009_10814358All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium511Open in IMG/M
3300021475|Ga0210392_11445504Not Available514Open in IMG/M
3300021477|Ga0210398_11136117Not Available619Open in IMG/M
3300021478|Ga0210402_11430178All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium619Open in IMG/M
3300022557|Ga0212123_10651249All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium656Open in IMG/M
3300022557|Ga0212123_10738562Not Available600Open in IMG/M
3300024330|Ga0137417_1077147All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1093Open in IMG/M
3300025320|Ga0209171_10075901All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2128Open in IMG/M
3300025903|Ga0207680_10096681All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1890Open in IMG/M
3300025913|Ga0207695_10576372All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1007Open in IMG/M
3300026318|Ga0209471_1215977All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium713Open in IMG/M
3300026325|Ga0209152_10401199All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium538Open in IMG/M
3300026351|Ga0257170_1045209All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium608Open in IMG/M
3300026480|Ga0257177_1069441All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium562Open in IMG/M
3300027439|Ga0209332_1082020Not Available582Open in IMG/M
3300027609|Ga0209221_1161689Not Available553Open in IMG/M
3300027610|Ga0209528_1146161All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium517Open in IMG/M
3300027674|Ga0209118_1000115All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae56161Open in IMG/M
3300027678|Ga0209011_1176117All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium592Open in IMG/M
3300027846|Ga0209180_10135135All Organisms → cellular organisms → Bacteria1417Open in IMG/M
3300027884|Ga0209275_10141218All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1269Open in IMG/M
3300027889|Ga0209380_10532922All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium683Open in IMG/M
3300027905|Ga0209415_11131150Not Available506Open in IMG/M
3300028047|Ga0209526_10133471All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1742Open in IMG/M
3300029636|Ga0222749_10738918Not Available539Open in IMG/M
3300030813|Ga0265750_1072843Not Available559Open in IMG/M
3300031718|Ga0307474_10165093All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1676Open in IMG/M
3300031718|Ga0307474_11198752All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium600Open in IMG/M
3300032160|Ga0311301_11886091All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium705Open in IMG/M
3300032174|Ga0307470_10928330All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium686Open in IMG/M
3300032180|Ga0307471_100677441All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1195Open in IMG/M
3300032180|Ga0307471_100927183All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1038Open in IMG/M
3300032261|Ga0306920_100178165All Organisms → cellular organisms → Bacteria3171Open in IMG/M
3300032954|Ga0335083_11490010Not Available514Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil15.18%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil8.93%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil8.93%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil8.04%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland6.25%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil5.36%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil4.46%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil4.46%
Iron-Sulfur Acid SpringEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring3.57%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil3.57%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere3.57%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil2.68%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland1.79%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment1.79%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds1.79%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil1.79%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere1.79%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.79%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog0.89%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.89%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.89%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil0.89%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.89%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil0.89%
PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland0.89%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland0.89%
Bog Forest SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil0.89%
BogEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Bog0.89%
PalsaEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa0.89%
PermafrostEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost0.89%
SoilEnvironmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil0.89%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.89%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.89%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.89%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300001154Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M1EnvironmentalOpen in IMG/M
3300001356Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007EnvironmentalOpen in IMG/M
3300001593Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2EnvironmentalOpen in IMG/M
3300002917Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_100cmEnvironmentalOpen in IMG/M
3300004617Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 47 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004620Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 49 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300005176Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128EnvironmentalOpen in IMG/M
3300005177Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139EnvironmentalOpen in IMG/M
3300005436Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaGEnvironmentalOpen in IMG/M
3300005440Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaGEnvironmentalOpen in IMG/M
3300005542Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1EnvironmentalOpen in IMG/M
3300005561Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148EnvironmentalOpen in IMG/M
3300005610Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3EnvironmentalOpen in IMG/M
3300005712Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4EnvironmentalOpen in IMG/M
3300005844Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2Host-AssociatedOpen in IMG/M
3300005921Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6EnvironmentalOpen in IMG/M
3300006028Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaGEnvironmentalOpen in IMG/M
3300006041Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014EnvironmentalOpen in IMG/M
3300006174Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014EnvironmentalOpen in IMG/M
3300006800Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109EnvironmentalOpen in IMG/M
3300007982Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPM 11 metaGEnvironmentalOpen in IMG/M
3300009011Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaGHost-AssociatedOpen in IMG/M
3300009088Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaGEnvironmentalOpen in IMG/M
3300009092Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaGHost-AssociatedOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009521Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaGEnvironmentalOpen in IMG/M
3300009523Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaGEnvironmentalOpen in IMG/M
3300009545Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaGHost-AssociatedOpen in IMG/M
3300009631Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_100EnvironmentalOpen in IMG/M
3300009665Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10EnvironmentalOpen in IMG/M
3300009683Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaGEnvironmentalOpen in IMG/M
3300010341Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010400Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2EnvironmentalOpen in IMG/M
3300011003Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t9i015EnvironmentalOpen in IMG/M
3300011120Combined assembly of Microbial Forest Soil metaTEnvironmentalOpen in IMG/M
3300012199Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012203Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaGEnvironmentalOpen in IMG/M
3300012917Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaGEnvironmentalOpen in IMG/M
3300012918Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaGEnvironmentalOpen in IMG/M
3300012923Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaGEnvironmentalOpen in IMG/M
3300012927Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012948Tropical forest soil microbial communities from Panama - MetaG Plot_14EnvironmentalOpen in IMG/M
3300012955Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MGEnvironmentalOpen in IMG/M
3300013306Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaGHost-AssociatedOpen in IMG/M
3300014199Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_30_metaGEnvironmentalOpen in IMG/M
3300014489Permafrost microbial communities from Stordalen Mire, Sweden - 812P2M metaGEnvironmentalOpen in IMG/M
3300014492Permafrost microbial communities from Stordalen Mire, Sweden - 612S2M metaGEnvironmentalOpen in IMG/M
3300014501Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300015264Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300017928Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_1EnvironmentalOpen in IMG/M
3300017933Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1EnvironmentalOpen in IMG/M
3300017935Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_40EnvironmentalOpen in IMG/M
3300017946Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10EnvironmentalOpen in IMG/M
3300017975Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018018Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_150EnvironmentalOpen in IMG/M
3300018038Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_10EnvironmentalOpen in IMG/M
3300018047Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10EnvironmentalOpen in IMG/M
3300019082Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_40EnvironmentalOpen in IMG/M
3300019278Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300020010Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1s2EnvironmentalOpen in IMG/M
3300020579Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-MEnvironmentalOpen in IMG/M
3300020580Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-MEnvironmentalOpen in IMG/M
3300020581Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-MEnvironmentalOpen in IMG/M
3300020582Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-OEnvironmentalOpen in IMG/M
3300021170Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-MEnvironmentalOpen in IMG/M
3300021171Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-MEnvironmentalOpen in IMG/M
3300021178Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-MEnvironmentalOpen in IMG/M
3300021180Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-OEnvironmentalOpen in IMG/M
3300021403Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-OEnvironmentalOpen in IMG/M
3300021445Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaGEnvironmentalOpen in IMG/M
3300021475Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-OEnvironmentalOpen in IMG/M
3300021477Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-OEnvironmentalOpen in IMG/M
3300021478Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-MEnvironmentalOpen in IMG/M
3300022557Paint Pots_combined assemblyEnvironmentalOpen in IMG/M
3300024330Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300025320Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025903Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025913Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026318Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 (SPAdes)EnvironmentalOpen in IMG/M
3300026325Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 (SPAdes)EnvironmentalOpen in IMG/M
3300026351Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-05-BEnvironmentalOpen in IMG/M
3300026480Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-07-BEnvironmentalOpen in IMG/M
3300027439Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300027609Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_O2 (SPAdes)EnvironmentalOpen in IMG/M
3300027610Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M3 (SPAdes)EnvironmentalOpen in IMG/M
3300027674Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300027678Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M3 (SPAdes)EnvironmentalOpen in IMG/M
3300027738Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300027846Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027884Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes)EnvironmentalOpen in IMG/M
3300027889Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes)EnvironmentalOpen in IMG/M
3300027905Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes)EnvironmentalOpen in IMG/M
3300028047Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300029636Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030813Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSE1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031718Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05EnvironmentalOpen in IMG/M
3300032160Sb_50d combined assembly (MetaSPAdes)EnvironmentalOpen in IMG/M
3300032174Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M
3300032954Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI12636J13339_100271523300001154Forest SoilMSAEEPVHSSNAVVKVAEEICKASRITTEGVLNVT*
JGI12269J14319_1002028513300001356Peatlands SoilADGTLRANEAGARIAKEICKASRITAEGVLNGAAT*
JGI12635J15846_1059820723300001593Forest SoilLFTLAASSVMSADGPVHGSDAVVKVAEEICKASRITTEGVLNNSELV*
JGI25616J43925_1025334123300002917Grasslands SoilFTLAASSVMSADMSGEAPVHNSNAAVKVAKEISKASRITTEGVLNIT*
Ga0068955_136529013300004617Peatlands SoilLLFTLAASSIMSAEGPVHSSDAVVKVAVEICKASRITTEGVLNIT*
Ga0068957_137022123300004620Peatlands SoilLFTLAASSVMSAEGPVHSSHAVVKVAERICRASRITTEGVLNIT*
Ga0066679_1014620313300005176SoilEQEDALLFTLAASSAMSAEGPLRSGDAAVKVAEELCKASRITTEGVLNVA*
Ga0066690_1076658523300005177SoilALLFTLAASSVMSAEGRVHSGNAAAKVAEEICKANRITTEGVLNIT*
Ga0070713_10059263913300005436Corn, Switchgrass And Miscanthus RhizosphereNQEDALLFILASSSVMSAEAAGHRNDAAGLVAAEICKASRITAEGVLNTI*
Ga0070705_10125227523300005440Corn, Switchgrass And Miscanthus RhizosphereAASSVMSAEGSIYSSNVLVKIADEICKASRITAEGVLNIR*
Ga0070732_1063340313300005542Surface SoilEDALLFTLAASSVMSAEGPVHRSDAVVKVAAEICKASRITTAGVLNIT*
Ga0066699_1058817123300005561SoilALLFTLAASSVMSAEGPLHSNDPVINFAEQICKARRITAEGVLNIA*
Ga0070763_1002083143300005610SoilFTLAASSVMSAEGPVLYSNRAVLKVAEEICKASRITTEGVLNIT*
Ga0070764_1053426923300005712SoilGPVHSSDAVVKVAEEICKASRITTEGVLNNSELV*
Ga0068862_10237224013300005844Switchgrass RhizosphereAASSVMSAEGSVYRSDAVVKVAAEICKASRITAEGALNIT*
Ga0070766_1066880623300005921SoilLLFTLAASSIMSAEGPAHNTDAVVKVAEEICKATRITAEGVLNIT*
Ga0070717_1084182213300006028Corn, Switchgrass And Miscanthus RhizosphereSSVMSAEGPLHSNDPVINFAEQICKARRITAEGVLNIA*
Ga0070717_1201784433300006028Corn, Switchgrass And Miscanthus RhizosphereLFTLAASSVMSAEGPVHGSNAAVKVAEEICKASRITTEGVLNVT*
Ga0075023_10029020923300006041WatershedsMSAEGPVHRSEAVFKVAAEICKASRITAEGVLNIT*
Ga0075014_10078566023300006174WatershedsALLFTLAASSVMSEEGPVRSNDALVKVAEEICKASRITTEGVLNS*
Ga0066660_1168832923300006800SoilLLFTLAASSVMSAEGPVHSSNAAAKVAEEICKASRITTEGVLNIT*
Ga0102924_135384313300007982Iron-Sulfur Acid SpringFTLAASSVMSGEEPMRGSDAVVKVAEEICKASRITTEGASKG*
Ga0105251_1047583323300009011Switchgrass RhizosphereEDALLFTVAASSVMSAEGPVHRSDAVAKVAAEICKASRIKAEGVLNIT*
Ga0099830_1073761613300009088Vadose Zone SoilSSVMSADMSGEAPVHNSNAAVKVAKEISKASRITTEGVLNIT*
Ga0105250_1050092513300009092Switchgrass RhizosphereKQEDALLFTLAASSVMSAEGPLRGTKAADKVADEICKATRITTEGVLS*
Ga0066709_10037060013300009137Grasslands SoilSSVMSAEGPVHSNHAVVKVAEKICKASRITAEGALNIT*
Ga0116222_110749823300009521Peatlands SoilVLFTLAASSVMSAEGPVHSSVAAAKVAEEICKASRITTEGVLKIT*
Ga0116221_128043923300009523Peatlands SoilALLFTLAASSVMSAEGPVHGSDAVVKVAEEICKASRITTEGVLSTQLV*
Ga0116221_130121813300009523Peatlands SoilMSAEGPVHRSAAVVKVAAEICKASRITTKGVLNIA*
Ga0105237_1227704823300009545Corn RhizosphereLFILASSSVMSAEAADHRKDAAGLVAAEICKASRITAEGVLNTI*
Ga0116115_115724623300009631PeatlandLFTLAASSVMSAEGQVHSNKAAARVAEEICKASRITTEGVLNVT*
Ga0116135_116217823300009665PeatlandLFTLAASSVMSADGPVHSSDAVVKVAEEICKASRITTEGVLNNSELV*
Ga0116224_1028781513300009683Peatlands SoilVLFTLAASSVMSAEGPVHSSVAAAKVAQEISKASRITTEGVLKIT*
Ga0074045_1098774823300010341Bog Forest SoilAVLFTLAASSVMSAQGPVHSSDAAAKVAEEICKASRITTEGVLNIT*
Ga0126372_1058857113300010360Tropical Forest SoilVLFALAASSVMTAEGPVHSHHAVVKVAEEICKASRITVEAVQYIT*
Ga0126377_1300874323300010362Tropical Forest SoilSAEGALNSSSAAVKAAEQICKASRITTEGVLNIT*
Ga0126379_1155777023300010366Tropical Forest SoilASSVMSAEGTLNSSSAAVKAAEEICKASRVTTEVF*
Ga0134122_1169895623300010400Terrestrial SoilVMSAEGPLRGTKAADKVADEICKATRITTEGVLS*
Ga0138514_10006861723300011003SoilSSVMSAEGPVRRNDAVAKVAEEICKASRITAEGVLNIT*
Ga0150983_1272861923300011120Forest SoilSAEGPVHRRAAVVKVAEEICKASRITTEGVLNVI*
Ga0137383_1032173223300012199Vadose Zone SoilLFTLAASSAMSAEGQLHSGDAAVKVAEELCKASRITTEGVLNVA*
Ga0137399_1009940413300012203Vadose Zone SoilASSAMSAEGPLHSGDVAVKVAEELCKASRITTEGVLSVS*
Ga0137395_1032690613300012917Vadose Zone SoilEDALLFTLAASSVMSAEGPVRSGHAAVRVAEEICKASRITTEGVLNVT*
Ga0137396_1017115733300012918Vadose Zone SoilSAEGPVHRSDAVVKVAEEICKASRITAEGILNVT*
Ga0137359_1149747823300012923Vadose Zone SoilSVMSAEGPVYSNKAAVRVAEEICKASRITTEGVLNVT*
Ga0137416_1090831513300012927Vadose Zone SoilEDALLFTLAASSAMSAEGPLHSGDAAVKVAEELCKASRITTEGVLSVS*
Ga0126375_1052896023300012948Tropical Forest SoilRFTLAASSVMSAEGALNSSSAAVKAAEQICKASRITTEGVLNIT*
Ga0164298_1015041313300012955SoilDALLFTLAASSVMSAEGPVHRSDAVVKVAAEICKASRIKAEGVLNIT*
Ga0163162_1037238133300013306Switchgrass RhizosphereALLFTLAASSVMSAEGSVYRSDAVVKVAAEICKASRITAEGALNIT*
Ga0181535_1034910913300014199BogALLFTLAASSVMSADGPVHSSDAVVKVAEEICKASRITTEGVLNNSELV*
Ga0182018_1022929213300014489PalsaEDAVLFTLAASSVMSAEEPTDSSNAAAKVAGEISKARRITTTGALNLA*
Ga0182013_1045448523300014492BogSVMSADGPVHGSDAVVKVAEEICKASRITTEGVLNNS*
Ga0182024_1129309023300014501PermafrostSAEGPVRSSDAVVKVAREICKASRITAEGVLNVT*
Ga0137403_1049764913300015264Vadose Zone SoilSSVMSAEGSVRSGDAAVKVAEEICKVSRITTEGVLNIT*
Ga0187806_133291923300017928Freshwater SedimentTLAASSVMSAEGPVRSSAAVVKVAAEICKASRITTEGILNIT
Ga0187801_1051702923300017933Freshwater SedimentSVMSAEGPVHGSDAVVKVAEEICKASRITTEGVLNNSELV
Ga0187848_1033238813300017935PeatlandASSVMSAEGPVPSGDAAVKVAEEISKASRITTEGVLNVT
Ga0187879_1011396233300017946PeatlandLLFTLAASSVMSAEGPVPSGDAAVKVAEEISKASRITTEGVLNVT
Ga0187782_1113631123300017975Tropical PeatlandAASSVMSAGGPVHSSDAVVKLAKELSKAARITAEGVLKVS
Ga0187886_137151223300018018PeatlandALLFTLAASSVMSAEGPVHRGDAAVKVAEEISKASRITTEGVLNIT
Ga0187855_1069743423300018038PeatlandLFTLAASSVMSADGPVHSSDAVVKVAEEICKASRITTEGVLNNNELV
Ga0187859_1003298843300018047PeatlandFTLAASSVMSADGPVHRSDAVVKVAEEICKASRITTEGVLNNSELV
Ga0187859_1048881113300018047PeatlandGDALLFTLAASSVMSAEGAVPTSAAAIKIAEEICKASRITTEGALNKA
Ga0187852_139676323300019082PeatlandALLFTLAASSVMSAEGQVHSNKAAARVAEEICKASRITTEGVLNVT
Ga0187800_182631313300019278PeatlandDALLFTLAASSIMSAGGAFHGSKAAVKVAQAISKASRITTEGALNMKDGQIL
Ga0193749_110240013300020010SoilVMSAEGPVRRNDAVAKVAEEICKASRITAEGVLNIT
Ga0210407_1066875923300020579SoilAMRFTLAASSVMSAEGPVLYSNHAVLKVAEEICKASRITTEGVLNIT
Ga0210403_1055056223300020580SoilSSVMSADGPVHSSDAVVKVAEEICKASRITTEGVLNNSELV
Ga0210399_1009638713300020581SoilFLFTLAASSVMSAEGQVPNSKAAVKVAEEICKASRITTEGVLNVT
Ga0210399_1023064613300020581SoilKDALLFTLAASSAMSAEGPLRSGDAAVKVAEELCKASRITTEGVLNVA
Ga0210395_1119708613300020582SoilTLAASSVMSAEGPVHPSDAVVKVAEEICKASRITTEGVLDNS
Ga0210400_1011859233300021170SoilEDALLFTLAASSVMSADGPVHSSDAVVKVAEEICKASRITTEGVLNNSELV
Ga0210400_1153217023300021170SoilLLFTLAASSVMSAEGPVHSSNAVTKVAENICKASRITTAGVLSIT
Ga0210405_1068764913300021171SoilSSVMSAEGPVHSSKAAVKVAEEICKASRITTEGVLNIT
Ga0210408_1049595423300021178SoilAASSVMSAEGPVQGSNAVVKVAEKISKAIRITAEGALNLR
Ga0210396_1019056513300021180SoilSVMPAEGPVLYSNRAVLKVAEEICKASRITTEGVLNIT
Ga0210397_1156254823300021403SoilALLFTLAASSVMSAEGAVHTSDAVVKVAQEICKASRITAEGVLNIT
Ga0182009_1081435813300021445SoilVMSAEAPGHRNDAAGLVAAEICKASRITAEGVLNTI
Ga0210392_1144550423300021475SoilLFTLAASSVMSAEGSVHTSDAVVKVAEEICKASRITTEGVLDNS
Ga0210398_1113611713300021477SoilVMSEEGPVSSSDAVVKVAEEICKASRITTEGVLNI
Ga0210402_1143017823300021478SoilLAASSAMSAEGPLRSGDAAVKVAEELCKASRITTEGVLNVA
Ga0212123_1065124923300022557Iron-Sulfur Acid SpringVLFTLAASSVMSAEGTIHSSNAAVKVAEKISKASRITTEGILNIT
Ga0212123_1073856213300022557Iron-Sulfur Acid SpringFTLAASSVMSGEEPMRGSDAVVKVAEEICKASRITTEGASKG
Ga0137417_107714713300024330Vadose Zone SoilEQEDALLFALAASSAMSAEGPLRSGDAAVKVAEELCKASRITTEGVLNVA
Ga0209171_1007590113300025320Iron-Sulfur Acid SpringLAASSVMSAEGPVRSSDAVVKVAQEICKASRITAEGVLNVT
Ga0207680_1009668133300025903Switchgrass RhizosphereFTLAASSVMSAEGSVDQSDAVVKVAAEICKASRITAEGALNIT
Ga0207695_1057637223300025913Corn RhizosphereSVMSAEGPLRGTKAADKVADEICKATRITTEGVLS
Ga0209471_121597713300026318SoilMSAEGPLRSGDAAVKVAEELCKASRITTEGVLNVA
Ga0209152_1040119913300026325SoilQEDALLFILASSSVMSAEAPGHRNDAAGIVAAEICKVSRITAEGVLNTI
Ga0257170_104520913300026351SoilVMSAEGPVHSSHAAVKVAEEICKASRITTEGVLNIT
Ga0257177_106944113300026480SoilASSVMSAEGPMHSSDAMVKVADEICKASRITAEGVLNIT
Ga0209332_108202023300027439Forest SoilDAVLFTLAASSVMSAEGPLSNSKAAERVAEEICEASRITTEGVLKIT
Ga0209221_116168913300027609Forest SoilDGPVHGSDAVVKVAEEICKASRITTEGVLNNSELV
Ga0209528_114616123300027610Forest SoilEDALLFTLAASSVMSAEGPVHRSEAVVKVAAEICKASRITAEGVLNIT
Ga0209118_100011533300027674Forest SoilMSAEEPVHSSNAVVKVAEEICKASRITTEGVLNVT
Ga0209011_117611713300027678Forest SoilDALLFTLAASSAMSAEGPLHSGDVAVKVAEELSKASRITTEGVLNVA
Ga0208989_1029507013300027738Forest SoilAMSAEGPLHSGDVAVKVAEELSKASRITTVGVLNVA
Ga0209180_1013513513300027846Vadose Zone SoilSSLMSAEGPVHSSKAAVRIAERICKATRIKTEVVSNIT
Ga0209275_1014121813300027884SoilDALLFTLAASSVMSAEGPVHSSKAAVKVAEEICKASRITTEGVLNIT
Ga0209380_1053292213300027889SoilIMSAEGPAHNTDAVVKVAEEICKATRITAEGVLNIT
Ga0209415_1113115013300027905Peatlands SoilASSVMSAEGPVHGSDAVVKVAEEISKASRITTEGVLSS
Ga0209526_1013347133300028047Forest SoilTLAASSVMSAEGPVLYSNHAVLKVAEEICKASRITTEGVLNIT
Ga0222749_1073891823300029636SoilLFTLAASSVMSAEGPVHGSAAVVKVAKEISKASRITTEGVLSS
Ga0265750_107284323300030813SoilDALLFTLAASSVMSAEGPVHGSDAVVKVAEEICKASRITTEGVLNNSELV
Ga0307474_1016509313300031718Hardwood Forest SoilAASSVMSAEGPVHGSDAVVKVAEEICKASRITTEGVLRAS
Ga0307474_1119875213300031718Hardwood Forest SoilAMSAEGPARGNNAAAKVAEEICKACRITTAGVLNLARRGLK
Ga0311301_1188609123300032160Peatlands SoilAASSVMSAEGPVHNNNAAARVAEEICKASRITTGGVLNIT
Ga0307470_1092833013300032174Hardwood Forest SoilFTLAASSVMSAEGPVHNNKAAVRVAEEICKASRITTEGVLNVT
Ga0307471_10067744113300032180Hardwood Forest SoilFTLAASSVMSAEGPVHSNKAAARVAEEICKASRITTEGVLNVT
Ga0307471_10092718313300032180Hardwood Forest SoilTLAASSVMSAEGPVHSSDAVVKVAGEICKASRITAEGALNIT
Ga0306920_10017816513300032261SoilAASSVMSAEGPVHRSDAVVKVAEEISKASRITAEGVLNIT
Ga0335083_1149001013300032954SoilDAVMFTLAASSVLSAEEPSREKEALARIAGEICKASRITTEGALKAAE

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.