NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F085057

Metagenome / Metatranscriptome Family F085057

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F085057
Family Type Metagenome / Metatranscriptome
Number of Sequences 111
Average Sequence Length 55 residues
Representative Sequence VSLAEQSLSLSSLAVIPCKKEHQGRLGESGMAPRYWSWVLDHLVAVNKVSKVSQVKQ
Number of Associated Samples 89
Number of Associated Scaffolds 111

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Eukaryota
% of genes with valid RBS motifs 74.55 %
% of genes near scaffold ends (potentially truncated) 49.55 %
% of genes from short scaffolds (< 2000 bps) 97.30 %
Associated GOLD sequencing projects 88
AlphaFold2 3D model prediction Yes
3D model pTM-score0.32

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Eukaryota (78.378 % of family members)
NCBI Taxonomy ID 2759
Taxonomy All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere
(52.252 % of family members)
Environment Ontology (ENVO) Unclassified
(79.279 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant surface
(70.270 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 42.35%    β-sheet: 0.00%    Coil/Unstructured: 57.65%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.32
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 111 Family Scaffolds
PF10536PMD 4.50



 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms78.38 %
UnclassifiedrootN/A21.62 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300005347|Ga0070668_100088909All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum2432Open in IMG/M
3300005365|Ga0070688_101422048All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum563Open in IMG/M
3300005544|Ga0070686_101903561All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum508Open in IMG/M
3300005617|Ga0068859_102729886All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum542Open in IMG/M
3300005719|Ga0068861_100633622All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum985Open in IMG/M
3300009092|Ga0105250_10502897All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum550Open in IMG/M
3300009101|Ga0105247_11835955All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum505Open in IMG/M
3300009553|Ga0105249_12348309Not Available606Open in IMG/M
3300009553|Ga0105249_13107242Not Available533Open in IMG/M
3300009972|Ga0105137_108316All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum551Open in IMG/M
3300009980|Ga0105135_112606All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum671Open in IMG/M
3300009981|Ga0105133_124842Not Available548Open in IMG/M
3300009990|Ga0105132_104949All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum947Open in IMG/M
3300009992|Ga0105120_1043959Not Available556Open in IMG/M
3300009994|Ga0105126_1007502All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum976Open in IMG/M
3300009994|Ga0105126_1030014All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum635Open in IMG/M
3300010397|Ga0134124_12145246All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum598Open in IMG/M
3300010397|Ga0134124_12337758All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum575Open in IMG/M
3300010397|Ga0134124_12804987All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum531Open in IMG/M
3300010401|Ga0134121_11510130All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum687Open in IMG/M
3300010403|Ga0134123_10486988All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum1157Open in IMG/M
3300013306|Ga0163162_11082749All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum908Open in IMG/M
3300014325|Ga0163163_11019840All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum891Open in IMG/M
3300014325|Ga0163163_12781069Not Available546Open in IMG/M
3300014326|Ga0157380_10560147Not Available1123Open in IMG/M
3300014968|Ga0157379_12482683All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum518Open in IMG/M
3300015278|Ga0182099_1010047All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum859Open in IMG/M
3300015280|Ga0182100_1088965All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum524Open in IMG/M
3300015280|Ga0182100_1091483All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum519Open in IMG/M
3300015284|Ga0182101_1036739All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum703Open in IMG/M
3300015290|Ga0182105_1081258All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum559Open in IMG/M
3300015293|Ga0182103_1022667All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum806Open in IMG/M
3300015293|Ga0182103_1045731All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum657Open in IMG/M
3300015306|Ga0182180_1096172All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum500Open in IMG/M
3300015310|Ga0182162_1065757All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum647Open in IMG/M
3300015310|Ga0182162_1084203All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum592Open in IMG/M
3300015310|Ga0182162_1101828Not Available551Open in IMG/M
3300015311|Ga0182182_1043740All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum722Open in IMG/M
3300015315|Ga0182120_1121396All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum531Open in IMG/M
3300015316|Ga0182121_1108128All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum570Open in IMG/M
3300015316|Ga0182121_1129775Not Available528Open in IMG/M
3300015320|Ga0182165_1041241All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum809Open in IMG/M
3300015325|Ga0182148_1057661Not Available709Open in IMG/M
3300015325|Ga0182148_1138286All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum514Open in IMG/M
3300015326|Ga0182166_1065954All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum675Open in IMG/M
3300015326|Ga0182166_1078631All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum635Open in IMG/M
3300015326|Ga0182166_1130605All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum525Open in IMG/M
3300015327|Ga0182114_1139306Not Available536Open in IMG/M
3300015330|Ga0182152_1149427All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum510Open in IMG/M
3300015331|Ga0182131_1101513All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum598Open in IMG/M
3300015334|Ga0182132_1073256All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum707Open in IMG/M
3300015335|Ga0182116_1165796All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum521Open in IMG/M
3300015338|Ga0182137_1133095All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum573Open in IMG/M
3300015339|Ga0182149_1100332All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum633Open in IMG/M
3300015340|Ga0182133_1036854All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum961Open in IMG/M
3300015340|Ga0182133_1067406All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum775Open in IMG/M
3300015348|Ga0182115_1262902Not Available548Open in IMG/M
3300015349|Ga0182185_1180143All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum636Open in IMG/M
3300015349|Ga0182185_1239040All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum552Open in IMG/M
3300015350|Ga0182163_1120619All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum806Open in IMG/M
3300015352|Ga0182169_1214468Not Available628Open in IMG/M
3300015353|Ga0182179_1144516All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum738Open in IMG/M
3300015354|Ga0182167_1213337All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum704Open in IMG/M
3300017408|Ga0182197_1041331All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum823Open in IMG/M
3300017408|Ga0182197_1080508All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum640Open in IMG/M
3300017414|Ga0182195_1202638Not Available522Open in IMG/M
3300017435|Ga0182194_1121355All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum551Open in IMG/M
3300017439|Ga0182200_1052848Not Available745Open in IMG/M
3300017445|Ga0182198_1138364Not Available585Open in IMG/M
3300017446|Ga0182217_1141776Not Available565Open in IMG/M
3300017447|Ga0182215_1045005Not Available934Open in IMG/M
3300017447|Ga0182215_1047369All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum912Open in IMG/M
3300017447|Ga0182215_1173322All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum503Open in IMG/M
3300022465|Ga0213505_115490Not Available623Open in IMG/M
3300025903|Ga0207680_10499623All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum866Open in IMG/M
3300025961|Ga0207712_11665891All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum572Open in IMG/M
3300026035|Ga0207703_10909502All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum843Open in IMG/M
3300026088|Ga0207641_11959851All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum587Open in IMG/M
3300028049|Ga0268322_1030023All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum625Open in IMG/M
3300028050|Ga0268328_1070455Not Available506Open in IMG/M
3300028052|Ga0268300_1011962All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum505Open in IMG/M
3300028055|Ga0268338_1003563All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum1039Open in IMG/M
3300028056|Ga0268330_1050216All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum545Open in IMG/M
3300028057|Ga0268352_1031142All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum586Open in IMG/M
3300028064|Ga0268340_1040428Not Available664Open in IMG/M
3300028139|Ga0268355_1004455All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum779Open in IMG/M
3300028147|Ga0268303_105151All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum564Open in IMG/M
3300028150|Ga0268343_1004164All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum856Open in IMG/M
3300028153|Ga0268320_1011458All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum671Open in IMG/M
3300028248|Ga0268312_1013850Not Available694Open in IMG/M
3300028248|Ga0268312_1017043All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum652Open in IMG/M
3300028464|Ga0268302_102311All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum786Open in IMG/M
3300028464|Ga0268302_105745All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum582Open in IMG/M
3300028466|Ga0268321_102084All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum816Open in IMG/M
3300028471|Ga0268323_1019943All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum520Open in IMG/M
3300028473|Ga0268319_1006707Not Available743Open in IMG/M
3300028473|Ga0268319_1024533All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum503Open in IMG/M
3300028474|Ga0268331_1002739All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum984Open in IMG/M
3300028523|Ga0268313_1000430All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum1511Open in IMG/M
3300028526|Ga0268339_1006711All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum694Open in IMG/M
3300032591|Ga0214484_1069291Not Available745Open in IMG/M
3300032689|Ga0214497_1066577All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum799Open in IMG/M
3300032689|Ga0214497_1105696All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum608Open in IMG/M
3300032699|Ga0214494_1049216All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum812Open in IMG/M
3300032759|Ga0314720_1046740All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum517Open in IMG/M
3300032760|Ga0314754_1059391All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum596Open in IMG/M
3300032812|Ga0314745_1011030All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum1691Open in IMG/M
3300032823|Ga0314723_1111018All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum505Open in IMG/M
3300032844|Ga0314743_1030410All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum1231Open in IMG/M
3300033526|Ga0314761_1001824All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum2965Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Switchgrass PhyllosphereHost-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere52.25%
PhyllosphereHost-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Phyllosphere20.72%
Switchgrass AssociatedHost-Associated → Plants → Unclassified → Unclassified → Unclassified → Switchgrass Associated6.31%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil4.50%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere4.50%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere3.60%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere1.80%
Switchgrass RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere1.80%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere1.80%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere1.80%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.90%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300005347Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaGHost-AssociatedOpen in IMG/M
3300005365Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaGEnvironmentalOpen in IMG/M
3300005544Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaGEnvironmentalOpen in IMG/M
3300005617Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2Host-AssociatedOpen in IMG/M
3300005719Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2Host-AssociatedOpen in IMG/M
3300009092Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaGHost-AssociatedOpen in IMG/M
3300009101Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaGHost-AssociatedOpen in IMG/M
3300009553Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaGHost-AssociatedOpen in IMG/M
3300009972Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_224 metaGHost-AssociatedOpen in IMG/M
3300009980Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_219 metaGHost-AssociatedOpen in IMG/M
3300009981Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_208 metaGHost-AssociatedOpen in IMG/M
3300009990Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_206 metaGHost-AssociatedOpen in IMG/M
3300009992Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_108 metaGHost-AssociatedOpen in IMG/M
3300009994Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_171 metaGHost-AssociatedOpen in IMG/M
3300010397Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4EnvironmentalOpen in IMG/M
3300010401Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1EnvironmentalOpen in IMG/M
3300010403Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3EnvironmentalOpen in IMG/M
3300013306Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaGHost-AssociatedOpen in IMG/M
3300014325Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaGHost-AssociatedOpen in IMG/M
3300014326Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaGHost-AssociatedOpen in IMG/M
3300014968Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaGHost-AssociatedOpen in IMG/M
3300015278Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_09MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015280Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_09MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015284Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_09MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015290Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_09MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015293Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_09MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015306Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_22AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015310Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_01AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015311Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_22AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015315Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_31MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015316Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_31MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015320Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_01AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015325Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_12JUL2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015326Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_01AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015327Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_31MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015330Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_12JUL2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015331Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_20JUN2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015334Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_20JUN2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015335Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_31MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015338Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_20JUN2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015339Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_12JUL2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015340Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_20JUN2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015348Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_31MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015349Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_22AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015350Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_01AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015352Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_01AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015353Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_22AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015354Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_01AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017408Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_12SEP2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017414Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_12SEP2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017435Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_12SEP2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017439Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_12SEP2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017445Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_12SEP2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017446Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_03OCT2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017447Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_03OCT2016_LD1 MGHost-AssociatedOpen in IMG/M
3300022465Metatranscriptome of phyllosphere microbial comminities from switchgrass, Michigan, USA - G5R1_MAIN_12JUL2016_LR1 MT pilot (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300025903Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025961Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026035Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026088Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028049Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_26JUN2017_LD1Host-AssociatedOpen in IMG/M
3300028050Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_17JUL2017_LD1Host-AssociatedOpen in IMG/M
3300028052Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_15MAY2017_LD1Host-AssociatedOpen in IMG/M
3300028055Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_07AUG2017_LD1Host-AssociatedOpen in IMG/M
3300028056Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_17JUL2017_LD1Host-AssociatedOpen in IMG/M
3300028057Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_18SEP2017_LD1Host-AssociatedOpen in IMG/M
3300028064Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_28AUG2017_LD1Host-AssociatedOpen in IMG/M
3300028139Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_18SEP2017_LD1Host-AssociatedOpen in IMG/M
3300028147Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_15MAY2017_LD1Host-AssociatedOpen in IMG/M
3300028150Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_28AUG2017_LD1Host-AssociatedOpen in IMG/M
3300028153Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_26JUN2017_LD1Host-AssociatedOpen in IMG/M
3300028248Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_05JUN2017_LD1Host-AssociatedOpen in IMG/M
3300028463Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_MAIN_17JUL2017_LD1Host-AssociatedOpen in IMG/M
3300028464Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_15MAY2017_LD1Host-AssociatedOpen in IMG/M
3300028466Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_NF_26JUN2017_LD1Host-AssociatedOpen in IMG/M
3300028471Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_26JUN2017_LD1Host-AssociatedOpen in IMG/M
3300028473Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_26JUN2017_LD1Host-AssociatedOpen in IMG/M
3300028474Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_17JUL2017_LD1Host-AssociatedOpen in IMG/M
3300028523Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_NF_05JUN2017_LD1Host-AssociatedOpen in IMG/M
3300028526Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_07AUG2017_LD1Host-AssociatedOpen in IMG/M
3300032591Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_31MAY2016_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032689Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_12JUL2016_LR2 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032699Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_12JUL2016_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032759Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_15MAY2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032760Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_07AUG2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032812Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_17JUL2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032823Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_05JUN2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032844Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_17JUL2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300033526Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_28AUG2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Ga0070668_10008890923300005347Switchgrass RhizosphereVSLAEQSLSLSSLAVIPCKREHQGQMEESGMVPRYWLQVLDHLVAVSNISKD*
Ga0070688_10142204813300005365Switchgrass RhizosphereRPTGVSLAEQSLSLSSLAVISCKKEHQARLGESGMAPRYLSWVLDHLVAASKVSKVSQEKWERA*
Ga0070686_10190356113300005544Switchgrass RhizosphereVSLAEQSLSLSSLVVIPCKKEHQGQLGESGMAPRYLSWVLDHLVAASKVSKVSQEKWERV
Ga0068859_10272988623300005617Switchgrass RhizosphereVSLAEQSLSLSSLAVIPCKREHQGRLGESGMAPHYLSWVLDHLVAASKVSKVSQEKWEKA
Ga0068861_10063362223300005719Switchgrass RhizosphereVSLAEQSLSLSSLAVIPCKKEHQGRLGESGMAPRYWSWVLDHLVAVNKVSKVSQVKQ*
Ga0105250_1050289723300009092Switchgrass RhizosphereVSLAEQSLSLSSLAVIPCKKEHQGRLGESGMAPRYLSWVLDHLVAASKVSKVSQEKWERT
Ga0105247_1183595513300009101Switchgrass RhizosphereKLVFAWKPTEVSLAEQSLLLFSLVVIICRRVHQEQLEESGMAPRYWSWVLDHLVAVNKVSKVSQVKQ*
Ga0105249_1234830923300009553Switchgrass RhizosphereMSLAEQSLSLSSLAVIPCKKEHQGRLGESGMAPHYWSWVLDHLVAVNKVSKVSQVKQ
Ga0105249_1310724223300009553Switchgrass RhizosphereMAEQSLSLSSLAVIPCKREHQGRMEESGMAPRYLSWVLDHLVAASKVSKVSKEKWERG*
Ga0105137_10831613300009972Switchgrass AssociatedVSLVEQSLSLSSSMAIPCKEEHQGQLEESGMAPRYWLQVLDHLVAISKMSKD*
Ga0105135_11260613300009980Switchgrass AssociatedLSSLAVIPCKREHQGRSGESGMAPCYLSWVLDHLVAASKVSKVSQEKWERA*
Ga0105133_12484213300009981Switchgrass AssociatedVSLAEHSLSLSSLVVIPCKKEHQGQLGESGMAPRYLSWDLDHLVATSKVSKVSQEKWERA
Ga0105132_10494923300009990Switchgrass AssociatedVFAWKPTEVSLAEQSLSLSSLVVTLCKRVHQEQLEESGMVPRYWSWVLDHLVAVREVSKD
Ga0105120_104395923300009992Switchgrass AssociatedVSLAEQSLSLSSLEVIPCKKEHQGRLGESGMAPRYWSWVLDHLVVVNKVSKVSQ
Ga0105126_100750213300009994Switchgrass AssociatedVSLAEQSLLLSSLAVIPCKKEHQGRLGESGMAPRYLSWVLDHLVAASKVSKVSQEKWERA
Ga0105126_103001423300009994Switchgrass AssociatedMSLAEQSLLLSSLAVISCKKEHQGQSGESRMVPRYWSWVLNHLVAARKVSRVSQVKQKRVQKE*
Ga0134124_1214524613300010397Terrestrial SoilVSLAEQSLSLSSLAVIPCKREHQGRMEESGMVSCYWLQVLDHLVAVHNVSKDKPRKGL
Ga0134124_1233775813300010397Terrestrial SoilQSLSLSSLAVIPFKKEHQGRLGESGMVPRYRSWVLDHLVAVNKVSKVNQVKQ*
Ga0134124_1280498723300010397Terrestrial SoilVSLAEQSLSLSSLAVIPCKREHQGRLGESGMAPRYLSWVLDHLVAASKVSKVSQEKWERA
Ga0134121_1151013023300010401Terrestrial SoilGVSLAEQPLLLSSLTAIPCKKEHQGWLEGSGMAPRYWSWVLDHLVAVSKVSRVSQVKW*
Ga0134123_1048698823300010403Terrestrial SoilLSLSSLVVIPCKKEHQGWLGESGMAPRYWSWVLDHLVAVNKVSKVSQVKQ*
Ga0163162_1108274913300013306Switchgrass RhizosphereVSLAEQSLSLSSLAVIPYKREHQGRLGESGMAPRYWSWVLDHFVAASKVSKVSQEKWERA
Ga0163163_1101984013300014325Switchgrass RhizosphereMPAGVSLAEQSLSLSSLAVIPCKKEHQGRLGESGMAPRYWSWVLDHLVAVNKVSKVSQVKQ*
Ga0163163_1278106913300014325Switchgrass RhizosphereVSLAEQSLSLSSSMEIPCKKERQGQLEESRMAPRYWLQVLDHL
Ga0157380_1056014723300014326Switchgrass RhizosphereVSLAEQSLSLSSLAVIPCKREHQWWMEESGMAPRYLSWVLDHLVAASKVSKVSQEKWERA
Ga0157379_1248268323300014968Switchgrass RhizosphereVSLAEQSLSLSSLAVIPCKKEQQERLGESGMAPRYLSWVLGHLVAASKVSKVSQEKWERT
Ga0182099_101004713300015278Switchgrass PhyllosphereVSLAEQSLSLSSLAVIPCKKEDQGRLGESEMAPRYWSWVLDHLVAVNKVSKVSQVKQ*
Ga0182100_108896513300015280Switchgrass PhyllosphereVSLAEQSLSLSSLTVIPCKREHQGRMEESGMIPRYWLQVLDHLVAVREVSKD*
Ga0182100_109148313300015280Switchgrass PhyllosphereVSLAEQSLLLSSLAVIPCKKEHQGRLEGSGMAPRYWSWVLDHLVAVSKVSRVSQVKW
Ga0182101_103673933300015284Switchgrass PhyllosphereVSLAEQSLSLSSLAVIPCKREHQGRMEESGMVPRYWLQVLDHLVAV
Ga0182105_108125813300015290Switchgrass PhyllosphereVSLAEQSLSLSSLAVIPCKKEHQGWLGESGMAPRYLSWVLDHLVAASKVSKVSQEKWERAQKE*
Ga0182103_102266723300015293Switchgrass PhyllosphereVSLAEQSLSLSSLAVIPCKREHQGRLGESGMAPHYLSWVLDHLVAASKVSKVSQEKWEWA
Ga0182103_104573113300015293Switchgrass PhyllosphereVNIAEQSLLLSSLVVIPCKKEHQGRLEGSRMAPRHWSWGLDHLVAVGKV
Ga0182180_109617213300015306Switchgrass PhyllospherePTGVSLAEQPLLLSSLTVIPCKKEHQGRLEGSGMAPRYWSRVLDHLVAVNKVSRVSQVK*
Ga0182162_106575723300015310Switchgrass PhyllosphereVSLAEQSLSLSLLAVIPCKKEHQGRLGESGMAPHYWSWVLDHLVAVNKVSKVSQVKQ*
Ga0182162_108420313300015310Switchgrass PhyllosphereVSLAEQSLLLSSWVVIPYKKEHQGRLEGSRMAPRYWSWVLDHLVAVGKVSRVSQ
Ga0182162_110182813300015310Switchgrass PhyllosphereVSLAEQSLSLSLLMVIPYKKEHQGRLGESGMAPRYWSWVLGHLVAVNKVSKVSQVKQ*
Ga0182182_104374023300015311Switchgrass PhyllosphereVSLAEQSLSLSSLAVIPCKKEHQGQLGESGMTPRYWSWVLDHFVAVNKVSKVSQVKQ*
Ga0182120_112139613300015315Switchgrass PhyllosphereEVSLAEQSLSLSSLVVILCRRVHQEQLEESGMAPQCWSWVLDHLVAANRVS*
Ga0182121_110812813300015316Switchgrass PhyllosphereLVVIPCKREHQGRMEESGMAPCYLSWVLDRLVAASKVGKVSQERWKRA*
Ga0182121_112977513300015316Switchgrass PhyllosphereVSLAEQSLSLSSLVVIPCKKEHQGRLGESGMAPHYWSWVLDHLVAVNKVSKVSQVKQ*
Ga0182165_104124133300015320Switchgrass PhyllosphereVSLAEQSLLLSSSAVIPCKREHQGRMEESGMVPRYWLQVLDHLVAVSNVSK
Ga0182148_105766123300015325Switchgrass PhyllosphereVSLAEQSLSLFFIGGDPLQKKYQGRLGESGMAPRYWSWVLDHLVAVNKVSKVSQVKQ*
Ga0182148_113828623300015325Switchgrass PhyllosphereMSLAEQSLSLSSLAVIPCKKEHQGRLGESGMAPRYWSWVLDHLVAVNKVSKVSQVKQ*
Ga0182166_106595413300015326Switchgrass PhyllosphereVSLAEQSLLLSSLAVIPCKKEHQGRLEGSRMAPCYWSWILYHLVAVGKV
Ga0182166_107863113300015326Switchgrass PhyllosphereVSLVEQSLSLSSFVVIPCKKEHQGQLEESGMASHYWLQVLDHLVAVGKVSKE*
Ga0182166_113060523300015326Switchgrass PhyllosphereVSLAEQSLSLSSLAVIPCKKEHQGRLGESEMAPRYLPWVLDHLVAASKVSKVSQEKWERG
Ga0182114_113930613300015327Switchgrass PhyllosphereVSLTEQSLSLSSLVVIPCKKEHQGRLGESGMAPRYWSWVLDHLV
Ga0182152_114942713300015330Switchgrass PhyllosphereKPTGVSLAEQSLLLSSLAVIPCKKEHQGRLEGSGMAPRYWSWVLDHLVAVSKVSRVSQVKW*
Ga0182131_110151323300015331Switchgrass PhyllosphereVSLAEKSLSLSSLAVIPCKREHQGRMEESGMAPRYLSWDLDHLVATSKVSKVSQEKWERA
Ga0182132_107325613300015334Switchgrass PhyllosphereLSSLAVIPCKKGHQGRLGESGMVLDHLVAVNKVSKVSQVKQ*
Ga0182116_116579613300015335Switchgrass PhyllosphereTGVSLAEQSLSLSSLAVIPCKGEHQGRMEESGMAPHYLSWVLDHLVAASKVSRVSQEKSERA*
Ga0182137_113309513300015338Switchgrass PhyllosphereVSLAEQSLSLSSLAMIPCKKEHQGRMEESRMVPRYLSWVLDHLVAASKVSKVSQ*
Ga0182149_110033223300015339Switchgrass PhyllosphereMPTGVSLAEQSLSLSSLAVIPCKREHQGRMGESGMVPHYWLQVLDQLVAVSNV
Ga0182133_103685423300015340Switchgrass PhyllosphereVSLAEQSLSLSSLAVIPCKKEQQGQLGESGMTPRYWSWVLDHLVAVNKVSKVSQVKQ*
Ga0182133_106740613300015340Switchgrass PhyllosphereVSLAKQLLSLSSLVVIPCKKEHQGRFGESGMAPRYLSWVLDHLV
Ga0182115_126290213300015348Switchgrass PhyllosphereMPTGVSLAEQTLLLSSLMEIPCKRGHQEQLGESGMVPRYWLQVL
Ga0182185_118014313300015349Switchgrass PhyllosphereVSLAEQSLSLSSLAVIPCKREHQGRMEESGMVPRYWLQVLDHLVAVSN
Ga0182185_123904013300015349Switchgrass PhyllosphereSSLAVIPCKKEHQELLEGSGMAPHYWSWVLDHLVPVSKVSRVSQVK*
Ga0182163_112061923300015350Switchgrass PhyllosphereVSLAEQSLSLSSLAVIPCKKEHQGRLGESGMAPHYWSWVLDHLVAVNKVSKVSQVKQ*
Ga0182169_121446813300015352Switchgrass PhyllosphereVSLAEQSLSLSSLAVIPCKREHQGRMEESGMAPRYLSWVLDCLVAASEVSNVSQVKQ*
Ga0182179_114451613300015353Switchgrass PhyllosphereVSLAEQSLLLSSLAVIPCKREHQGRMEESRMVPRYLSWVLDHLVAASKVSKV
Ga0182167_121333723300015354Switchgrass PhyllosphereVSLAKQSLSLSSLAVIPCKKEHQGQLGESGMTPRYWSWVLDHFVAVNKVSKVSQVKQ*
Ga0182197_104133123300017408Switchgrass PhyllosphereVSLAEQSLSLSSLMVIPYKKEHQGRLGESGMAPRYWSWVLDHLVAVNKVSKVSQVKQ
Ga0182197_108050813300017408Switchgrass PhyllosphereVSLAEQSLSLSSLAVIPCKREHQVRMEESGMTPRYLSWVLDHLVAASKVSNVSQVKL
Ga0182195_120263813300017414Switchgrass PhyllosphereVSLAEQSLSLSSLAVIPCKKERQERLEGSRMAPHYLSWVLDHLVAIGKVS
Ga0182194_112135523300017435Switchgrass PhyllosphereVSLAEQSLSLSSLAVIPCKKEHQGQLGESGMTPRYWSWVLDHFVAVNKVSKVSQVKQ
Ga0182200_105284813300017439Switchgrass PhyllosphereVSLAEQSLSLSSLAVIPCKKEQQGQLGESGMTPRYWSWVLDHLVPVNKVSKVSQVKQ
Ga0182198_113836423300017445Switchgrass PhyllosphereVSLAEQSLSLSSLAVIPCKKEHQGRLGESGMAPHYLSWVLDHLVAASKVSKVSQEK
Ga0182217_114177623300017446Switchgrass PhyllosphereVSLAEQSLSLSSLAVIPYKRKHQGWLGESGMAPRYLSWVLDHLVGVSKVSKV
Ga0182215_104500523300017447Switchgrass PhyllosphereMPTGVSLAEQSLSLSSLAVIPCKREHQGRMEESGMAPRYLSWVLNHLVAASKVSKVSQEKGERAYKE
Ga0182215_104736913300017447Switchgrass PhyllosphereVSLAEQSLSLSSLAVIPCKKEHQGRLGESGMAPHYWSWVLDHLVAVNKVSKISQVKQ
Ga0182215_117332223300017447Switchgrass PhyllospherePTGVSLAEQSLSLSSLAVIPCKKEHQGQLGESGMAPRYLSWDLDHLVAASKVSKVSQEKWERA
Ga0213505_11549023300022465Switchgrass PhyllosphereVSLAEQSLSLSSLAVIPCKKEHQGWMEESGMAPRYLSWVLDHLVAASKVSKVSQVKQ
Ga0207680_1049962323300025903Switchgrass RhizosphereVSLAEQSLSLSSLAVIPCKRERQGQLEESGMAPLYLSWDLDHLVAASKVSKVSEEKWERA
Ga0207712_1166589113300025961Switchgrass RhizosphereMAEQSLSLSSLAVIPCKREHQGRMEESGMAPRYLSWVLDHLVAA
Ga0207703_1090950223300026035Switchgrass RhizosphereVSLAEQSLSLSSLAVIPCKKEHQGRLGESGMAPRYWSWVLDYFVVVNKVSKVSQVKQ
Ga0207641_1195985123300026088Switchgrass RhizosphereVSLAEQSLSLSSLAVIPCKKEHQGRLGESGMAPRYWSWVLDHLVAVNKVSKVSQVKQ
Ga0268322_103002323300028049PhyllosphereVSLAEQSLSLSSLAVIPCKKEHQGRLGESGMAPRYWSLVLDHLVAVNKVSKVSQVKQ
Ga0268328_107045513300028050PhyllosphereVSLAEQSLSLSSLAVIPCKKEQQGQLGESGMTPRYWSWVLDHFVAVN
Ga0268300_101196213300028052PhyllosphereVSLAEQSLLLSSLAVIPCKKERQEWLEGSRMAPHYWSWVLDHLVAIGKVS
Ga0268338_100356313300028055PhyllosphereVSLAEQSLSLSSLAVIPCKREHQGRLGESGMAPHYLSWVLDHLVAASKVSKVSQEK
Ga0268330_105021623300028056PhyllosphereVSLAEQSLSLSSLAVIPCKKEQQGQLGESGMTPRYWSWVLDHFVAVNKVSKVSQVKQ
Ga0268352_103114223300028057PhyllosphereVSLAEQSLSLSSLAVIPCKKEHQGRLGGSGMAPRYWSWVLDHLVAASKVSKVSQEKWERA
Ga0268340_104042823300028064PhyllosphereVSLAEQSLLLSSLAVIPCKREHQGRMEESRMVPRYLSWVLDHLVAASKVSKVSQEFGRGV
Ga0268355_100445523300028139PhyllosphereRPTGVSLAEQSLSLSSLAVIPCKREHQGRLGESGMAPRYLSWVLGHLVAASKVSKVSQEKWERA
Ga0268303_10515123300028147PhyllosphereQSLSLSSLVVIPCKREHQGQLGESGMAPRYLSWVLDHLVAASKVSKVSQEKWERA
Ga0268343_100416423300028150PhyllosphereVSLAEQSLSLSSLAVIPCKREHQGRMEESGMAPRYLSWVLDHLVAASKVSKVSQEKWERA
Ga0268320_101145823300028153PhyllosphereSLSSLVVIPCKKEHQGRLGESGMAPRYWSWVLDHLVAVNKVSKVSQVKQ
Ga0268312_101385023300028248PhyllosphereVSLPEQSLSLSSLAVIPCKKEHQRRLGESGMAPHYWSWVLDHLVAVN
Ga0268312_101704313300028248PhyllosphereTEVSLAEQSLSLSSLAVIPCKREHQGRMEESGMAPRYLSWVLDHLVAASKVSKVSQEKWERA
Ga0268325_10341113300028463PhyllosphereVIPCKKEHQGQLGESGMAPRYLSWDLDHLVAASKVSKVSQEKWERA
Ga0268302_10231123300028464PhyllosphereVSLAEQSLSLSSLVVIPCKKEHQGRLGESGMVPRYWSWVLDHLVAVNKVSKVIQVKQ
Ga0268302_10574523300028464PhyllosphereAEQSLSLSSLVVIPCKREHQGLLGGSGMAPRYLSWVLDHLVAASKVSKVSQEKWERA
Ga0268321_10208433300028466PhyllosphereVSLAEQSLSLSSLAVIPCKREHQGWLGESGMAPRYLSWVLDHLVAASKVN
Ga0268323_101994313300028471PhyllosphereVSLAEQSLSLSSLTVIPCKREHQGRLEESGMAFRYFSWVLNHLVTASKVSKVS
Ga0268319_100670733300028473PhyllosphereVSLAEQSLSLSSLAVIPCKKEHQGRLGESGMAPRYWSWVLDHLVAVNKVSKV
Ga0268319_102453313300028473PhyllosphereRPTGVSLAEQSLSLSSLAVIHCKREHQGLLGGSGMAPRYLSWVLDHLVAASKVSKVSQEK
Ga0268331_100273933300028474PhyllosphereVRLAEQSLSLSSLAVIPCKREHQGRLGESGMAPHYLSWVLDHLVAASKVSKVSQEKWERA
Ga0268313_100043023300028523PhyllosphereVSLAEQSLSLSSLAVIPCKKEHQGRLGESGMAPRYWSWVLDHFVAVNKVSKVSQVKQ
Ga0268339_100671113300028526PhyllosphereVSLAEQSLSLSSLAVIPCKKEHQGRLGESGMAPRYLSWVLDHLVAASKVSKVSQ
Ga0214484_106929113300032591Switchgrass PhyllosphereVSLAEQSLSLSSLAVIPCKKEHQGRLGESGMAPRYWSWVLDHLVAVN
Ga0214497_106657713300032689Switchgrass PhyllosphereTIIIIFSLAVIPCKKEHQGRLGESGMAPHYWSWVLDHLVAVNKVSKVSQVKQ
Ga0214497_110569633300032689Switchgrass PhyllosphereVSPAKQSLLLSSLAAIPCKKEHQGQLEESEMAPRYWLQVLDHFVAVS
Ga0214494_104921623300032699Switchgrass PhyllosphereTGVSLAEQSLSLSSLAVIPYKREHQGWLGESGMAPRYWSWVLDHFVAASKVSKVSQEKWERA
Ga0314720_104674013300032759Switchgrass PhyllosphereGVSLAEQSLSLFSLAVIPCKREHQGRMEESGMAPRYLSWVLDHLVAASKVSRVSQEKWER
Ga0314754_105939113300032760Switchgrass PhyllosphereSLSLSSLAVIPCKREHQGRMEESGMAPHYLSWVLDHLVAVNKVSKVSQGKL
Ga0314745_101103023300032812Switchgrass PhyllosphereVSLAEESLSLYSLAVIPCKKEHQGRLGESGMAPRYWSWVLDHLVAVNKVSKVSQVKQ
Ga0314723_111101823300032823Switchgrass PhyllospherePTWVSLAEQSLSLSSLAVIPCKKEHQGRFRESGMAPRYWSWVLDHLVAVNKGSKVGQVKQ
Ga0314743_103041013300032844Switchgrass PhyllosphereVSLAEESLSLYSLAVIPCKKEHQGWLGESGMAPRYWSWVLDHLVAVNKVSKVSQVKQYKA
Ga0314761_100182423300033526Switchgrass PhyllosphereVSLAEESLSLYSLAVIPCKKEHQGRLGESGMAPRYWSWVLDHLVAVNKVSKVSQVKQYKA


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.