NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F085018

Metagenome Family F085018

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F085018
Family Type Metagenome
Number of Sequences 111
Average Sequence Length 82 residues
Representative Sequence MGKLEVRLLKHTCRAELDRYLRLYSRSFNPDERVSPQVLRWVIQPSPARVNPVHLFAAYLDKRLVGGACTLVLPMFQVVF
Number of Associated Samples 86
Number of Associated Scaffolds 111

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 90.99 %
% of genes near scaffold ends (potentially truncated) 98.20 %
% of genes from short scaffolds (< 2000 bps) 81.08 %
Associated GOLD sequencing projects 80
AlphaFold2 3D model prediction Yes
3D model pTM-score0.65

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (99.099 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland
(29.730 % of family members)
Environment Ontology (ENVO) Unclassified
(84.685 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Water (non-saline)
(56.757 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 23.15%    β-sheet: 21.30%    Coil/Unstructured: 55.56%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.65
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 111 Family Scaffolds
PF064393keto-disac_hyd 16.22
PF13620CarboxypepD_reg 5.41
PF05063MT-A70 3.60
PF09195Endonuc-BglII 3.60
PF01156IU_nuc_hydro 1.80
PF01555N6_N4_Mtase 1.80
PF07927HicA_toxin 0.90
PF14103DUF4276 0.90

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 111 Family Scaffolds
COG4725N6-adenosine-specific RNA methylase IME4Translation, ribosomal structure and biogenesis [J] 7.21
COG0863DNA modification methylaseReplication, recombination and repair [L] 1.80
COG1041tRNA G10 N-methylase Trm11Translation, ribosomal structure and biogenesis [J] 1.80
COG1957Inosine-uridine nucleoside N-ribohydrolaseNucleotide transport and metabolism [F] 1.80
COG2189Adenine specific DNA methylase ModReplication, recombination and repair [L] 1.80
COG1724Predicted RNA binding protein YcfA, dsRBD-like fold, HicA-like mRNA interferase familyGeneral function prediction only [R] 0.90

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms99.10 %
UnclassifiedrootN/A0.90 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300005552|Ga0066701_10561434All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium700Open in IMG/M
3300009519|Ga0116108_1246321All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2522Open in IMG/M
3300009522|Ga0116218_1243722All Organisms → cellular organisms → Bacteria → Acidobacteria808Open in IMG/M
3300009524|Ga0116225_1048972All Organisms → cellular organisms → Bacteria → Acidobacteria2039Open in IMG/M
3300009547|Ga0116136_1026288All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA21827Open in IMG/M
3300009547|Ga0116136_1081119All Organisms → cellular organisms → Bacteria → Acidobacteria860Open in IMG/M
3300009548|Ga0116107_1148079All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2650Open in IMG/M
3300009549|Ga0116137_1100443All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium848Open in IMG/M
3300009616|Ga0116111_1021018All Organisms → cellular organisms → Bacteria → Acidobacteria2280Open in IMG/M
3300009617|Ga0116123_1063765All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA21025Open in IMG/M
3300009629|Ga0116119_1144865All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2593Open in IMG/M
3300009631|Ga0116115_1068195All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2929Open in IMG/M
3300009639|Ga0116122_1259093All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2537Open in IMG/M
3300009646|Ga0116132_1263121All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2525Open in IMG/M
3300009764|Ga0116134_1335114All Organisms → cellular organisms → Bacteria → Acidobacteria519Open in IMG/M
3300010339|Ga0074046_10624962All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2636Open in IMG/M
3300010379|Ga0136449_102119711All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2824Open in IMG/M
3300010379|Ga0136449_103619385All Organisms → cellular organisms → Bacteria → Acidobacteria586Open in IMG/M
3300014153|Ga0181527_1057780All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA22029Open in IMG/M
3300014153|Ga0181527_1311325All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2618Open in IMG/M
3300014155|Ga0181524_10166016All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA21122Open in IMG/M
3300014155|Ga0181524_10434692All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2567Open in IMG/M
3300014156|Ga0181518_10125109All Organisms → cellular organisms → Bacteria → Acidobacteria1405Open in IMG/M
3300014158|Ga0181521_10010324All Organisms → cellular organisms → Bacteria → Acidobacteria9165Open in IMG/M
3300014159|Ga0181530_10213761Not Available1053Open in IMG/M
3300014200|Ga0181526_11005553All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2524Open in IMG/M
3300014494|Ga0182017_10997669All Organisms → cellular organisms → Bacteria → Acidobacteria502Open in IMG/M
3300014638|Ga0181536_10328591All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2702Open in IMG/M
3300014838|Ga0182030_11155218All Organisms → cellular organisms → Bacteria → Acidobacteria666Open in IMG/M
3300014839|Ga0182027_10085451All Organisms → cellular organisms → Bacteria3835Open in IMG/M
3300014839|Ga0182027_10352415All Organisms → cellular organisms → Bacteria → Acidobacteria1650Open in IMG/M
3300017925|Ga0187856_1021606All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA23265Open in IMG/M
3300017929|Ga0187849_1036759All Organisms → cellular organisms → Bacteria2433Open in IMG/M
3300017929|Ga0187849_1109231All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA21162Open in IMG/M
3300017929|Ga0187849_1137815All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2996Open in IMG/M
3300017931|Ga0187877_1070578All Organisms → cellular organisms → Bacteria1523Open in IMG/M
3300017935|Ga0187848_10198892All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2862Open in IMG/M
3300017938|Ga0187854_10073583All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA21646Open in IMG/M
3300017940|Ga0187853_10152925All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA21103Open in IMG/M
3300017940|Ga0187853_10344774All Organisms → cellular organisms → Bacteria → Acidobacteria666Open in IMG/M
3300017941|Ga0187850_10449539All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2559Open in IMG/M
3300017946|Ga0187879_10110885All Organisms → cellular organisms → Bacteria → Acidobacteria1568Open in IMG/M
3300017961|Ga0187778_10382080All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2921Open in IMG/M
3300017972|Ga0187781_10212974All Organisms → cellular organisms → Bacteria → Acidobacteria1364Open in IMG/M
3300017973|Ga0187780_10971290All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2618Open in IMG/M
3300017975|Ga0187782_10451670All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2980Open in IMG/M
3300017988|Ga0181520_11032470All Organisms → cellular organisms → Bacteria → Acidobacteria543Open in IMG/M
3300018002|Ga0187868_1024051All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA22882Open in IMG/M
3300018004|Ga0187865_1050492All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA21672Open in IMG/M
3300018004|Ga0187865_1154441All Organisms → cellular organisms → Bacteria → Acidobacteria803Open in IMG/M
3300018005|Ga0187878_1093797All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA21238Open in IMG/M
3300018009|Ga0187884_10028351All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA22829Open in IMG/M
3300018013|Ga0187873_1097960All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA21166Open in IMG/M
3300018013|Ga0187873_1217795All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2711Open in IMG/M
3300018017|Ga0187872_10437260All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2549Open in IMG/M
3300018018|Ga0187886_1082885All Organisms → cellular organisms → Bacteria1376Open in IMG/M
3300018019|Ga0187874_10104036All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1234Open in IMG/M
3300018019|Ga0187874_10357989All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2590Open in IMG/M
3300018021|Ga0187882_1369881All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2545Open in IMG/M
3300018022|Ga0187864_10274179All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2763Open in IMG/M
3300018022|Ga0187864_10468452All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2533Open in IMG/M
3300018023|Ga0187889_10043544All Organisms → cellular organisms → Bacteria2445Open in IMG/M
3300018024|Ga0187881_10315080All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2647Open in IMG/M
3300018024|Ga0187881_10345270All Organisms → cellular organisms → Bacteria → Acidobacteria613Open in IMG/M
3300018025|Ga0187885_10039946All Organisms → cellular organisms → Bacteria2468Open in IMG/M
3300018033|Ga0187867_10635976All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2583Open in IMG/M
3300018044|Ga0187890_10341111All Organisms → cellular organisms → Bacteria → Acidobacteria840Open in IMG/M
3300018057|Ga0187858_10110912All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA21863Open in IMG/M
3300018057|Ga0187858_10305198All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA21008Open in IMG/M
3300018062|Ga0187784_10135885All Organisms → cellular organisms → Bacteria → Acidobacteria2008Open in IMG/M
3300018062|Ga0187784_10240300All Organisms → cellular organisms → Bacteria1474Open in IMG/M
3300018062|Ga0187784_11006444All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2662Open in IMG/M
3300018086|Ga0187769_10821571All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2703Open in IMG/M
3300018088|Ga0187771_10103396All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA22298Open in IMG/M
3300018088|Ga0187771_10292535All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA21364Open in IMG/M
3300018088|Ga0187771_10605704All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2928Open in IMG/M
3300018088|Ga0187771_10839760All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2779Open in IMG/M
3300018088|Ga0187771_11526381All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2567Open in IMG/M
3300018089|Ga0187774_11227481All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium539Open in IMG/M
3300018090|Ga0187770_10035259All Organisms → cellular organisms → Bacteria3531Open in IMG/M
3300018090|Ga0187770_10104312All Organisms → cellular organisms → Bacteria → Acidobacteria2120Open in IMG/M
3300018090|Ga0187770_11256631All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2599Open in IMG/M
3300025439|Ga0208323_1077801All Organisms → cellular organisms → Bacteria → Acidobacteria555Open in IMG/M
3300025442|Ga0208034_1012502All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA22726Open in IMG/M
3300025446|Ga0208038_1012006All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA22452Open in IMG/M
3300025448|Ga0208037_1015132All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA21963Open in IMG/M
3300025459|Ga0208689_1003351All Organisms → cellular organisms → Bacteria → Acidobacteria7133Open in IMG/M
3300025469|Ga0208687_1013773All Organisms → cellular organisms → Bacteria2413Open in IMG/M
3300025472|Ga0208692_1025427All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA21674Open in IMG/M
3300025477|Ga0208192_1036547All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA21041Open in IMG/M
3300027854|Ga0209517_10461420All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2700Open in IMG/M
3300029817|Ga0247275_1143644All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2605Open in IMG/M
3300029911|Ga0311361_10097905All Organisms → cellular organisms → Bacteria → Acidobacteria4185Open in IMG/M
3300029957|Ga0265324_10306165All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2541Open in IMG/M
3300029990|Ga0311336_11694701All Organisms → cellular organisms → Bacteria → Acidobacteria558Open in IMG/M
3300030518|Ga0302275_10400820All Organisms → cellular organisms → Bacteria → Acidobacteria717Open in IMG/M
3300031238|Ga0265332_10426923All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium548Open in IMG/M
3300032160|Ga0311301_12389535All Organisms → cellular organisms → Bacteria → Acidobacteria597Open in IMG/M
3300032173|Ga0315268_11147444All Organisms → cellular organisms → Bacteria → Acidobacteria786Open in IMG/M
3300032805|Ga0335078_12716886All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2504Open in IMG/M
3300032828|Ga0335080_10687706All Organisms → cellular organisms → Bacteria → Acidobacteria1067Open in IMG/M
3300032892|Ga0335081_11604445All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium714Open in IMG/M
3300032955|Ga0335076_11759839All Organisms → cellular organisms → Bacteria → Acidobacteria509Open in IMG/M
3300033402|Ga0326728_10005035All Organisms → cellular organisms → Bacteria38042Open in IMG/M
3300033402|Ga0326728_10591706All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2868Open in IMG/M
3300033402|Ga0326728_10957348All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2599Open in IMG/M
3300033405|Ga0326727_10660699All Organisms → cellular organisms → Bacteria → Acidobacteria849Open in IMG/M
3300033405|Ga0326727_11249897All Organisms → cellular organisms → Bacteria → Acidobacteria512Open in IMG/M
3300033977|Ga0314861_0444625All Organisms → cellular organisms → Bacteria562Open in IMG/M
3300033982|Ga0371487_0148638All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA21171Open in IMG/M
3300033983|Ga0371488_0083092All Organisms → cellular organisms → Bacteria → Acidobacteria1829Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland29.73%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland18.02%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland15.32%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog9.01%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil6.31%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil5.41%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil3.60%
FenEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Fen2.70%
BogEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Bog1.80%
RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere1.80%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment0.90%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.90%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil0.90%
PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland0.90%
Bog Forest SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil0.90%
BogEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Bog0.90%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen0.90%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300005552Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150EnvironmentalOpen in IMG/M
3300009519Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_150EnvironmentalOpen in IMG/M
3300009522Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaGEnvironmentalOpen in IMG/M
3300009524Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaGEnvironmentalOpen in IMG/M
3300009547Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_40EnvironmentalOpen in IMG/M
3300009548Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_100EnvironmentalOpen in IMG/M
3300009549Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_100EnvironmentalOpen in IMG/M
3300009616Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_100EnvironmentalOpen in IMG/M
3300009617Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_100EnvironmentalOpen in IMG/M
3300009629Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_100EnvironmentalOpen in IMG/M
3300009631Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_100EnvironmentalOpen in IMG/M
3300009639Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_40EnvironmentalOpen in IMG/M
3300009646Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_150EnvironmentalOpen in IMG/M
3300009764Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_40EnvironmentalOpen in IMG/M
3300010339Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3EnvironmentalOpen in IMG/M
3300010379Sb_50d combined assemblyEnvironmentalOpen in IMG/M
3300014153Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_60_metaGEnvironmentalOpen in IMG/M
3300014155Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_60_metaGEnvironmentalOpen in IMG/M
3300014156Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_60_metaGEnvironmentalOpen in IMG/M
3300014158Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_60_metaGEnvironmentalOpen in IMG/M
3300014159Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_60_metaGEnvironmentalOpen in IMG/M
3300014200Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaGEnvironmentalOpen in IMG/M
3300014494Permafrost microbial communities from Stordalen Mire, Sweden - 712E3D metaGEnvironmentalOpen in IMG/M
3300014638Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_60_metaGEnvironmentalOpen in IMG/M
3300014838Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300014839Permafrost microbial communities from Stordalen Mire, Sweden - 712E1D metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300017925Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_40EnvironmentalOpen in IMG/M
3300017929Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_100EnvironmentalOpen in IMG/M
3300017931Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_100EnvironmentalOpen in IMG/M
3300017935Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_40EnvironmentalOpen in IMG/M
3300017938Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_150EnvironmentalOpen in IMG/M
3300017940Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_100EnvironmentalOpen in IMG/M
3300017941Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_150EnvironmentalOpen in IMG/M
3300017946Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10EnvironmentalOpen in IMG/M
3300017961Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MGEnvironmentalOpen in IMG/M
3300017972Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300017973Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MGEnvironmentalOpen in IMG/M
3300017975Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300017988Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_30_metaGEnvironmentalOpen in IMG/M
3300018002Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_40EnvironmentalOpen in IMG/M
3300018004Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_100EnvironmentalOpen in IMG/M
3300018005Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_150EnvironmentalOpen in IMG/M
3300018009Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_40EnvironmentalOpen in IMG/M
3300018013Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_100EnvironmentalOpen in IMG/M
3300018017Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_40EnvironmentalOpen in IMG/M
3300018018Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_150EnvironmentalOpen in IMG/M
3300018019Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_150EnvironmentalOpen in IMG/M
3300018021Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_150EnvironmentalOpen in IMG/M
3300018022Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_40EnvironmentalOpen in IMG/M
3300018023Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_100EnvironmentalOpen in IMG/M
3300018024Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_100EnvironmentalOpen in IMG/M
3300018025Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_100EnvironmentalOpen in IMG/M
3300018033Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_10EnvironmentalOpen in IMG/M
3300018044Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_10EnvironmentalOpen in IMG/M
3300018057Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_150EnvironmentalOpen in IMG/M
3300018062Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018086Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MGEnvironmentalOpen in IMG/M
3300018088Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MGEnvironmentalOpen in IMG/M
3300018089Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_20_MGEnvironmentalOpen in IMG/M
3300018090Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300025439Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_100 (SPAdes)EnvironmentalOpen in IMG/M
3300025442Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_100 (SPAdes)EnvironmentalOpen in IMG/M
3300025446Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_100 (SPAdes)EnvironmentalOpen in IMG/M
3300025448Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_100 (SPAdes)EnvironmentalOpen in IMG/M
3300025459Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_150 (SPAdes)EnvironmentalOpen in IMG/M
3300025469Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_100 (SPAdes)EnvironmentalOpen in IMG/M
3300025472Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_100 (SPAdes)EnvironmentalOpen in IMG/M
3300025477Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_150 (SPAdes)EnvironmentalOpen in IMG/M
3300027854Peat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes)EnvironmentalOpen in IMG/M
3300029817Soil microbial communities from Marcell Experimental Forest, Minnesota, USA - Bog25EnvironmentalOpen in IMG/M
3300029911III_Bog_N2 coassemblyEnvironmentalOpen in IMG/M
3300029957Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaGHost-AssociatedOpen in IMG/M
3300029990I_Fen_N2 coassemblyEnvironmentalOpen in IMG/M
3300030518Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N2_2EnvironmentalOpen in IMG/M
3300031238Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaGHost-AssociatedOpen in IMG/M
3300032160Sb_50d combined assembly (MetaSPAdes)EnvironmentalOpen in IMG/M
3300032173Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_topEnvironmentalOpen in IMG/M
3300032805Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2EnvironmentalOpen in IMG/M
3300032828Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4EnvironmentalOpen in IMG/M
3300032892Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5EnvironmentalOpen in IMG/M
3300032955Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5EnvironmentalOpen in IMG/M
3300033402Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB31MNEnvironmentalOpen in IMG/M
3300033405Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB29MYEnvironmentalOpen in IMG/M
3300033977Tropical peat soil microbial communities from peatlands in Loreto, Peru - SJ75EnvironmentalOpen in IMG/M
3300033982Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB22AY SIP fractionEnvironmentalOpen in IMG/M
3300033983Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB23AN SIP fractionEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Ga0066701_1056143413300005552SoilMTKLTVRLLKHTATRQIDQYLRLYSRCFNPDERVSPTVLRWVVQPSPARANPVHLFAAYHDGRLAGGAVTLVL
Ga0116108_124632113300009519PeatlandMEMRMGKLEVRLLKHTWGAELDRYLRLYSRSFNPDERVSPQVLRWVIQPSPARVNPVHLFAAYLDKRLVGGACTLVLPMFQ
Ga0116218_124372213300009522Peatlands SoilMQNLKVKLLKHTDRAELDRYLRLYSRSFNPDERVSTRILRWVMQPSPARVNPVHLFAAYLDKRLVGG
Ga0116225_104897213300009524Peatlands SoilLKHTDRAELDRYLRLYSRSFNPDERVSTEILRWVIQPSPARVNPVHLFAAYLDKRLIGGACTLVLPMFQV
Ga0116136_102628833300009547PeatlandMEMWMGKLEVRLLKHTCRAELDRYLRLYSRSFNPDERVSPQVLRWVIQPSPARVNPVHLFAAYLDKRLVGGACTLVLPMFQVV
Ga0116136_108111913300009547PeatlandMLKLTLKLLRPTERGDLEEYLRLYQRSFNPDERVSLSVLRRVIVPSPARVNPVHLFAAHLGHRLVGGACTLVLPAFSVVFGSYIFVDPALRGRGLGIQIL
Ga0116107_114807923300009548PeatlandMGKMEVRLLKHTMRAELDRYLRLYSRSFNPDERVSPQVLRWVIQPSPARVNPVHLFAAYLDKRLVGGACTLVLPMFRVVFGSYIFVDAALRGRGL
Ga0116137_110044313300009549PeatlandMSKLTVRLLQHPRRRELEEYLRLYSRCFNPDERVSPRVLRRVIVPSPARVNPVHLFAAYLDSRLVGGACTLVLPAFRVVFGSYI
Ga0116111_102101843300009616PeatlandMGKLEVRLLKHTCRAELDRYLRLYSRSFNPDERVSPQVLRWVIQPSPARVNPVHLFAAYLDKRLVGGACTLVLPMFQVVFGS
Ga0116123_106376513300009617PeatlandMGKLEVRLLKHTCRAELDRYLRLYSRSFNPDERVSPQVLRWVIQPSPARVNPVHLFAAYLDKRLVGGACTLVLPMFQVVFGSYIFVD
Ga0116119_114486523300009629PeatlandMGKMEVRLLKHTMRAELDRYLRLYSRSFNPDERVSPQVLRWVIQPSLARVNPVHLFAAYLDKRLVGGACTLVLP
Ga0116115_106819523300009631PeatlandLRLYSRSFNPDERVSPQVLRWVIQPSPARVNPVHLFAAYLDKRLVGGACTLVLPMFQVV
Ga0116122_125909313300009639PeatlandMEMRMGKLEVRLLKHTWGAELDRYLRLYSRSFNPDERVSPQVLRWVIQPSPARVNPVHLFAAYLDKRLVGGACTLVLPMFQVVFGSY
Ga0116132_126312123300009646PeatlandMGKLEVRLLKHTCRAELDRYLRLYSRSFNPDERVSPQVLRWVIQPSPARVNPVHLFAAYLDKRLVGGACTLVLPMFQV
Ga0116134_133511413300009764PeatlandMLKLTVRLLRHTQRRELEEYLRLYQRSFNPDERVSPRVLRRVIVPSPAGVNPVHLFAAYLDDRLVGGACTLVVPTFSVVFGSYIF
Ga0074046_1062496213300010339Bog Forest SoilMRMGKLEVRLLKHTRGAELDRYLRLYSRSFNPDERVSPQVLRWVIQPSPGRVNPVHLFAAYLDKRLVGGACTLVLPMFQVVFG
Ga0136449_10211971113300010379Peatlands SoilMPKLKVRLLKHTDRAELDRYLRLYSRSFNPDERVSTQILRWVMQPSPARVNPVHLFAAYLDKRLVGGACTLVLPMFQVVFGSYIF
Ga0136449_10361938513300010379Peatlands SoilMRKLTVQLLRHTERRQLQEYLRIYRRSFNPDERVSPHVLRRVIVPSPARVNPVHLFAAYQGDRLVGGACTLVLPA
Ga0181527_105778033300014153BogMEKWRGKLEVRLLKHTSGAELDRYLRLYSRSFNPDERVSPQILRWVIQPSPARVNPVHLFAAYLDKQLVGGACTLVLPMFQVVFGSYIFVDAAL
Ga0181527_131132523300014153BogMQNLKVNLLKHTDRAELDRYLRLYSRSFNPDERVSTQILRWVMQPSPARVNPVHLFAAYLDKRLVGGAC
Ga0181524_1016601613300014155BogMPKLKVRLLKHTDRAELDRYLRLYSRSFNPDERVSTQILRWVMRPSPARVNPVHLFAAYLDKRLVGGACTLVLPMFQVVFGSYIFVDP
Ga0181524_1043469213300014155BogMQNLKVNLLKHTDRAELDRYLRLYSRSFNPDERVSTQILRWVMQPSPARVNPVHLFAAYLDKRLVGGACTLVLPMFQVVFGSYIFVDPAL
Ga0181518_1012510923300014156BogMARLRVKLLKHTERAELDRYLRLYSRSFNPDERVSTEILRWVIQPSPARVNPVHLFAAYLDKRLIGGACTLVLPMFQVVF
Ga0181521_1001032483300014158BogMEMWMGKLEVRLLKHTCRAELDRYLRLYSRSFNPDERVSPQVLRWVIQPSPARVNPVHLFAAYLDKRLVGGACTLVLPMFQVVFGSYLFVD
Ga0181530_1021376113300014159BogMEMRMGKLEVRLLKHTKRAELDRYLRLYSRSFNPDERVSPQILRWVIQPSPARVNPVHLFAAYLDKQLVGGACTLVLPMFQV
Ga0181526_1100555313300014200BogMLKLHVKLLKHTDRAELDRYLRLYSRSFNPDERVSTQILRWVMQPSPARVNPVHLFAAYLDKQLVGGACTLVLPMFQVVFGSYIF
Ga0182017_1099766913300014494FenMHKLTVKLLHPSQRRALDEYLRLYQRSFNADERVSPRVLRRVVVPSPERVNPVHLFAAHQGDRMVGGACTLVLPAFSVVFGSYIFVDLELRSRGLG
Ga0181536_1032859113300014638BogMGKLEVRLLKHTRGAELDRYLRLYSRSFNPDERVSPRILRWVIQPSPARVNPVHLFAAYLDKRLVGGACTLVLPMFQ
Ga0182030_1115521813300014838BogMLKLTVQLLRHTQRRQLEEYLRIYQRSFNPDERVSPRVLRRVIIPAPARVNPVHLFAAYRGDRLVGGACTLLVPAFSV
Ga0182027_1008545153300014839FenMLKLTVQLLRHTERRKLAEYLKIYQRSFNPDERVSPQILRRVIVPSPARVNPVHLFAAYRGDRMVGGACTLVLPAFSVVFGSYIFVDPEL
Ga0182027_1035241533300014839FenMPKLTVKLLRYTQHRELDEYLRLYQRSFNPDERVSASILRRVIVPSPARVNPVHLFAAFLGDRMIGGACTLVLSAFSAVLGSYLFV
Ga0187856_102160613300017925PeatlandMGKLEVRLLKHTCRAELDRYLRLYSRSFNPDERVSPQVLRWVIQPSPARVNPVHLFAAYLDKRLVGGACTLVLPMFQVV
Ga0187849_103675943300017929PeatlandMGKLEVRLLKHTCRAELDRYLRLYSRSFNPDERVSPQVLRWVIQPSPARVNPVHLFAAYLDKRLVGGACTLVLPMFQVVFGSYIFVDAALRG
Ga0187849_110923123300017929PeatlandMGKLEVRLLKHTMRAELDRYLRLYSRSFNPDERVSPQVLRWVIQPSPARVNPVHLFAAYLDKRLVGGACTLVLPMF
Ga0187849_113781513300017929PeatlandMGKLEVRLLKNTSRAELDRYLRLYSRSFNPDERVSPQVLRWVIQPSPARVNAVHLFAAYLDKRLVGGACTLVLPMFQVVFGSYIFVDAALRG
Ga0187877_107057813300017931PeatlandMGKLEVRLLKHTCRAELDRYLRLYSRSFNPDERVSPRVLRWVIQPSPARVNPVHLFAAYLDKQLVGGA
Ga0187848_1019889223300017935PeatlandMQNLKVNLLKHTDRAELDRYLRLYSRSFNPDERVSTQILRWVMQPSPARVNPVHLFAAYLDKRLVGGACTLVLPMFQVVFGSYIFVD
Ga0187854_1007358313300017938PeatlandMGKLEVRLLKHTCRAELDRYLRLYSRSFNPDERVSPQVLRWVIQPSPARVNPVHLFAAYLDKRLVGGACTLV
Ga0187853_1015292513300017940PeatlandLEVRLLKRTCRAELGRYLRLYSRSFNPDERVSPRVLRWVIQPSPARVNPVHLFAAYLDKRLVGGACTLVLPMFQ
Ga0187853_1034477413300017940PeatlandMLKLTLKLLRPTERGDLEEYLRLYQRSFNPDERVSLSVLRRVIVPSPARVNPVHLFAAHLGHRLVGGACTLVLPAFSVVFGSYI
Ga0187850_1044953913300017941PeatlandMGKLEVRLLKHTCRAELDRYLRLYSRSFNPDERVSPQVLRWVIQPSPARVNPVHLFAAYLDKRLVGGACTLVLPMFQ
Ga0187879_1011088513300017946PeatlandMAKLRVRLLRHTDRAGLDRYLRLYRRSFNPDERVSTQILRWVIQPSPARVNPVHLFAAYLDKRLVGGACTLVLPMFQV
Ga0187778_1038208013300017961Tropical PeatlandMGKLQVRLLKHTSGVELDRYLRLYSRSFNPDERVSPQILRWVIQPSPARVNPVHLFAAYLDKEMVGGACTLVLPMFQVVFGSY
Ga0187781_1021297413300017972Tropical PeatlandMGKLEVRLLKHTNRAELERYLRLYSRSFNPDERVSPQILRWVIQPSPARVNPVHLFAAYLDKRLVGGACTLVLPMFQ
Ga0187780_1097129013300017973Tropical PeatlandMGKLRVRLLKQTSGAALDRFLRLYSRSFNPDERVSPRLLRWVIQPSPDRVNPVHLFAAYLDKQLVGGACTLVLPMF
Ga0187782_1045167013300017975Tropical PeatlandMRKLELQLLKHTNRVELDRYLRLYGRSFNPDERVSPRILRWVIQPSPARVNPVHLFAAYLDRQLVGGACTLVLPMFQ
Ga0181520_1103247013300017988BogMSKLTVKLLAHTQHRELEKYLRLYQRSFNPDERVNPSVLRRVIVPSPARVNPVHLFAAHLGDRLIGGACTLVLPAFSAV
Ga0187868_102405113300018002PeatlandMGKLEVLLLKHTCRAELDRYLRLYSRSFNPDERVSPQVLRWVIQPSPARVNPVHLFAAYLDKRLVGGACTLVLPMFQVV
Ga0187865_105049213300018004PeatlandLEVRLLKRTCRAELGRYLRLYSRSFNPDERVSPRVLRWVIQPSPARVNPVHLFAAYLDKRLVGGACTL
Ga0187865_115444123300018004PeatlandMLKLTLKLLRPTERGDLEEYLRLYQRSFNPDERVSLSVLRRVIVPSPARVNPVHLFAAYLGDRLVGGACTLVLPAFSVVFGSYIF
Ga0187878_109379713300018005PeatlandMGKLEVRLLKHTMRAELDRYLRLYSRSFNPDERVSPQVLRWVIQPSPARVNPVHLFAAYLDKRLVGGACTLVLPMFQVVFGSYIFVDPAL
Ga0187884_1002835163300018009PeatlandMGKLEVRLLKHTCRAELDRYLRLYSRSFNPDERVSPQVLRWVIQPSPARVNPVHLFAAYLDKRLVGGACTLVLPMFQVVFGSYLFVD
Ga0187873_109796013300018013PeatlandMGKLEVRLLKHTCRAELDRYLRLYSRSFNPDERVSPQVLRWVIQPSPARVNPVHLFAAYLDKRLVGGACTLVLPM
Ga0187873_121779523300018013PeatlandLEVRLLKRTCRAELGRYLRLYSRSFNPDERVSPRVLRWVIQPSPARVNPVHLFAAYLDKRLVGGACTLVLPMFQVVFGSYIFV
Ga0187872_1043726013300018017PeatlandMGKLEVRVLKHTCRAELDRYLRLYSRSFNPDERVSPQVLRWVIQPSPARVNPVHLFAAYLDKRLVGGACTLVLPMFQVV
Ga0187886_108288513300018018PeatlandMGKLEVRLLKNTSRAELDRYLRLYSRSFNPDERVSPQVLRWVIQPSPARVNPVHLFAAYLDKRLVGGACTLVLPMFQVVFGSYIFVDAALRG
Ga0187874_1010403613300018019PeatlandMLRLTVHLLRHTQRRELEEYLRLYQRSFNPDERVSPRVLRRVIVPSPARVNPVHLFAAYQGNRLVGGACTLVLPAFSV
Ga0187874_1035798913300018019PeatlandMGKLEVRLLKHTWGAELDRYLRLYSRSFNPDERVSPQVLRWVIQPSPARVNPVHLFAAYLDKRLVGGACTLVLPMFQV
Ga0187882_136988113300018021PeatlandLEVRLLKRTCRAELGRYLRLYSRSFNPDERVSPRVLRWVIQPSPARVNPVHLFAAYLDKRLVGGACTLVLPMFQVVFGS
Ga0187864_1027417923300018022PeatlandMGKLEVRVLKHTCRAELDRYLRLYSRSFNPDERVSPQVLRWVIQPSPARVNPVHLFAAYLDKRLVGGACTLVL
Ga0187864_1046845213300018022PeatlandMGKLEVRLLKHTCRAELDRYLRLYSRSFNPDERVSPQVLRWVIQPSPARVNPVHLFAAYLAKRLVGGACTLVLPMFQVVFGSYLFVDAAFRGRGLA
Ga0187889_1004354443300018023PeatlandMGKLEVRLLKHTCRAELDRYLRLYSRSFNPDERVSPQVLRWVIQPSPARVNPVHLFAAYLDKRLVGGACTLVLPMFQVVFGSY
Ga0187881_1031508013300018024PeatlandLEVRLLKRTCRAELGRYLRLYSRSFNPDERVSPRVLRWVIQPSPARVNPVHLFAAYLDKRLVGGACTLVLPMFQVVFGSYI
Ga0187881_1034527013300018024PeatlandMLKLTLKLLRPTERGDLEEYLRLYQRSFNPDERVSLSVLRRVIVPSPARVNPVHLFAAHLGDRLVGGACTLV
Ga0187885_1003994643300018025PeatlandMGKLEVRLLKHTCRAELDRYLRLYSRSFNPDERVSPQVLRWVIQPSPARVNPVHLFAAYLDKRLVGGACTLVLPMFQVVFGSYIFVDAA
Ga0187867_1063597613300018033PeatlandMAKLRVRLLKHTDRAELDRYLRLYSRSFNPDERVSTEILRWVIQPSPARVNPVHLFAAYLDKRLIGGACTLVLPMFQVVF
Ga0187890_1034111123300018044PeatlandMLKLTVRLLRHTQRRELEEYLRLYQRSFNPDERVSPSVLRRVVVPSPARVNPVHQFAAYLHDRLVGGACTMVLPAFSVVFG
Ga0187858_1011091213300018057PeatlandMVKLKVRLLRHTDRAGLDRYLRLYRRSFNPDERVSTQILRWVIQPSPARVNPVHLFAAYLDKRLVGGACTLVLPMFQVVFGSY
Ga0187858_1030519813300018057PeatlandMGKLEVRLLKHTCRAELDRYLRLYSRSFNPDERVSPQVLRWVIQPSPARVNPVHLFAAYLDKRLVGGACTL
Ga0187784_1013588513300018062Tropical PeatlandMGKLEVRLLKHTNRAELERYLRLYSRSFNPDERVSPQILRWVIQPSPARVNPVHLFAADLDRRLVGGACTLVLPMF
Ga0187784_1024030033300018062Tropical PeatlandMLKLTVHLLRHTQRRKLDEFLRLYKRSFNPDEQVSSRVLRRVIVPSPARVNPVHLFGAYCGDHLVGGACTLVVPAFHVVFGSYIFVDPE
Ga0187784_1100644413300018062Tropical PeatlandMRKLELRLLRHTNRLELDRYLRLYSRSFNSEERVSPQILRWVIQPAPARVNPVHLFAAYLDRQLVGGAC
Ga0187769_1082157113300018086Tropical PeatlandMLKLQVRLLKHTDRVELDRYFRLYNRSFNPDERVSTQILRWVIQPSPARVNPAHLFAAYLGKRLVGGACTLVLPMFQVVFG
Ga0187771_1010339613300018088Tropical PeatlandMGKLRVRLLKHTSGAELDRYLRLYSRSFNPDERVSPRVLRWVIQPSPARVNLVHLFAAYLDKQLVGGACTLVLPMFQAVFGSYIFVDP
Ga0187771_1029253513300018088Tropical PeatlandMGKLEVRLLKHTRGAELDRYLRLYSRSFNPDERVSPQVLRWVIQPSPARVNPVHLFAAYLDKRLVGGACTLVLPMFQVVFGSYIFVDAVLRGRGLGERI
Ga0187771_1060570413300018088Tropical PeatlandMQRLRVRLLKHTDRRELDRYLRLYSRCFNPDERVSPRILRWVIKPSPARLNPVHLFAGYLDGRIVGGACTLVLPTFRV
Ga0187771_1083976013300018088Tropical PeatlandMGKLEVRLLKHTSRAQLDHYLRLYSRSFNPDERVSPQVLRWVIQPSPARVNPVHLFAAYLDRQLVGGACTLVLPMFQVVFGSYIFVDAALRGRGLGERIL
Ga0187771_1152638113300018088Tropical PeatlandMGKLEVRLLKHTSSAELDRYLRLYSRSFNPDERVSPQVLRWVIQPSPARVNPAHLFGAYLDKRLVGGACTLVLPMFQVVF
Ga0187774_1122748123300018089Tropical PeatlandMSKLTVRLLRHTRRDELEEYLRLYSRCFNPDERVSPRVLRRVIVPSPARVNPVHLFAAYLDGRLVGGACTLVLPAFRVVF
Ga0187770_1003525913300018090Tropical PeatlandMPKLTLRLLQPSRRRELEAYLQLYGRSFDPDERVSPRVLRQVIVPSPSRVNPVHLFAAYLGRRMVGGACTLVLPMF
Ga0187770_1010431223300018090Tropical PeatlandMVSFHTADMEINVERMEVQLLKHTSGAELDRYLRLYSRSFSSDERVSPQILRWVIQPSPARVNPVHLFAGYLEKQLVGGACTLVL
Ga0187770_1125663113300018090Tropical PeatlandMGELEVRLLKHTCRAELDRYLRLYSRSFNPDERVSPRILRWVIQPSPARVNPVHLFAAYLDKRLVGGACTLV
Ga0208323_107780113300025439PeatlandMLKLTLKLLRPTERGDLEEYLRLYQRSFNPDERVSLSVLRRVIVPSPARVNPVHLFAAHLGDRLVGGACTL
Ga0208034_101250243300025442PeatlandMGKLEVRLLKHTCRAELDRYLRLYSRSFNPDERVSPQVLRWVIQPSPARVNPVHLFAAYLDKRLVGGACTLVLPMFQVVF
Ga0208038_101200643300025446PeatlandMGKLEVRLLKHTWGAELDRYLRLYSRSFNPDERVSPQVLRWVIQPSPARVNPVHLFAAYLDKRLVGGACTLVLPMFQVVFGSYLFVDAALRGRGLGVRI
Ga0208037_101513233300025448PeatlandMGKLEVRLLKHTWGAELDRYLRLYSRSFNPDERVSPQVLRWVIQPSPARVNPVHLFAAYLDKRLVGGACTLVLPMFQVVFGSYLFVDAALRGRG
Ga0208689_100335113300025459PeatlandMGKLEVRLLKNTSRAELDRYLRLYSRSFNPDERVSPQVLRWVIQPSPARVNAVHLFAAYLDKRLVGGACTLVLPMFQVVFGSYIFVDAALRGR
Ga0208687_101377313300025469PeatlandMGKLEVRLLKHTCRAELDRYLRLYSRSFNPDERVSPQVLRWVIQPSPARVNPVHLFAAYLDKRLVGGACTLVLPMFQVVFGSYIFVDAALRGR
Ga0208692_102542713300025472PeatlandMGKLEVRLLKHTCKAELDSYLRLYSRSFNPDERVSPQVLRWVIQPSPARVNPVHLFAAYLDKRLVGGACTLVLPMFQVVFGSYIFVDAALRGRGLGVRV
Ga0208192_103654713300025477PeatlandMGKLEVRLLKHTWGAELDRYLRLYSRSFNPDERVSPQVLRWVIQPSLARVNPVHLFAAYLDKRLVGGACTLVLPMFQVVFGSY
Ga0209517_1046142023300027854Peatlands SoilMGKWEVRLLKHTSRVQLDQYLRLYSRSFNPDERVSPQILRWVIQPSPARVNPVHLFAAYLDKRMVGGACTLVLPMFQVVFGSYI
Ga0247275_114364423300029817SoilMEIWRGELEVRLLKHSSGAELDRYLRLYSRSFNPDERVSPQILRWVIQPSPARVNPVHLFAAYSDKQLVGGACTLVLPMFQV
Ga0311361_1009790563300029911BogMQKLKVELLRPTDQKALDQFLRLYQRSFNPDERVSPAVLRRVMVPSPARVNPVHLFAAFLGDRLVGGACTLVLPAFS
Ga0265324_1030616513300029957RhizosphereMQNLKVKLLKHTDRAELNRYLRLYSRSFNPDERVSTQILRWVVQPSPARVNPVHLFAAYRDKQLVGGACTLVLPMFQVVF
Ga0311336_1169470113300029990FenMHKLTVSLLRPSEGHALDEYLRLYQRSFNADERVSSAVLRRVMIPSPERVNPVHLFAAYQGDRMVGGACTLVLPAFSVVFGSYLFVDPHLRSRGLGMRI
Ga0302275_1040082023300030518BogMQKLTVELLRPTAHKALDQFLRLYQLSFNPDERVSPAVLRRVMAPSPARVNPVHLFAAYLGDRLVGGACTLVLPAFS
Ga0265332_1042692323300031238RhizosphereMLKLSVQLLRHTQRRPLDAYLGLYQRSFSPDERVSSQVLRRVIVPSPARVNPVHLFAAYLGQRLVGGA
Ga0311301_1238953513300032160Peatlands SoilMRKLTVQLLRHTERRQLQEYLRIYRRSFNPDERVSPHVLRRVIVPSPARVNPVHLFAAYQGDRLVGGACTLVLPAFSAVFRSYIFVDPALRG
Ga0315268_1114744423300032173SedimentMPRLTLRLLKPSRRRELEAYLRLYRRCFNPDERVSTRILRWVIEPSPMRVNPVHLFAAYTGRRLVGGTCTVVFPSFQVVFGSYIFVDPS
Ga0335078_1271688613300032805SoilMGKLRIRLLRHTNRAALDQYLRLYSRSFNPDERVSTEILRWVIQPSPARVNPVHLFAAYADRRLVGGACTLVLPM
Ga0335080_1068770613300032828SoilMRKLTVRLLRHTERCQLQEYLRIYQRSFNPDERVSPRILRRVMVPSPARVNPVHLFAAYEGRRLVGGACTLVLPAFSAVFGSYIF
Ga0335081_1160444523300032892SoilMPKLTVHLLRHTERRKLEEYLRLYKRSFNPDERVSPRVLRRVVVPSPARVNPVHLFAAYLGDRLAGGACTLVLPAFSVVFGSYIFVDPALRGRG
Ga0335076_1175983923300032955SoilMPKLTLQLLHHTDREGLESYLRLYQRSFSPDERVSPTVLRRVIVPAPARVNPVHLFAARLGDRLVGGACT
Ga0326728_1000503583300033402Peat SoilMRKLTVQLVRHTERRKLDEYMRLYQRSFNPDERVSPSVLRWVIVPSPARVNPVHLFAAYRGDRMIGGACTLVLPAFSVVFGSYIFVDPALRG
Ga0326728_1059170623300033402Peat SoilMLRCAQHDKQGAKLKLHVRLLKHTDRAELDRYLRLYSRSFNPDERVSAQILRWVIQPSPARVNPVHLFAAYLDKQLVGGACTLVLPMFQVVFGSYIFVDPALRRRGS
Ga0326728_1095734813300033402Peat SoilMGNLDVRLLKHTKRAELDSYLRLYSRSFDPDERVSPRVLRWVIQPSPARVNPVHLFAAYLDRQLVGGACTLVLPM
Ga0326727_1066069913300033405Peat SoilMLRLTVQLLSHKQRRKLDEYLRLYGRSFNPDERVSPGVLRRVMVPSPARVNPVHLFAASLGSRLVGGACTLVLPAFNAVFGSY
Ga0326727_1124989713300033405Peat SoilMAKLGLSLIQHHQRRELEAYLRLYALSFNPDERVSPQVLRRVIAPSPARVNPVHLFAAYLDDRLVGGACMLVLPAFRAVFGSYIFVDPALR
Ga0314861_0444625_305_5623300033977PeatlandMMYKLNRSEGTMPTLAVRLLEHTEPKELDDYLRLYSRCFNPHERVSPRILRWVIEPSPARVNPAHLFAAYLDGKLVGGACTLVLPA
Ga0371487_0148638_916_11703300033982Peat SoilMQNLKVKLLKHTDRAEVDRYLRLYSRSFNPDERVSTQVLRWVMQPSPARVNPVHLFAAYLDKQLVGGACTLVLPMFQVVFGSYVF
Ga0371488_0083092_3_2513300033983Peat SoilMNLEMRMRKLELRLLKRTNGAELDRYLRLYSRSFNPDERVSPQILRWVIQPSPARVNPVHLFAAYLDKQLVGGACTLVLPMFQ

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.