NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F085280

Metagenome / Metatranscriptome Family F085280

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F085280
Family Type Metagenome / Metatranscriptome
Number of Sequences 111
Average Sequence Length 54 residues
Representative Sequence MSRGATYLGLLANLKQDEMLYEARQRSHSTEPIRPRRTRSLAASLLRALRITKR
Number of Associated Samples 91
Number of Associated Scaffolds 111

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 90.09 %
% of genes near scaffold ends (potentially truncated) 12.61 %
% of genes from short scaffolds (< 2000 bps) 82.88 %
Associated GOLD sequencing projects 86
AlphaFold2 3D model prediction Yes
3D model pTM-score0.33

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (81.982 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(12.613 % of family members)
Environment Ontology (ENVO) Unclassified
(25.225 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(27.027 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 43.90%    β-sheet: 0.00%    Coil/Unstructured: 56.10%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.33
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 111 Family Scaffolds
PF14716HHH_8 39.64
PF07336ABATE 12.61
PF14791DNA_pol_B_thumb 10.81
PF11706zf-CGNR 7.21
PF05239PRC 6.31
PF03446NAD_binding_2 0.90
PF02749QRPTase_N 0.90
PF13176TPR_7 0.90
PF13427DUF4111 0.90
PF01035DNA_binding_1 0.90
PF05598DUF772 0.90

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 111 Family Scaffolds
COG5516Uncharacterized conserved protein containing a Zn-ribbon-like motif, possibly RNA-bindingGeneral function prediction only [R] 12.61
COG0157Nicotinate-nucleotide pyrophosphorylaseCoenzyme transport and metabolism [H] 0.90
COG0350DNA repair enzyme Ada (O6-methylguanine-DNA--protein-cysteine methyltransferase)Replication, recombination and repair [L] 0.90
COG1488Nicotinic acid phosphoribosyltransferaseCoenzyme transport and metabolism [H] 0.90
COG3695Alkylated DNA nucleotide flippase Atl1, participates in nucleotide excision repair, Ada-like DNA-binding domainTranscription [K] 0.90


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms81.98 %
UnclassifiedrootN/A18.02 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2088090008|P3_DRAFT_NODE_176771_len_1212_cov_16_273102All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi1262Open in IMG/M
2124908032|Perma_A_C_ConsensusfromContig175086All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1472Open in IMG/M
2124908041|P3_CLC_ConsensusfromContig100177All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi1237Open in IMG/M
2124908041|P3_CLC_ConsensusfromContig73386Not Available720Open in IMG/M
2124908044|A5_c1_ConsensusfromContig7674Not Available754Open in IMG/M
2228664021|ICCgaii200_c0843230All Organisms → cellular organisms → Bacteria1812Open in IMG/M
3300000787|JGI11643J11755_11529650All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium654Open in IMG/M
3300000887|AL16A1W_10201979All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium676Open in IMG/M
3300000887|AL16A1W_10224660All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi849Open in IMG/M
3300000890|JGI11643J12802_10760122All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium556Open in IMG/M
3300002122|C687J26623_10028954All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1471Open in IMG/M
3300002124|C687J26631_10037170All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1719Open in IMG/M
3300003371|JGI26145J50221_1000926All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium2342Open in IMG/M
3300004114|Ga0062593_100213599Not Available1552Open in IMG/M
3300004114|Ga0062593_102796185All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium557Open in IMG/M
3300004157|Ga0062590_100277382All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi1285Open in IMG/M
3300004463|Ga0063356_101955594Not Available886Open in IMG/M
3300004480|Ga0062592_101910137All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi584Open in IMG/M
3300004643|Ga0062591_101012896All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium791Open in IMG/M
3300005294|Ga0065705_10145558All Organisms → cellular organisms → Bacteria2049Open in IMG/M
3300005294|Ga0065705_10163223All Organisms → cellular organisms → Bacteria1766Open in IMG/M
3300005331|Ga0070670_102113886All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium519Open in IMG/M
3300005345|Ga0070692_10633193All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium712Open in IMG/M
3300005364|Ga0070673_101085340All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium747Open in IMG/M
3300005440|Ga0070705_100003442All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia7761Open in IMG/M
3300005445|Ga0070708_100111738All Organisms → cellular organisms → Bacteria2512Open in IMG/M
3300005459|Ga0068867_102066589All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium539Open in IMG/M
3300005468|Ga0070707_100075907All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi3242Open in IMG/M
3300005518|Ga0070699_100460019All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi1154Open in IMG/M
3300005518|Ga0070699_101522656All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium613Open in IMG/M
3300005526|Ga0073909_10532653All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium572Open in IMG/M
3300005836|Ga0074470_10595955All Organisms → cellular organisms → Bacteria4323Open in IMG/M
3300005875|Ga0075293_1037723Not Available665Open in IMG/M
3300006852|Ga0075433_11500354Not Available582Open in IMG/M
3300006880|Ga0075429_100282674All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi1453Open in IMG/M
3300009012|Ga0066710_100810766All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi1435Open in IMG/M
3300009162|Ga0075423_10931136All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium922Open in IMG/M
3300010391|Ga0136847_13250266All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium792Open in IMG/M
3300010399|Ga0134127_12413185All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi605Open in IMG/M
3300011003|Ga0138514_100006850All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1737Open in IMG/M
3300011987|Ga0120164_1041613All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium681Open in IMG/M
3300011999|Ga0120148_1039474All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi986Open in IMG/M
3300012208|Ga0137376_10780842All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi822Open in IMG/M
3300012931|Ga0153915_10012420All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi8187Open in IMG/M
3300012931|Ga0153915_10510896All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi1374Open in IMG/M
3300013503|Ga0120127_10038295All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium923Open in IMG/M
3300013766|Ga0120181_1027124All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi1400Open in IMG/M
3300014056|Ga0120125_1129277All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium606Open in IMG/M
3300014829|Ga0120104_1062477Not Available713Open in IMG/M
3300014873|Ga0180066_1095891Not Available611Open in IMG/M
3300015085|Ga0167632_1002728Not Available2644Open in IMG/M
3300015085|Ga0167632_1038835All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium612Open in IMG/M
3300015371|Ga0132258_11259664All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1869Open in IMG/M
3300015371|Ga0132258_11566980All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi1663Open in IMG/M
3300017997|Ga0184610_1180064All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium702Open in IMG/M
3300017997|Ga0184610_1244408All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium597Open in IMG/M
3300018000|Ga0184604_10171431All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi728Open in IMG/M
3300018027|Ga0184605_10208085All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi888Open in IMG/M
3300018028|Ga0184608_10139868All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi1038Open in IMG/M
3300018052|Ga0184638_1023312All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium2203Open in IMG/M
3300018052|Ga0184638_1136103All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium893Open in IMG/M
3300018056|Ga0184623_10235660All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi837Open in IMG/M
3300018056|Ga0184623_10424386All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium580Open in IMG/M
3300018063|Ga0184637_10458913Not Available748Open in IMG/M
3300018071|Ga0184618_10196150All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi842Open in IMG/M
3300018076|Ga0184609_10324296All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium720Open in IMG/M
3300018077|Ga0184633_10006578All Organisms → cellular organisms → Bacteria5400Open in IMG/M
3300018077|Ga0184633_10026031Not Available2915Open in IMG/M
3300018469|Ga0190270_11492035All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium725Open in IMG/M
3300020001|Ga0193731_1157246All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium554Open in IMG/M
3300020002|Ga0193730_1093475All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium842Open in IMG/M
3300020059|Ga0193745_1063716All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium805Open in IMG/M
3300021344|Ga0193719_10029890All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi2348Open in IMG/M
3300022756|Ga0222622_10460122All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium904Open in IMG/M
3300025160|Ga0209109_10478702Not Available569Open in IMG/M
3300025313|Ga0209431_10150010Not Available1845Open in IMG/M
3300025313|Ga0209431_10496679Not Available929Open in IMG/M
3300025318|Ga0209519_10695177Not Available549Open in IMG/M
3300025324|Ga0209640_10100930All Organisms → cellular organisms → Bacteria2488Open in IMG/M
3300025324|Ga0209640_11191603All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium573Open in IMG/M
3300025325|Ga0209341_10194704All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1697Open in IMG/M
3300025327|Ga0209751_10420068All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1106Open in IMG/M
3300025885|Ga0207653_10296641All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium626Open in IMG/M
3300025917|Ga0207660_11477511All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium550Open in IMG/M
3300025922|Ga0207646_10131198All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium2255Open in IMG/M
3300025922|Ga0207646_10190726Not Available1851Open in IMG/M
3300025922|Ga0207646_10686020All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi916Open in IMG/M
3300025945|Ga0207679_11676474All Organisms → cellular organisms → Bacteria582Open in IMG/M
3300025960|Ga0207651_11144797All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium698Open in IMG/M
3300027674|Ga0209118_1047293All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi1279Open in IMG/M
3300028715|Ga0307313_10014832All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi2047Open in IMG/M
3300028771|Ga0307320_10237724All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium717Open in IMG/M
3300028792|Ga0307504_10016243All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1779Open in IMG/M
3300028803|Ga0307281_10308297All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium592Open in IMG/M
3300028819|Ga0307296_10385722All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium765Open in IMG/M
3300030998|Ga0073996_12350717All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi829Open in IMG/M
3300031716|Ga0310813_10116688All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium2101Open in IMG/M
3300031949|Ga0214473_10112334All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi3182Open in IMG/M
3300031949|Ga0214473_12417954Not Available500Open in IMG/M
3300031965|Ga0326597_10426707All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi1466Open in IMG/M
3300031965|Ga0326597_10690636All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi1076Open in IMG/M
3300031965|Ga0326597_11949760Not Available545Open in IMG/M
3300032163|Ga0315281_10000457All Organisms → cellular organisms → Bacteria56656Open in IMG/M
3300032205|Ga0307472_102612063Not Available515Open in IMG/M
3300033407|Ga0214472_10783999All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi859Open in IMG/M
3300033433|Ga0326726_10392917All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1315Open in IMG/M
3300033811|Ga0364924_096247All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi669Open in IMG/M
3300033811|Ga0364924_128678All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi588Open in IMG/M
3300033814|Ga0364930_0037438All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1644Open in IMG/M
3300034125|Ga0370484_0015429All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1695Open in IMG/M
3300034178|Ga0364934_0028140Not Available2054Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment12.61%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil12.61%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere9.01%
PermafrostEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost7.21%
SoilEnvironmental → Terrestrial → Soil → Loam → Unclassified → Soil7.21%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil4.50%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Soil4.50%
SedimentEnvironmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment3.60%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil2.70%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil2.70%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere2.70%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere2.70%
Freshwater WetlandsEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands1.80%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.80%
Glacier Forefield SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil1.80%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere1.80%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere1.80%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere1.80%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment0.90%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Sediment0.90%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil0.90%
Sediment (Intertidal)Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal)0.90%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.90%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil0.90%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.90%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil0.90%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.90%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.90%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.90%
Untreated Peat SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil0.90%
Rice Paddy SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil0.90%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil0.90%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.90%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil0.90%
SoilEnvironmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil0.90%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.90%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.90%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2088090008Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Permafrost Layer P3EnvironmentalOpen in IMG/M
2124908032Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Perma_allEnvironmentalOpen in IMG/M
2124908041Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Permafrost Layer P3EnvironmentalOpen in IMG/M
2124908044Soil microbial communities from permafrost in Bonanza Creek, Alaska, sample from Active Layer A5EnvironmentalOpen in IMG/M
2228664021Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
3300000787Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
3300000887Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A3-65cm-16A)- 1 week illuminaEnvironmentalOpen in IMG/M
3300000890Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
3300002122Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 10_2EnvironmentalOpen in IMG/M
3300002124Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 10_3EnvironmentalOpen in IMG/M
3300003371Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PMHost-AssociatedOpen in IMG/M
3300004114Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5EnvironmentalOpen in IMG/M
3300004157Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2EnvironmentalOpen in IMG/M
3300004463Combined assembly of Arabidopsis thaliana microbial communitiesHost-AssociatedOpen in IMG/M
3300004480Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4EnvironmentalOpen in IMG/M
3300004643Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3EnvironmentalOpen in IMG/M
3300005294Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk SoilEnvironmentalOpen in IMG/M
3300005331Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaGHost-AssociatedOpen in IMG/M
3300005345Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaGEnvironmentalOpen in IMG/M
3300005364Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaGHost-AssociatedOpen in IMG/M
3300005440Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaGEnvironmentalOpen in IMG/M
3300005445Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaGEnvironmentalOpen in IMG/M
3300005459Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2Host-AssociatedOpen in IMG/M
3300005468Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaGEnvironmentalOpen in IMG/M
3300005518Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaGEnvironmentalOpen in IMG/M
3300005526Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1EnvironmentalOpen in IMG/M
3300005836Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.42_YBBEnvironmentalOpen in IMG/M
3300005875Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_25C_0N_101EnvironmentalOpen in IMG/M
3300006852Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2Host-AssociatedOpen in IMG/M
3300006880Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3Host-AssociatedOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300010391Freshwater sediment microbial communities from Lake Superior, USA - Station SU-17. Combined Assembly of Gp0155404, Gp0155335, Gp0155336, Gp0155336, Gp0155403, Gp0155406EnvironmentalOpen in IMG/M
3300010399Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3EnvironmentalOpen in IMG/M
3300011003Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t9i015EnvironmentalOpen in IMG/M
3300011987Permafrost microbial communities from Nunavut, Canada - A20_80cm_0MEnvironmentalOpen in IMG/M
3300011999Permafrost microbial communities from Nunavut, Canada - A28_65cm_6MEnvironmentalOpen in IMG/M
3300012208Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012931Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaGEnvironmentalOpen in IMG/M
3300013503Permafrost microbial communities from Nunavut, Canada - A23_5cm_12MEnvironmentalOpen in IMG/M
3300013766Permafrost microbial communities from Nunavut, Canada - A26_65cm_6MEnvironmentalOpen in IMG/M
3300014056Permafrost microbial communities from Nunavut, Canada - A20_5cm_0MEnvironmentalOpen in IMG/M
3300014829Permafrost microbial communities from Nunavut, Canada - A10_35cm_6MEnvironmentalOpen in IMG/M
3300014873Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT200B_16_10DEnvironmentalOpen in IMG/M
3300015085Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G4B, Ice margin, adjacent to proglacial lake)EnvironmentalOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300017997Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_coexEnvironmentalOpen in IMG/M
3300018000Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_coexEnvironmentalOpen in IMG/M
3300018027Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coexEnvironmentalOpen in IMG/M
3300018028Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coexEnvironmentalOpen in IMG/M
3300018052Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b2EnvironmentalOpen in IMG/M
3300018056Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_b1EnvironmentalOpen in IMG/M
3300018063Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b2EnvironmentalOpen in IMG/M
3300018071Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1EnvironmentalOpen in IMG/M
3300018076Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coexEnvironmentalOpen in IMG/M
3300018077Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b1EnvironmentalOpen in IMG/M
3300018469Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 TEnvironmentalOpen in IMG/M
3300020001Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1a2EnvironmentalOpen in IMG/M
3300020002Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1a1EnvironmentalOpen in IMG/M
3300020059Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1a2EnvironmentalOpen in IMG/M
3300021344Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2EnvironmentalOpen in IMG/M
3300022756Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1EnvironmentalOpen in IMG/M
3300025160Soil microbial communities from Rifle, Colorado, USA - sediment 10ft 2EnvironmentalOpen in IMG/M
3300025313Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_3 (SPAdes)EnvironmentalOpen in IMG/M
3300025318Soil microbial communities from Rifle, Colorado, USA - sediment 13ft 1EnvironmentalOpen in IMG/M
3300025324Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 10_1 (SPAdes)EnvironmentalOpen in IMG/M
3300025325Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_2 (SPAdes)EnvironmentalOpen in IMG/M
3300025327Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_1 (SPAdes)EnvironmentalOpen in IMG/M
3300025885Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025917Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025922Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025945Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025960Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300027674Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300028715Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_203EnvironmentalOpen in IMG/M
3300028771Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_369EnvironmentalOpen in IMG/M
3300028792Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 19_SEnvironmentalOpen in IMG/M
3300028803Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_120EnvironmentalOpen in IMG/M
3300028819Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153EnvironmentalOpen in IMG/M
3300030998Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Soil GP-3A (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031716Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3EnvironmentalOpen in IMG/M
3300031949Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT98D197EnvironmentalOpen in IMG/M
3300031965Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT100D185EnvironmentalOpen in IMG/M
3300032163Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G07_0EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300033407Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT140D175EnvironmentalOpen in IMG/M
3300033433Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MNEnvironmentalOpen in IMG/M
3300033811Sediment microbial communities from East River floodplain, Colorado, United States - 28_j17EnvironmentalOpen in IMG/M
3300033814Sediment microbial communities from East River floodplain, Colorado, United States - 55_j17EnvironmentalOpen in IMG/M
3300034125Peat soil microbial communities from wetlands in Alaska, United States - Sheep_creek_tus_01_15EnvironmentalOpen in IMG/M
3300034178Sediment microbial communities from East River floodplain, Colorado, United States - 27_j17EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
P3_DRAFT_010604202088090008SoilMAGAMPANQWRNPMSRGASYWGLLAALKQEEMLYEARRRQRSTDVIRRRRGRSLGASLLHVLRGKR
Perma_A_C_036829002124908032SoilMSRGATYLGLLANLKQDEMLYEARRRRYSTDAIRPRRGRSLGATLLRALRITRR
P3_CLC_002467302124908041SoilMRRGATYWGLLASLKQEEMLYEARRRQRSTDPIRRRRGRSLGATLLHVLRGKR
P3_CLC_009109602124908041SoilMSRGLTYLGLLAELKQEEMLYEARRRQRSTDVIRRRRGRSLGATLLHMLRGKR
A5_c1_012001302124908044SoilMSRARYLGLLANIRQDDMINEARRRRYSTEPIRPSRGWSLGATLLRALRITRD
ICCgaii200_084323042228664021SoilMSRGATYLGLLASLKQDEMLYEAKRRTFRTEPIRPDRGRSFGASLLRALRITKR
JGI11643J11755_1152965023300000787SoilMSRGATYLGLLANLKQDEMLYEAXQRSXSTEPIRPPRSRSLTASLLRVLRITKR*
AL16A1W_1020197923300000887PermafrostMSRGAIYLGLLANLRQDEMLYEARQRRFSTEPIRPSRDRSFAASLMRALRITKR*
AL16A1W_1022466023300000887PermafrostMSRGATYLGLLANLRQNEMLYEARRRTHSTEPIRERDGRGFGASLLRALRITKR*
JGI11643J12802_1076012213300000890SoilMSRGATYLGLLASLKQDEMLYEAKRRTFRTEPIRPDRGRSFGASLLRALRITKR*
C687J26623_1002895443300002122SoilMSRGATYLGLLAALKQDEMLYEARQRRYSTDAIRRRRSRTFAGTLLRALRITRR*
C687J26631_1003717043300002124SoilMSRGATYLGLLAALKQDEMLYEARQRRYSTDAIRRRRSRTFAGTLLRALRIT
JGI26145J50221_100092633300003371Arabidopsis Thaliana RhizosphereMSRGATYLGLLANLKQDEMLYEARQRSHSTEPIRPPRGRSLTASLLRVLRITKR*
Ga0062593_10021359923300004114SoilRGATYLGLLASLKQDEMLYEAHRRTFRTEPIRPSRGRSFGASLLRALRITKR*
Ga0062593_10279618513300004114SoilMSRGATYLGLLANLRQNEMLYEVRRRTHSTEPIRERDGRGLAASLLRALRITKR*
Ga0062590_10027738223300004157SoilMSRGATYLGLLANLKQDEMLYEARQRSHSTEPIRPPRERSLGASLLRALRITKR*
Ga0063356_10195559433300004463Arabidopsis Thaliana RhizosphereMSRGATYLGLLATLKQEEMLYEAHRRTFRTDTIRPRSDRSLGASLLRALRITKR*
Ga0062592_10191013723300004480SoilLLANLKQDEMLYEARQRSHSTEPIRPPRERSLGASLLRALRITKR*
Ga0062591_10101289623300004643SoilMSRGATYLGLLASLKQDEMLYEAHRRTFRTDPIRPRRGRSFGASLLRALRITKR*
Ga0065705_1014555813300005294Switchgrass RhizosphereMSRGATYLGLLANLKQDEMLYEARQRSHSTEPIRPARTRSFGASLLRALRITKR*
Ga0065705_1016322313300005294Switchgrass RhizosphereMSRGATYLGLLANLRQNEMLYEARRRSHSTEPIRERDGRGLGASLLRALRITKR*
Ga0070670_10211388623300005331Switchgrass RhizosphereMSRGATYLGLLANLKQDEMLYEARQRSHSTEPIRPPRARSLGASLLRALRITKR*
Ga0070692_1063319323300005345Corn, Switchgrass And Miscanthus RhizosphereMSRGATYLGLLANLKQDEMLYEARQRSHSTEPIRPRRTRSLAASLLRALRITKR*
Ga0070673_10108534023300005364Switchgrass RhizosphereMSRGATYLGLLANLKQDEMLYEAHRRTFRTDPIRPRRGRSFGASLLRALRITKR*
Ga0070705_10000344223300005440Corn, Switchgrass And Miscanthus RhizosphereMSRGATYLGLLAHLRQNEMLYEARRRTHSTEPIRPRDDRGFGASLLRALRITKR*
Ga0070708_10011173833300005445Corn, Switchgrass And Miscanthus RhizosphereMSRGAIYLGLLANLRQDEMLYEARQRRFSTEPIRPRRDRSFTASLLRAMRITKR*
Ga0068867_10206658923300005459Miscanthus RhizosphereMSRGATYLGLLANLRQNEMLYEARRRTHSTEPIRERDGRGLAASLLRALRITKR*
Ga0070707_10007590723300005468Corn, Switchgrass And Miscanthus RhizosphereMSRGATYLGLLASLKQDEMLYEARQRTHSTEPIRPRRTRSLAASLLRALRITKR*
Ga0070699_10046001923300005518Corn, Switchgrass And Miscanthus RhizosphereRGATYLGLLASLKQDEMLYEARQRTHSTEPIRPRRTRSLAASLLRALRITKR*
Ga0070699_10152265623300005518Corn, Switchgrass And Miscanthus RhizosphereMSRGATYLGLLAHLRQNEMLYEARRRNHSTEPIRPRDDRGFGASLLR
Ga0073909_1053265323300005526Surface SoilMSRGATYLGLLANLRQNEMLYEARRRTHSTEPIRPRDDRSFGASLLRALRITKR*
Ga0074470_1059595563300005836Sediment (Intertidal)MSRGATYLGLLAALKQDEMLYEARRRNRSTDVIRPRRARSLGTTLLRVLRVKR*
Ga0075293_103772323300005875Rice Paddy SoilMSRRATYLGLLANLRQDEHLREAHSRRFSTEVIRPRRRGGLSAFVLRALRISKR*
Ga0075433_1150035423300006852Populus RhizosphereMSRGTAYLGLLANLRQDDYLRDAAQRQRSTEPIRPRRQGGIGAAILRALRITR*
Ga0075429_10028267423300006880Populus RhizosphereMSRGATYLGLLANLKQDEMLYEAHRRTFQTEPIRRSQSRGRSFGASLLRALRITKR*
Ga0066710_10081076623300009012Grasslands SoilMSRGATYLGLLANLRQDEMLYEARQRRFSTEPIRPRRDRSFAASLLRALRITKR
Ga0075423_1093113633300009162Populus RhizosphereMSRGATYLGLLANLKQDEMLYEAQRRTFRTDPIRPSRGRSLGASLLRVLRITKR*
Ga0136847_1325026613300010391Freshwater SedimentMSRGATYLGMLANLRQEELLYEVRLRRRPTDAIRARRGRSLGAMLMRVLRVTKR*
Ga0134127_1241318513300010399Terrestrial SoilTYLGLLANLRQNEMLYEARRRTHSTEPIRERDGRGLAASLLRALRITKR*
Ga0138514_10000685023300011003SoilMSRGATYLGLLANLKQDELLYEARRRTFSTEPIRRRRRRSLSASVLRALRITKR*
Ga0120164_104161323300011987PermafrostMSRGATYLGLLANLRQNEMLYEARRRTHATVPIRERDGRGFGASLLRALRITRR*
Ga0120148_103947423300011999PermafrostMSRGSTYLGLLANLRQDEMLYEARQRTYSTEPIRPIRRRSLAAALLRALRITKR*
Ga0137376_1078084223300012208Vadose Zone SoilMSRGAVYLGLLANLRQDEMLYEARQRRFSTEPIRPRRDRSFAASLLRALRITKR*
Ga0153915_1001242063300012931Freshwater WetlandsMSNGATYLALLAALRQDDVLYDARRRQRSTDVIRRRRGRSLGSTLLQMLRSKR*
Ga0153915_1051089613300012931Freshwater WetlandsMSNGATYLALLTALKQDDTADEARRRQRSTDVIRRRRGRSLGATLLQVLRVRR*
Ga0120127_1003829523300013503PermafrostMSRGIAYLGLIANLRQDEMLYEARQRAFSTEPIRPRRRRSFGAALLRALRITKR*
Ga0120181_102712423300013766PermafrostMSRGIAYLGLIANLRQDEMLYEARQRAYSTEPIRPSRRRSFGAALLRALRITKR*
Ga0120125_112927713300014056PermafrostMSRGAIYLGLLANLRQDEMLYEARQRRFSTEPIRPSRDRIFAASLMRALLTTKR*
Ga0120104_106247723300014829PermafrostMSRGIAYLGLIANLRQDEMLYEARQRAYSTEPIRPSRRRSFGAAVLRALRITKR*
Ga0180066_109589123300014873SoilMSRGATYLGLLARLKQDEMLYEARQRRHVTEEIRPRRQQSLSDTVLRALRIKR*
Ga0167632_100272833300015085Glacier Forefield SoilMYLGLLANLRQDEMLYDASHRGRSTKPIRPRRARSFGATLLRALRITKR*
Ga0167632_103883533300015085Glacier Forefield SoilMSRGATYLGLLATLKQDEMLYEANRRRRPTDEIRPDRGRSFGATLLRALRITKR*
Ga0132258_1125966433300015371Arabidopsis RhizosphereMSRGATYLGLLANLKQDEMLYEAHRRTFRTEPIRRSQGRGRSFGASLLRALRITKR*
Ga0132258_1156698033300015371Arabidopsis RhizosphereMSRGATYLGLLANLRQEEMLREARQRRYGTEPIRPRRARGLTASLLRALRITKR*
Ga0184610_118006433300017997Groundwater SedimentMSRGATYLGLLANLKQEEMLYEARQRRHSTEEIRPRRGPGLGASLLRLLRITKR
Ga0184610_124440823300017997Groundwater SedimentMSRGATYLGLLANLRQNEILYETRRRTHSTEPIRERDGRGLGASLLRALRITKR
Ga0184604_1017143123300018000Groundwater SedimentMSRGATYLGLLANLRQNEMLYEVRRRTHSTEPIRERDGRGLAASLLRALRITKR
Ga0184605_1020808513300018027Groundwater SedimentMSRGATYLGLLVNLRQNEMLYEVRRRTHSTEPIRERDGRGLGASLLRALRITKR
Ga0184608_1013986813300018028Groundwater SedimentMSRGATYLGLLANLRQNEMLYEARRRTHSTEPIRERDGRGLGASLLRALRITKR
Ga0184638_102331223300018052Groundwater SedimentMSRGATYLGLLAALKQDELLYEARQRRRSTDVIRPSRGRGFGSALLRALRITKR
Ga0184638_113610323300018052Groundwater SedimentMSRGATYLGLLANLRQNEMLYEARQRTRSTEPIRPRREGGFGASLLRALRITKR
Ga0184623_1023566023300018056Groundwater SedimentMSRGATYLGLLANLKQEEMLYEARQRRHSTEAIRPRRGPGLGASLLRMLRIRKR
Ga0184623_1042438623300018056Groundwater SedimentMSRGATYLGMLANLKQEEMLYEARQRRHSTEAIRPRRGPGLGASLLRM
Ga0184637_1045891313300018063Groundwater SedimentMSRGATYIGLLAALKQDEMLYEARQRRFSTEVIRRRRGRSLGSTLLRMLRITKR
Ga0184618_1019615013300018071Groundwater SedimentMSRGATYLGLLANLKQDEMLYEARQRSHSTEPIRPRRTRSLTASLLRALRITKR
Ga0184609_1032429623300018076Groundwater SedimentMSRGATYLGLLANLKQEEMLYEARQRSHSTEPIRPRRTRSLTASLLRALRITKR
Ga0184633_1000657823300018077Groundwater SedimentMSRGATYLGLLANLKQEEMLYEARRRTYSTEPIRERRGRSLGSMLLRALRITRR
Ga0184633_1002603133300018077Groundwater SedimentMSRGATYLGLLAALKQDEMLYEARQRRFSTDVIRRRRGRTLGSTLLRVLRITKR
Ga0190270_1149203533300018469SoilMSRGATYLGLLANLKQDEMLYEARQRSHSTEPIRPPRGRSLTASLLRVLRITKR
Ga0193731_115724623300020001SoilMSRGLTYLGLIANLRQDDMLYEARQRRYSTEPIRPIRRRSFGAALLRALRITKR
Ga0193730_109347533300020002SoilMSRMTYLGLIANLRQDEMLYEARQRTYSTEPIRPSRRRSFGAALLRALRITKR
Ga0193745_106371623300020059SoilMSRGATYLGLLANLKQDEMLYEARRRTHSTEPIRERDGRGLGASLLRALRITKR
Ga0193719_1002989023300021344SoilMSRGARYLGLLANLRQDELLYEAAQRRRSTEPIRPSRSGGIGAAILRVLRITR
Ga0222622_1046012213300022756Groundwater SedimentMSRGATYLGLLANLKQEEMLYEARQRTHSTEPIRPNRGRSLGASLLRVLRITKR
Ga0209109_1047870213300025160SoilMSRGATYLGLLARLKQDEMLYEARQRRFVTEEIRPTGRGLGAALLRALRIGKR
Ga0209431_1015001013300025313SoilRGSASQEDSMSRGATYLGLLAALKQDEMLYEARRRRHSTDEIRRRRGRTFGSTLLRALRITKR
Ga0209431_1049667933300025313SoilMSRGATYLGLLAALKQDEMLYEARQRRRSTDVIRRRRGRSLGSSLLRALGITRR
Ga0209519_1069517723300025318SoilMSRGATYLGLLAILKQEEMLYEAHRRTFQTDPIRPRRDRSLGASLLRALRITKR
Ga0209640_1010093033300025324SoilMSRGATYLGLLATLRQQEMLYEARQRRHSTEPIRPRRGDSLGTSLLRALRITKR
Ga0209640_1119160323300025324SoilMSRGTTYLGLLANLRHDEMIYEARNRRRSTGVIRPRRRRSLSDAVLRALRIRR
Ga0209341_1019470433300025325SoilMSRGATYLGLLAALKQDEMLYEARRRRHSTDEIRRRRGRTFGSTLLRALRITKR
Ga0209751_1042006823300025327SoilMSRGTTYLGLLANLKHDEMIYEARNRRRSTEVIRPRRRRSLSDTVLRALRIKR
Ga0207653_1029664113300025885Corn, Switchgrass And Miscanthus RhizosphereMSRGATYLGLLANLKQDEMLYEARQRSHSTEPIRPARTRSFGASLLRALRITKR
Ga0207660_1147751123300025917Corn RhizosphereMSRGATYLGLLANLKQDEMLYEARQRSHSTEPIRPPRSRSLTASLLRVLRITKR
Ga0207646_1013119833300025922Corn, Switchgrass And Miscanthus RhizosphereMSRGATYLGLLASLKQDEMLYEARQRTHSTEPIRPRRTRSLAASLLRA
Ga0207646_1019072623300025922Corn, Switchgrass And Miscanthus RhizospherePMSRGATYLGLLASLKQDEMLYEARQRTHSTEPIRPRRTRSLAASLLRALRITKR
Ga0207646_1068602023300025922Corn, Switchgrass And Miscanthus RhizosphereMSRGATYLGLLAHLRQNEMLYEARRRTHSTEPIRPRDDRGFGASLLRALRITKR
Ga0207679_1167647413300025945Corn RhizosphereGGLPMSRGATYLGLLANLRQNEMLYEVRRRTHSTEPIRERDGRGLAASLLRALRITKR
Ga0207651_1114479733300025960Switchgrass RhizosphereMSRGATYLGLLANLKQDEMLYEAHRRTFRTDPIRPRRGRSFGASLLRALRITKR
Ga0209118_104729323300027674Forest SoilMTRGTTYLGLLANLRDDDLLYEAIRRQRPTEPIRPRRNLSFGAALLRALRITRR
Ga0307313_1001483223300028715SoilMSRGATYLGLLANLKQDEMLYEARQRSHSTEPIRPRRTRSLAASLLRALRITKR
Ga0307320_1023772423300028771SoilMSRGATYLGLLANLRQNEMLYEARQRTRSTEPIRPRREGGFGASLLRALRITRR
Ga0307504_1001624323300028792SoilMSRGATYLGLLANLKQDELLYEAMRRRRPTEEIRPRRGPSLGATLLRALRITRR
Ga0307281_1030829723300028803SoilMSRGATYLGLLASLRQNEMIHEARRRTHSTEPIRERDGRSLGASLLRALRITKR
Ga0307296_1038572223300028819SoilMSRGATYLGLLANLRQNEMLYEARRRTHSTEPIRERDGRGFGASLLRALRITKR
Ga0073996_1235071723300030998SoilMRARYLGLLANLRQDEMLYEARRRRYSTEPIRPSRSWSLGASLLRALRITRR
Ga0310813_1011668833300031716SoilMSRGATYLGLLANLKQDEMLYEARQRSHSTEPIRPPRSRSFGASLLRALRITKR
Ga0214473_1011233423300031949SoilVSRGATYLGLLATLRQQEMLYEARQRRHSTEPIRPRRGDSLGTSLLRALRITKR
Ga0214473_1241795413300031949SoilYLGLLARLKQDEMLYEARQRRYSTEEIRPRRRRSLSATVLRALRITKR
Ga0326597_1042670723300031965SoilMSRGATYLGLLAALKQDEMLYEARQRRYSTVEIRPRRRRSMSAMVLRALRITKR
Ga0326597_1069063623300031965SoilMSRGATYLGLLAALKQDEMLYEARQRRYSTEEIRPRRRRSLSATVLRALRITKR
Ga0326597_1194976013300031965SoilMSRGATYLGLLATLRQSEMIHEARQRRYSTEPIRPRRSSSLGASLLRALRITRR
Ga0315281_10000457193300032163SedimentMSRATYLGLLANLRHEDMAADARRRQRSTDAIRRRRGRSFGAILLHMLRSKR
Ga0307472_10261206323300032205Hardwood Forest SoilMSRGARYLGLLANLRQDELLYEAAQRRRSTEPIRAGRSGGIGAAILRALRITKS
Ga0214472_1078399923300033407SoilMSRGATYLGLLATLKQEEMLYEAQRRMFQTDPIRPRRDRSLGASLLRALRITKR
Ga0326726_1039291733300033433Peat SoilMSRARYLGLLANIRQDDMIYEARRRQYSTEPIRPSRSWSLGDSLLRALRIKR
Ga0364924_096247_111_2753300033811SedimentMSRGATYLGLLAELKQDEMLYEARQRRFSTDVIRRRRGRSLASTLLRALGIGKR
Ga0364924_128678_4_1683300033811SedimentMSRGATYIGLLAALKQDEMLYEARQRRYSTDVIRRRRGRTLGSTLLRMLRITKR
Ga0364930_0037438_1415_15793300033814SedimentMSRGATYLGLLATLKQDELLYEARQRRRSTDVIRRRRGRTLGGTLLRVLRITKR
Ga0370484_0015429_1400_15613300034125Untreated Peat SoilMSKGAIYFGLLANLRQNDMLHEARSRRYSTDTIRPRRTDGFGAGLLRFLRIKR
Ga0364934_0028140_164_3283300034178SedimentMSRGATYLGLLATLRQQEMLYEARQRRYSTEPIRPRRGDSLSASLLRALRITKR


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.