NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F085781

Metagenome / Metatranscriptome Family F085781

Go to section:
Overview Alignments Structure & Topology Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F085781
Family Type Metagenome / Metatranscriptome
Number of Sequences 111
Average Sequence Length 169 residues
Representative Sequence LALAATASAAETESYEYIALSSHMQLVSRALEMGGSRNAAKALLHSALETFEGSHSHAHGRARNDAATLEAHSQTVSVPIDEKLAMTVKVSPTYALDEIQSVTLKAFRKIVGYDTFESIRVKERNETKDTSDYYNVTVSMMVRRKPVEGAAPAPAAAGSVSLAASLDKGFPYDD
Number of Associated Samples 76
Number of Associated Scaffolds 111

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Eukaryota
% of genes with valid RBS motifs 1.80 %
% of genes near scaffold ends (potentially truncated) 94.59 %
% of genes from short scaffolds (< 2000 bps) 100.00 %
Associated GOLD sequencing projects 72
AlphaFold2 3D model prediction No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Eukaryota (100.000 % of family members)
NCBI Taxonomy ID 2759
Taxonomy All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine
(41.441 % of family members)
Environment Ontology (ENVO) Unclassified
(59.459 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(96.396 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 42.53%    β-sheet: 11.49%    Coil/Unstructured: 45.98%
Feature Viewer
Powered by Feature Viewer

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms100.00 %
UnclassifiedrootN/A0.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300006357|Ga0075502_1614991All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium889Open in IMG/M
3300006383|Ga0075504_1375508All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium909Open in IMG/M
3300006384|Ga0075516_1363827All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium715Open in IMG/M
3300006392|Ga0075507_1503523All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium713Open in IMG/M
3300006393|Ga0075517_1506272All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium875Open in IMG/M
3300006400|Ga0075503_1594311All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium898Open in IMG/M
3300006571|Ga0075505_1465181All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium921Open in IMG/M
3300008832|Ga0103951_10563416All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium619Open in IMG/M
3300008834|Ga0103882_10085369All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium529Open in IMG/M
3300009263|Ga0103872_1045982All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium628Open in IMG/M
3300009265|Ga0103873_1043120All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium847Open in IMG/M
3300009599|Ga0115103_1849601All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium913Open in IMG/M
3300009608|Ga0115100_10153003All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium554Open in IMG/M
3300009608|Ga0115100_10182867All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1076Open in IMG/M
3300009732|Ga0123373_153942All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium660Open in IMG/M
3300009741|Ga0123361_1134952All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium647Open in IMG/M
3300010981|Ga0138316_10016291All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium617Open in IMG/M
3300010981|Ga0138316_11507017All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium591Open in IMG/M
3300010985|Ga0138326_11060638All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium590Open in IMG/M
3300010985|Ga0138326_11395837All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium520Open in IMG/M
3300010987|Ga0138324_10255516All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium827Open in IMG/M
3300010987|Ga0138324_10430898All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium648Open in IMG/M
3300012518|Ga0129349_1025202All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium532Open in IMG/M
3300012518|Ga0129349_1044498All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium787Open in IMG/M
3300012525|Ga0129353_1129731All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium510Open in IMG/M
3300012525|Ga0129353_1830186All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium643Open in IMG/M
3300012965|Ga0129346_1262783All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium582Open in IMG/M
3300012966|Ga0129341_1220078All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium509Open in IMG/M
3300017783|Ga0181379_1132090All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium898Open in IMG/M
3300018628|Ga0193355_1020028All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium630Open in IMG/M
3300018742|Ga0193138_1019495All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium874Open in IMG/M
3300018763|Ga0192827_1049806All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium732Open in IMG/M
3300018766|Ga0193181_1021418All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium900Open in IMG/M
3300018787|Ga0193124_1050815All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium619Open in IMG/M
3300018787|Ga0193124_1066366All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium543Open in IMG/M
3300018800|Ga0193306_1059846All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium574Open in IMG/M
3300018812|Ga0192829_1065585All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium701Open in IMG/M
3300018830|Ga0193191_1082258All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium516Open in IMG/M
3300018832|Ga0194240_1008139All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium808Open in IMG/M
3300018832|Ga0194240_1010474All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium755Open in IMG/M
3300018838|Ga0193302_1049888All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium711Open in IMG/M
3300018838|Ga0193302_1078995All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium542Open in IMG/M
3300018846|Ga0193253_1045054All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1089Open in IMG/M
3300018846|Ga0193253_1062038All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium919Open in IMG/M
3300018885|Ga0193311_10037287All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium699Open in IMG/M
3300018926|Ga0192989_10055866All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1014Open in IMG/M
3300018926|Ga0192989_10145105All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium576Open in IMG/M
3300018926|Ga0192989_10155840All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium550Open in IMG/M
3300018967|Ga0193178_10069212All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium549Open in IMG/M
3300018976|Ga0193254_10061678All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium871Open in IMG/M
3300018982|Ga0192947_10238881All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium587Open in IMG/M
3300018989|Ga0193030_10136577All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium785Open in IMG/M
3300018989|Ga0193030_10148019All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium758Open in IMG/M
3300018989|Ga0193030_10156343All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium740Open in IMG/M
3300018989|Ga0193030_10163421All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium725Open in IMG/M
3300018989|Ga0193030_10196097All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium664Open in IMG/M
3300018989|Ga0193030_10201931All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium654Open in IMG/M
3300018989|Ga0193030_10227303All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium614Open in IMG/M
3300018989|Ga0193030_10304256All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium515Open in IMG/M
3300019001|Ga0193034_10101184All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium662Open in IMG/M
3300019001|Ga0193034_10106712All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium648Open in IMG/M
3300019032|Ga0192869_10227220All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium802Open in IMG/M
3300019036|Ga0192945_10151234All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium747Open in IMG/M
3300019039|Ga0193123_10281351All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium653Open in IMG/M
3300019051|Ga0192826_10188615All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium762Open in IMG/M
3300019051|Ga0192826_10234199All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium677Open in IMG/M
3300019051|Ga0192826_10263032All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium634Open in IMG/M
3300019051|Ga0192826_10291601All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium597Open in IMG/M
3300019095|Ga0188866_1023560All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium647Open in IMG/M
3300019097|Ga0193153_1019805All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium696Open in IMG/M
3300019117|Ga0193054_1040163All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium704Open in IMG/M
3300019149|Ga0188870_10119005All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium622Open in IMG/M
3300019150|Ga0194244_10015184All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium946Open in IMG/M
3300021350|Ga0206692_1619548All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium538Open in IMG/M
3300021350|Ga0206692_1847628All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium861Open in IMG/M
3300021355|Ga0206690_10798625All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium560Open in IMG/M
3300021872|Ga0063132_106042All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium884Open in IMG/M
3300021881|Ga0063117_1023199All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium501Open in IMG/M
3300021896|Ga0063136_1029873All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium710Open in IMG/M
3300021896|Ga0063136_1059074All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium624Open in IMG/M
3300021908|Ga0063135_1016054All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium848Open in IMG/M
3300021908|Ga0063135_1034114All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium859Open in IMG/M
3300021912|Ga0063133_1023425All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium558Open in IMG/M
3300021912|Ga0063133_1056128All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium671Open in IMG/M
3300021912|Ga0063133_1057638All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium593Open in IMG/M
3300021934|Ga0063139_1020939All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium684Open in IMG/M
3300021935|Ga0063138_1135888All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium508Open in IMG/M
3300023683|Ga0228681_1025565All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium687Open in IMG/M
3300023695|Ga0228680_1027150All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium654Open in IMG/M
3300023704|Ga0228684_1026126All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium891Open in IMG/M
3300026134|Ga0208815_1059073All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium519Open in IMG/M
3300026448|Ga0247594_1080770All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium568Open in IMG/M
3300026495|Ga0247571_1165502All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium524Open in IMG/M
3300026504|Ga0247587_1135521All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium606Open in IMG/M
3300026513|Ga0247590_1076265All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium868Open in IMG/M
3300028134|Ga0256411_1170720All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium702Open in IMG/M
3300028137|Ga0256412_1157014All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium840Open in IMG/M
3300028137|Ga0256412_1157794All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium837Open in IMG/M
3300028137|Ga0256412_1268048All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium629Open in IMG/M
3300028137|Ga0256412_1277602All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium617Open in IMG/M
3300028233|Ga0256417_1148210All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium631Open in IMG/M
3300028282|Ga0256413_1141264All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium874Open in IMG/M
3300028282|Ga0256413_1181113All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium759Open in IMG/M
3300028290|Ga0247572_1126105All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium636Open in IMG/M
3300028575|Ga0304731_10548462All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium601Open in IMG/M
3300028575|Ga0304731_11479665All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium591Open in IMG/M
3300028575|Ga0304731_11593094All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium617Open in IMG/M
3300030856|Ga0073990_11833862All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium536Open in IMG/M
3300030856|Ga0073990_12043393All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium502Open in IMG/M
3300031062|Ga0073989_13510524All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium622Open in IMG/M
3300032732|Ga0314711_10613309All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium551Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine41.44%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine22.52%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater14.41%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous11.71%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater2.70%
Surface Ocean WaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Surface Ocean Water2.70%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake1.80%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater0.90%
Marine OceanicEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine Oceanic0.90%
SeawaterEnvironmental → Aquatic → Marine → Strait → Unclassified → Seawater0.90%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300006357Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006383Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_>0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006384Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_>0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006392Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_<0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006393Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_>0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006400Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006571Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_>0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300008832Eukaryotic communities of water collected during the Tara Oceans expedition - TARA_A200000150EnvironmentalOpen in IMG/M
3300008834Eukaryotic communities of water from the North Atlantic ocean - ACM26EnvironmentalOpen in IMG/M
3300009263Eukaryotic communities of water from the North Atlantic ocean - ACM27EnvironmentalOpen in IMG/M
3300009265Eukaryotic communities of water from the North Atlantic ocean - ACM8EnvironmentalOpen in IMG/M
3300009599Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_5May14_M1_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009608Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_2Apr14_M1_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009732Marine microbial and viral communities from Louisana Shelf, Gulf of Mexico - GoM_2015_C6C_232_2m (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009741Marine microbial and viral communities from Louisana Shelf, Gulf of Mexico - GoM_2015_C6C_193_2m (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010981Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-7 (Eukaryote Community Metatranscriptome) (version 4)EnvironmentalOpen in IMG/M
3300010985Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-7 (Eukaryote Community Metatranscriptome) (version 8)EnvironmentalOpen in IMG/M
3300010987Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-7 (Eukaryote Community Metatranscriptome) (version 6)EnvironmentalOpen in IMG/M
3300012518Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012525Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.2_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012965Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_20_0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012966Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300017783Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 2 SPOT_SRF_2009-07-10EnvironmentalOpen in IMG/M
3300018628Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_111 - TARA_N000001820 (ERX1782125-ERR1711885)EnvironmentalOpen in IMG/M
3300018742Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_022 - TARA_A100000534 (ERX1789653-ERR1719224)EnvironmentalOpen in IMG/M
3300018763Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_040 - TARA_N000000064 (ERX1782288-ERR1711868)EnvironmentalOpen in IMG/M
3300018766Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_036 - TARA_N000000317 (ERX1789428-ERR1719465)EnvironmentalOpen in IMG/M
3300018787Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_011 - TARA_X000001288 (ERX1789595-ERR1719164)EnvironmentalOpen in IMG/M
3300018800Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_102 - TARA_N000001650 (ERX1789422-ERR1719172)EnvironmentalOpen in IMG/M
3300018812Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_040 - TARA_N000000065 (ERX1789716-ERR1719392)EnvironmentalOpen in IMG/M
3300018830Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_039 - TARA_N000000006 (ERX1789678-ERR1719267)EnvironmentalOpen in IMG/M
3300018832Eukaryotic communities of water from different depths collected during the Tara Oceans expedition - TARA_N000000852 (ERX1782372-ERR1712031)EnvironmentalOpen in IMG/M
3300018838Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_102 - TARA_N000001646 (ERX1789439-ERR1719515)EnvironmentalOpen in IMG/M
3300018846Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_092 - TARA_N000001299 (ERX1789404-ERR1719503)EnvironmentalOpen in IMG/M
3300018885Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_102 - TARA_N000001654 (ERX1789521-ERR1719396)EnvironmentalOpen in IMG/M
3300018926Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_092 - TARA_N000001309 (ERX1789376-ERR1719276)EnvironmentalOpen in IMG/M
3300018967Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_036 - TARA_N000000316 (ERX1789557-ERR1719488)EnvironmentalOpen in IMG/M
3300018976Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_092 - TARA_N000001301 (ERX1789542-ERR1719444)EnvironmentalOpen in IMG/M
3300018982Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001384 (ERX1782271-ERR1711935)EnvironmentalOpen in IMG/M
3300018989Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002803 (ERX1782326-ERR1711934)EnvironmentalOpen in IMG/M
3300019001Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_009 - TARA_X000001043 (ERX1782383-ERR1712007)EnvironmentalOpen in IMG/M
3300019032Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_066 - TARA_N000000805 (ERX1782188-ERR1712216)EnvironmentalOpen in IMG/M
3300019036Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001382 (ERX1782404-ERR1712086)EnvironmentalOpen in IMG/M
3300019039Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_011 - TARA_X000001286 (ERX1782333-ERR1712137)EnvironmentalOpen in IMG/M
3300019051Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_040 - TARA_N000000064 (ERX1782232-ERR1712227)EnvironmentalOpen in IMG/M
3300019095Metatranscriptome of marine microbial communities from Baltic Sea - GS694_3p0_dTEnvironmentalOpen in IMG/M
3300019097Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_025 - TARA_A100000393 (ERX1782443-ERR1712022)EnvironmentalOpen in IMG/M
3300019117Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_131 - TARA_N000002348 (ERX1782351-ERR1711912)EnvironmentalOpen in IMG/M
3300019149Metatranscriptome of marine microbial communities from Baltic Sea - GS695_3p0_dTEnvironmentalOpen in IMG/M
3300019150Eukaryotic communities of water from different depths collected during the Tara Oceans expedition - TARA_N000000616 (ERX1782105-ERR1711908)EnvironmentalOpen in IMG/M
3300021350Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 40m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021355Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 150m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021872Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S5 C27 B21 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021881Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-10 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021896Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S13 C1 B13 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021908Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S11 C1 B13 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021912Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S7 C1 B21 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021934Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S18 C1 B14 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021935Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S17 C1 B21 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300023683Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 22R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300023695Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 21R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300023704Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 35R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026134Marine viral communities from the Southern Atlantic ocean transect to study dissolved organic matter and carbon cycling - metaG 3438_5245 (SPAdes)EnvironmentalOpen in IMG/M
3300026448Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 57R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026495Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 24R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026504Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 46R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026513Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 51R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028134Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - WCR_12 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028137Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - WCR_74 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028233Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - MB_1026D (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028282Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - WCR_77 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028290Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 25R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028575Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-7 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030856Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_S23_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031062Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_S21_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032732Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Shad11_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Ga0075502_161499113300006357AqueousATLVAMAGVSATETETAEMVGLSSHMQLVSRALEMGGSRNAAKALLHSALATFEGSHTRTHSGVRMMNDAATLDAHSQLCSVPIDEKLALTVKVSPTYALDEIQSVTLKAFRKIVGYDTFESIRRKERNETKDTSDYYNVTVSMMVKRKPVEAAAAPAAAHPASLAATLDKGFPYDD*
Ga0075504_137550813300006383AqueousVKATLVAMAGVSATETETAEMVGLSSHMQLVSRALEMGGSRNAAKALLHSALATFEGSHTRTHSGVRMMNDAATLDAHSQLCSVPIDEKLALTVKVSPTYALDEIQSVTLKAFRKIVGYDTFESIRRKERNETKDTSDYYNVTVSMMVKRKPVEAAAAPAAAHPASLAATLDKGFPYDD*
Ga0075516_136382713300006384AqueousFVKATLVAMAGVSATETETAEMVGLSSHMQLVSRALEMGGSRNAAKALLHSALATFEGSHTRTHSGVRMMNDAATLDAHSQLCSVPIDEKLALTVKVSPTYALDEIQSVTLKAFRKIVGYDTFESIRRKERNETKDTSDYYNVTVSMMVKRKPVEAAAAPAAAHPASLAATLDKGFPYDD
Ga0075507_150352313300006392AqueousMKFVKATLVAMAGVSATETETAEMVGLSSHMQLVSRALEMGGSRNAAKALLHSALATFEGSHTRTHSGVRMMNDAATLDAHSQLCSVPIDEKLALTVKVSPTYALDEIQSVTLKAFRKIVGYDTFESIRRKERNETKDTSDYYNVTVSMMVKRKPVEAAAAPAAAHPASLAATLDKGFPYDD*
Ga0075517_150627213300006393AqueousSATETETAEMVGLSSHMQLVSRALEMGGSRNAAKALLHSALATFEGSHTRTHSGVRMMNDAATLDAHSQLCSVPIDEKLALTVKVSPTYALDEIQSVTLKAFRKIVGYDTFESIRRKERNETKDTSDYYNVTVSMMVKRKPVEAAAAPAAAHPASLAATLDKGFPYDD*
Ga0075503_159431113300006400AqueousLVAMAGVSATETETAEMVGLSSHMQLVSRALEMGGSRNAAKALLHSALATFEGSHTRTHSGVRMMNDAATLDAHSQLCSVPIDEKLALTVKVSPTYALDEIQSVTLKAFRKIVGYDTFESIRRKERNETKDTSDYYNVTVSMMVKRKPVEAAAAPAAAHPASLAATLDKGFPYDD*
Ga0075505_146518113300006571AqueousKFVKATLVAMAGVSATETETAEMVGLSSHMQLVSRALEMGGSRNAAKALLHSALATFEGSHTRTHSGVRMMNDAATLDAHSQLCSVPIDEKLALTVKVSPTYALDEIQSVTLKAFRKIVGYDTFESIRRKERNETKDTSDYYNVTVSMMVKRKPVEAAAAPAAAHPASLAATLDKGFPYDD*
Ga0103951_1056341613300008832MarineESYEAIGLSSHMQLVSRALEMGGSRQAARALLTTALETFEGSHSHAHGRAHLRNDAATLEAHSQTVSVPIDEKPAMTVKVSPTYALDTVQSVTLKAFRKIVGYDTFESIRQKERSEAKDTSDYYNVTVSMMVQRKPVESAAAPAATGGSLATTLDKGFPYDD*
Ga0103882_1008536913300008834Surface Ocean WaterRALEMGGSRSAARALLHSALQTFEGSQAHTRGASSNVDARSQTVAVPIDEKLAMTVKVSPTYALDDIQSVTLKAFRKIVGYDTFESTRVKERNETKDTSDYYNVTVSMMVRRKPVDGAGAAGGATGTETLASKLDKGFPYDD*
Ga0103872_104598213300009263Surface Ocean WaterLSSHMQLVSRALEMGGSRNAAKALLHSALETFEGSHSRVHSRAADVDARSQTVAVPIDEKLAMTVKVSPTYALDDIQSVTLKAFRKIVGYDTFESIRVKERSEQKDTSDYYNVTVSMMVRRKPVEGAAAAGGAAAESLAAKLDKGFPYDD*
Ga0103873_104312013300009265Surface Ocean WaterALATASATETESWETIGLSSHMQLVSRALEMGGSRNAAKALLHSALETFEGSHSRVHSRAADVDARSQTVAVPIDEKLAMTVKVSPTYALDDIQSVTLKAFRKIVGYDTFESIRVKERSEQKDTSDYYNVTVSMMVRRKPVEGAAAAGGAAAESLAAKLDKGFPYDD*
Ga0115103_184960113300009599MarineVKATLVAAAAVSATETTETVGLSSHMQLVSRALEMGGSRNAAKALLHSALATFEGSHAHTHAGVRMMNDAATLEAHSQLVSVPIDEKLALSVKVSPTYALDEIQSVTLKAFRKIVGYDTFESIRRKERNETKDTSDYYNVTVSMMVKRKPVEAAAAPAAAPPASLAATLDKGFPYDD*
Ga0115100_1015300313300009608MarineFVKATLAALATASATETESWETIGLSSHMQLVSRALEMGGSRSAARALLHSALQTFEGSQAHTRGATGNVDARSQTVAVPIDEKLAMTVKVSPTYALDTISSVTLKAFRKIVGYDTFESIRVKERNETKDTSDYYNVTVSMMVQRKPVEGAGAATGATPASLAATLDKGFPYDD*
Ga0115100_1018286723300009608MarineMQLVSRALEMGGSRNAAKALLHSALATFEGSHAHTHAGVRMMNDAATLEAHSQLVSVPIDEKLALSVKVSPTYALDEIQSVTLKAFRKIVGYDTFESIRRKERNETKDTSDYYNVTVSMMVKRKPVEAAAAPAAAPPASLAATLDKGFPYDD*
Ga0123373_15394213300009732MarineMKFVKATLAALATASATETESWETIGLSSHMQLVSRALEMGGSRNAAKALLHSALETFEGSHSRVHSRAADVDARSQTVAVPIDEKLAMTVKVSPTYALDDIQSVTLKAFRKIVGYDTFESIRVKERSEQKDTSDYYNVTVSMMVRRKPVEGAAAAGGAAAESLAAKLDKGFPYDD*
Ga0123361_113495213300009741MarineKFVKATLAALATASATETESWETIGLSSHMQLVSRALEMGGSRNAAKALLHSALETFEGSHSRVHSRAADVDARSQTVAVPIDEKLAMTVKVSPTYALDDIQSVTLKAFRKIVGYDTFESIRVKERSEQKDTSDYYNVTVSMMVRRKPVEGAAAAGGAAAESLAAKLDKGFPYDD*
Ga0138316_1001629113300010981MarineVKATLCAIATASATEVESWETIGLSSHMQLVSRALEMGGSRSAARALLHSALQTFEGSHARGNAANVDARSQTVAVPIDEKLAMTVKVSPTYALDTVNSVTLKAFRKIVGYDTFESIRVKERNETKDTSDYYNVTVSMMVQRKPVEGAAAAGGNTGESLAAKLDKGFPYDD*
Ga0138316_1150701713300010981MarineTESFETIGLSSHMQLVSRALEMGGSRMAAKALLTTALETFEGAYAHSHSHSRTHIRNDAATLEAHSQTVAVPIDEKLAMTVKVSPTYALDEIQSVTLKAFRKIVGYDTFESIRVKERNETKDTSDYYNVTVSMMVRRKPVEGAAASGPAAGSQTLSATLDKGFPYDD*
Ga0138326_1106063813300010985MarineATLAALATASAAEVDSYETVGLSSHMQLVSRALEMGGSRNGARALLHEALSTFEGSYSHAHGRAHLRNDAATLEAHSQTVSVPIDEKLAMTVKVSPTYALDTIQSVTLKAFRKIVGYDTFESIRVKERNETKDTSDYYNVTVSMMVQRKPVEAAAAPAATGASLATTLDKGFPYDD*
Ga0138326_1139583713300010985MarineYETIGLNSQMQLVSRALEMGGSRMAARALLHAALETFEGSHSYAHGRAHLRNDAATLEAHSQTVAVPIDEKLAMTVKVSPTYALDEIQSVTLKAFRKIVGYDTFESIRVKERNEQKDTSDYYNVTVSMMVRRKPVEGATAAPNANGVASLAASLDKGFPYDD*
Ga0138324_1025551613300010987MarineMQLVSRALEMGGSRNGARALLHEALSTFEGSYSHAHGRAHLRNDAATLEAHSQTVSVPIDEKLAMTVKVSPTYALDTIQSVTLKAFRKIVGYDTFESIRVKERNETKDTSDYYNVTVSMMVQRKPVEAAAAPAATGASLATTLDKGFPYDD*
Ga0138324_1043089813300010987MarineVKATVLALATASATETESFETIGLSSHMQLVSRALEMGGSRMAAKALLTTALETFEGAYAHSHSHSRTHIRNDAATLEAHSQTVAVPIDEKLAMTVKVSPTYALDEIQSVTLKAFRKIVGYDTFESIRVKERNETKDTSDYYNVTVSMMVQRKPVEGAAAAGGNTGESLAAKLDKGFPYDD*
Ga0129349_102520213300012518AqueousFVKATLAALATASATETESWETIGLSSHMQLVSRALEMGGSRNAAKALLHSALETFEGSHSRVHSRSADVDARSQTVAVPIDEKLAMTVKVSPTYALDDIQSVTLKAFRKIVGYDTFESIRVKERSEQKDTSDYYNVTVSMMVRRKPVEGAAAAGGAAAESLAAKLDKGFPYDD*
Ga0129349_104449813300012518AqueousFVKATLIAMAGVSATETETEEMVALSSHMQLVSRALEMGGSRNAAKALLHSALATFEGSHSRTHSGVRMMNDAATLDAHSQLCSVPIDEKLALTVKVSPTYALDEIQSVTLKAFRKIVGYDTFESIRRKERNETKDTSDYYNVTVSMMVKRKPVEAAAAPAAAHPASLAATLDKGFPYDD
Ga0129353_112973113300012525AqueousATLIAMAGVSATETETEEMVALSSHMQLVSRALEMGGSRNAAKALLHSALATFEGSHSRTHSGVRMMNDAATLDAHSQLCSVPIDEKLALTVKVSPTYALDEIQSVTLKAFRKIVGYDTFESIRRKERNETKDTSDYYNVTVSMMVKRKPVEAAAAPAAAHPASLAATLD
Ga0129353_183018613300012525AqueousATLAALATASATETESWETIGLSSHMQLVSRALEMGGSRNAAKALLHSALETFEGSHSRVHSRAADVDARSQTVAVPIDEKLAMTVKVSPTYALDDIQSVTLKAFRKIVGYDTFESIRVKERSEQKDTSDYYNVTVSMMVRRKPVEGAAAAGGAAAESLAAKLDKGFPYDD*
Ga0129346_126278313300012965AqueousKMKFVNATLAALATASATETESWETIGLSSHMQLVSRALEMGGSRNAAKALLHSALETFEGSHSRVHSRAADVDARSQTVAVPIDEKLAMTVKVSPTYALDDIQSVTLKAFRKIVGYDTFESIRVKERSEQKDTSDYYNVTVSMMVRRKPVEGAAAAGGAAAESLAAKLDKGFPYDD*
Ga0129341_122007813300012966AqueousIKMKFVKATLAALATASATETESWETIGLSSHMQLVSRALEMGGSRNAAKALLHSALETFEGSHSRVHSRAADVDARSQTVAVPIDEKLAMTVKVSPTYALDDIQSVTLKAFRKIVGYDTFESIRVKERSEQKDTSDYYNVTVSMMVRRKPVEGAAAAGGAAAESLAAK
Ga0181379_113209023300017783SeawaterMKFVKALALAATASAAETESYEYIALSSHMQLVSRALEMGGSRNAAKALLHSALETFEGSHSHAHGRARNDAATLEAHSQTVSVPIDEKLAMTVKVSPTYALDEIQSVTLKAFRKIVGYDTFESIRVKERNETKDTSDYYNVTVSMMVRRKPVEGAAPAPAAAGSVSLAASLDKGFPYDD
Ga0193355_102002813300018628MarineGSRMAAKALLTTALETFEGAHSHAHTRGRARNDAATLEAHSQTVSVPIDEKLAMTVKVSPTYALDEIQSVTLKAFRKIVGYDTFESIRVKERNETKDTSDYYNVTVSMMVKRKPVDGGAAPSGASQTLASSLDKGFPYDD
Ga0193138_101949513300018742MarineKMKFAKATLAALAVASASETESFETVGLSSHMQLVSRALEMGGSRTAAKALLHSALETFEGSHSRAHAGVRMMNDAATLEAHSQLVAVPIDEKLALTVKVSPTYALDEIQSVTLKAFRKIVGYDTFDSIRRKERSEQKDTSDYYNVTVSMMVKRKPVEAAAAPAAAHATSLAATLDKGFPYDD
Ga0192827_104980613300018763MarineMGIIYKIKMKFVKATLAALATASAAETESYETIGLNSQMQLVSRALEMGGSRMAARALLHAALETFEGSHSYAHGRAHLRNDAATLEAHSQTVAVPIDEKLAMTVKVSPTYALDEIQSVTLKAFRKIVGYDTFESIRVKERNEQKDTSDYYNVTVSMMVRRKPVEAAAAPASQSVSLAASLDKGFPYDD
Ga0193181_102141813300018766MarineKMKFAQATLAALSVASAAETESLETVGLSSHMQLVSRALEMGGSRNAAKALLHSALETFEGAHTRTHNGVRMMNDAATLEAHSQLVAVPIDEKLALTVKVSPTYALDEIQSVTLKAFRKIVGYDTFDSIRRKERSEQKDTSDYYNVTVSMMVKRKPVEAAAAPAPAHATSLAATLDKGFPYDD
Ga0193124_105081513300018787MarineLVSRALEMGGSRQAARALLTTALETFEGSHSHAHGRAHLRNDAATLEAHSQTVSVPIDEKLAMTVKVSPTYALDTVQSVTLKAFRKIVGYDTFESIRQKERSEAKDTSDYYNVTVSMMVQRKPVESAAAPAATGGSLATTLDKGFPYDD
Ga0193124_106636613300018787MarineEALSTFESSHSHAYAHGRARVRNDAATLEAHSQTVSVPIDEKLAMTVKVSPTYALDEIQSVTLKAFRKIVGYDTFESIRVKERNEQKDTSDYYNVTVSMMVRRKPVEAAAAPAATGAALASTLDKGFPYDD
Ga0193306_105984613300018800MarineETIGLSSHMQLVSRALEMGGSRNAAKALLHSALETFEGSHSHSHTGVRMMNDAATLEAHSQLVAVPIDEKLALTVKVSPTYALDEIQSVTLKAFRKIVGYDTFDSIRRKERSEQKDTSDYYNVTVSMMVKRRPVEAAAAPPAQAHGTSLAATLDKGFPYDD
Ga0192829_106558513300018812MarineASAAETESLETVGLSSHMQLVSRALEMGGSRNAAKALLHSALETFEGAHTRTHNGVRMMNDAATLEAHSQLVAVPIDEKLALTVKVSPTYALDEIQSVTLKAFRKIVGYDTFDSIRRKERSEQKDTSDYYNVTVSMMVKRKPVEAAAAPAPAHATSLAATLDKGFPYDD
Ga0193191_108225813300018830MarineKALLHSALETFEGSHSRAHAGVRMMNDAATLEAHSQLVAVPIDEKLALTVKVSPTYALDEIQSVTLKAFRKIVGYDTFDSIRRKERSEQKDTSDYYNVTVSMMVKRKPVEAAAAPAAAHATSLAATLDKGFPYDD
Ga0194240_100813913300018832MarineASETESFETVGLSSHMQLVSRALEMGGSRTAAKALLHSALETFEGSHSRAHAGVRMMNDAATLEAHSQLVAVPIDEKLALTVKVSPTYALDEIQSVTLKAFRKIVGYDTFDSIRRKERSEQKDTSDYYNVTVSMMVKRKPVEAAAAPAAAHATSLAATLDKGFPYDD
Ga0194240_101047413300018832MarineASETESFETVGLSSHMQLVSRALEMGGSRTAAKALLHSALETFEGSHSRAHAGVRMMNDAATLEAHSQLVAVPIDEKLALTVKVSPTYALDEIQSVTLKAFRKIVGYDTFDSIRRKERSEQKDTSDYYNVTVSMMVKRKPVEPAAAPSGPAQAHSLAATLDKGFPYDD
Ga0193302_104988813300018838MarineVASAAETETLETVGLSSHMQLVSRALEMGGSRNAAKALLHSALETFEGAHTKTHSGVRMMNDGAALEAHSQLVSVPIDEKLALTVKVSPTHALDEIQSVTLKAFRKIVGYDTFDSIRRKERNETKDTSDYYNVTVSMMVKRKPVEPAAAPSGPAHAATSLAATLDKGFPYDD
Ga0193302_107899513300018838MarineLNSQMQLVSRALEMGGSRMAARALLHAALETFEGSHSYAHGRAHLRNDAATLEAHSQTVAVPIDEKLAMTVKVSPTYALDEIQSVTLKAFRKIVGYDTFESIRVKERNEQKDTSDYYNVTVSMMVRRKPVEAAAAPASQSVSLAASLDKGFPYDD
Ga0193253_104505413300018846MarineKFVKATLVAAAAVSASETTETVGLSSHMQLVSRALEMGGSRNAAKALLHSALATFEGSHSHTHAGVRMMNDAATLEAHSQLVSVPIDEKLALSVKVSPTYALDEIQSVTLKAFRKIVGYDTFESIRRKERNETKDTSDYYNVTVSMMVKRKPVEAATAPAAAPPASLAATLDKGFPYDD
Ga0193253_106203813300018846MarineFAQATLAALSVASATETESLETVGLSSHMQLVSRALEMGGSRNAAKALLHSALETFEGSHTNTHTGVRMMNDGAALEAHSQLVAVPIDEKLALTVKVSPTYALDEIQSVTLKAFRKIVGYDTFDSIRRKERSEQKDTSDYYNVTVSMMVKRKPVEAAAAPGPAAAHASSLAATLDKGFPYDD
Ga0193311_1003728713300018885MarineKFAKAILAGVAVASASETESWETIGLSSHMQLVSRALEMGGSRNAAKALLHSALETFEGSHSHSHTGVRMMNDAATLEAHSQLVAVPIDEKLALTVKVSPTYALDEIQSVTLKAFRKIVGYDTFDSIRRKERSEQKDTSDYYNVTVSMMVKRRPVEAAAAPPAQAHGTSLAATLDKGFPYDD
Ga0192989_1005586613300018926MarineFVKATLVAAAAVSASETTETVGLSSHMQLVSRALEMGGSRNAAKALLHSALATFEGSHSHTHAGVRMMNDAATLEAHSQLVSVPIDEKLALSVKVSPTYALDEIQSVTLKAFRKIVGYDTFESIRRKERNETKDTSDYYNVTVSMMVKRKPVEAATAPAAAPPASLAATLDKGFPYDD
Ga0192989_1014510513300018926MarineFVKATLAALATASATETESWETIGLSSHMQLVSRALEMGGSRSAARALLHSALQTFEGSQAHTRGATGNVDARSQTVAVPIDEKLAMTVKVSPTYALDTINSVTLKAFRKIVGYDTFESIRVKERNETKDTSDYYNVTVSMMVQRKPVEGAAAATGATPASLAATLDKGFPYDD
Ga0192989_1015584013300018926MarineVASATETESLETVGLSSHMQLVSRALEMGGSRNAAKALLHSALETFEGSHTNTHTGVRMMNDGAALEAHSQLVAVPIDEKLALTVKVSPTYALDEIQSVTLKAFRKIVGYDTFDSIRRKERSEQKDTSDYYNVTVSMMVKRKPVEAAAAPGPAAAHASSLAATLDKGFPYDD
Ga0193178_1006921213300018967MarineRALLHAALETFEGSHSYAHGRAHLRNDAATLEAHSQTVAVPIDEKLAMTVKVSPTYALDEIQSVTLKAFRKIVGYDTFESIRVKERNEQKDTSDYYNVTVSMMVRRKPVEAAAAPASQSVSLAASLDKGFPYDD
Ga0193254_1006167813300018976MarineETTETVGLSSHMQLVSRALEMGGSRNAAKALLHSALATFEGSHSHTHAGVRMMNDAATLEAHSQLVSVPIDEKLALSVKVSPTYALDEIQSVTLKAFRKIVGYDTFESIRRKERNETKDTSDYYNVTVSMMVKRKPVEAATAPAAAPPASLAATLDKGFPYDD
Ga0192947_1023888113300018982MarineLEMGGSRNAAKALLHEALSTFEGSRSHAHGRVRNDAATLEAHSQTVAVPIDEKLAMTVKVSPTYALDEVQSVTLKAFRKIVGYDTFESIRVKERNEAKDTSDYYNVTVSMMVRRKPVEAAAAPAAGGSVSLASSLDKGFPYDD
Ga0193030_1013657713300018989MarineTWGNIKIKMKFVKATLAALAIASATETENLEMEQVGLSSHMQLVSRALEMGGSRNAARQLLTTALETFEGSHSHTHQRVHMKDASAALEAHSQTVAVPIDEKLAMTVKVSPTYALDEIQSVTLKAFRKIVGYDTFESIRVKERNETKDTSDYYNVTVSMMVRRKPVEAAAAPSSSGSVSLAASLDKGFPYDD
Ga0193030_1014801923300018989MarineHGDIYKIKMKFVKATLAALATASATEVESFETIGLSSHMQLVSRALEMGGSRNAAKALLTTALEAFEGSHAHSHGRAHLRNDAATLEAHSQTVSVPIDEKLAMTVKVSPTYALDEIQSVTLKAFRKIVGYDTFESIRVKERSEQKDTSDYYNVTVSMMVRRKPVEAAAAPSSGGSVSLASSLDKGFPYDD
Ga0193030_1015634313300018989MarineMGDIINKLKMKFVKATLAAMATASAADTEEFMGLSAQMQLVSKALEMGGSRQAAKELLHEALATFEGAHSHAHTRAWMRNDAATLEAHSQTVAVPIDEKLAMTVKVSPTYALDSIQSVTLKAFRKIVGYDTFESIRTKERNEKKDTNDYYNITVSMMVQRKPVEAAAAPAGSGVSLASSLDKGFPYDD
Ga0193030_1016342113300018989MarineMKFVKALALATTVSASAPETYEFIELSSHMQLVSRALEMGGSRNAAKALLHSALETFEGSHSHAHGRARNDAATLEAHSQTVSVPIDEKLAMTVKVSPTYALDEIQSVTLKAFRKIVGYDTFESIRVKERNETKDTSDYYNVTVSMMVRRKPVEGAAPAPAAAGSVSLASSLDKGFPYDD
Ga0193030_1019609713300018989MarineTWGNYIKLKMKFVKATLCAIATASATEVESWETIGLSSHMQLVSRALEMGGSRSAARALLHSALQTFEGSHARGNAANVDARSQTVAVPIDEKLAMTVKVSPTYALDTVNSVTLKAFRKIVGYDTFESIRVKERNETKDTSDYYNVTVSMMVQRKPVEGAAAAGGNTGESLAAKLDKGFPYDD
Ga0193030_1020193113300018989MarineDSYETVGLSSHMQLVSRALEMGGSRNGARALLHEALSTFEGSHSHAHGRAHLRNDAATLEAHSQTVSVPIDEKLAMTVKVSPTYALDTIQSVTLKAFRKIVGYDTFESIRVKERNETKDTSDYYNVTVSMMVQRKPVEAAAAPAATGASLATTLDKGFPYDD
Ga0193030_1022730313300018989MarineFAIASASATETESWETIGLSSHMQLVSRALEMGGSRNAAKMLLHSALETFEGSHSHMRVRQTQGNVDARSQTVAVPIDEKLAMTVKVSPTYALDDIQSVTLKAFRKIVGYDTFESIRVKERNETKDTSDYYNVTVSMMVRRKPVEGAAAAGGAAAASLASTLDKGFPYDD
Ga0193030_1030425613300018989MarineQETIGLSSHMQLVSRALEMGGSRNAAKALLTTALEAFEGSHAHSHGRAHMRNDAATLEAHSQTVAVPIDEKLAMTVKVSPTYALDEIQSVTLKAFRKIVGYDTFESIRVKERNEQKDTSDYYNVTVSMMVRRKPVEAAAAPAATGAALASTLDKGFPYDD
Ga0193034_1010118413300019001MarineASESTSWETIGLSSHMQLVSRALEMGGSRNAAKALLHEALSTFEGSRSYAHGRVRNDAATLEAHSQTVSVPIDEKLAMTVKVSPTYALDEIQSVTLKAFRKIVGYDTFESIRVKERNETKDTSDYYNVTVSMMVRRKPVEAAAAPAAGGSVSLASSLDKGFPYDD
Ga0193034_1010671213300019001MarineEMGGSRNAAKALLHSALETFEGAHTRTHNGVRMMNDAAALEAHSQLVAVPIDEKLALTVKVSPTYALDEIQSVTLKAFRKIVGYDTFDSIRRKERSEQKDTSDYYNVTVSMMVKRKPVEAAAAPAPAHATSLAATLDKGFPYDD
Ga0192869_1022722013300019032MarineHGIIKKMKFAQATLAALSVASATETESLETVGLSSHMQLVSRALEMGGSRNAAKALLHSALETFEGSHTKTHAGVRMMNDGAALEAHSQLVAVPIDEKLALTVKVSPTYALDEIQSVTLKAFRKIVGYDTFDSIRRKERSEQKDTSDYYNVTVSMMVKRKPVEAAAAPGPAAKASSLAATLDKGFPYDD
Ga0192945_1015123413300019036MarineMKFVKAVLAVAATASASESTSWETIGLSSHMQLVSRALEMGGSRNAAKALLHEALSTFEGSRSHAHGRVRNDAATLEAHSQTVAVPIDEKLAMTVKVSPTYALDEVQSVTLKAFRKIVGYDTFESIRVKERNEAKDTSDYYNVTVSMMVRRKPVEAAAAPAAGGSVSLASSLDKGFPYDD
Ga0193123_1028135113300019039MarineSLETIGLSNQMQLVSTALQMGGSRNAAKALLHEALSTFESSHSHAYAHGRARVRNDAATLEAHSQTVSVPIDEKLAMTVKVSPTYALDEIQSVTLKAFRKIVGYDTFESIRVKERNEQKDTSDYYNVTVSMMVRRKPVEAAAAPAATGAALASTLDKGFPYDD
Ga0192826_1018861513300019051MarineMGKIKMKFVKATLAALATASAAETESYETIGLNSQMQLVSRALEMGGSRMAARALLHAALETFEGSHSYAHGRAHLRNDAATLEAHSQTVAVPIDEKLAMTVKVSPTYALDEIQSVTLKAFRKIVGYDTFESIRVKERNEQKDTSDYYNVTVSMMVRRKPVEAAAAPASQSVSLAASLDKGFPYDD
Ga0192826_1023419913300019051MarineAEVDSYETVGLSSHMQLVSRALEMGGSRNGARALLHEALSTFEGSHSHGRAHLRNDAATLEAHSQTVSVPIDEKLAMTVKVSPTYALDTIQSVTLKAFRKIVGYDTFESIRVKERNETKDTSDYYNVTVSMMVQRKPVEAAAAPAAAGASLATTLDKGFPYDD
Ga0192826_1026303223300019051MarineRNAAKALLHSALETFEGSHSHAHGRTRNDAATLEAHSQTVSVPIDEKLAMTVKVSPTYALDEIQSVTLKAFRKIVGYDTFESIRVKERNETKDTSDYYNVTVSMMVRRKPVAGAAAPAPSGSVSLASSLDKGFPYDD
Ga0192826_1029160113300019051MarineYETIGLSSHMQLVSRALEMGGSRNAAKALLTTALETFEGAHSHTHSRTKLRNDAATLEAHSQTVAVPIDEKLAMTVKVSPTYALDEIQSLTLKAFRKIVGYDTFESIRVKERNEAKDTSDYYNVTVSMMVRRKPVEGASAAGPTNGGQSLSATLDKGFPYDD
Ga0188866_102356013300019095Freshwater LakeMKFVKATLAAIATASATETESWETIGLSSHMQLVSRALEMGGSRSAARALLHSALQTFEGSHVRGSTANVDARSQTVAVPIDEKLAMTVKVAPTYALDTINSVTLKAFRKIVGYDTFESIRVKERNETKDTSDYYNVTVSMMVQRKPVEGAAAAGGATAESLAAKLDKGFPYDD
Ga0193153_101980513300019097MarineKALLHSALETFEGAHTRTHSGVRMMNDAAALEAHSQLVAVPIDEKLALTVKVSPTYALDEIQSVTLKAFRKIVGYDTFDSIRRKERSEQKDTSDYYNVTVSMMVKRKPVEAAAAPAPAHATSLAATLDKGFPYDD
Ga0193054_104016313300019117MarineMGIFYKIKMKFVTATLAALATASAAEVDSYETVGLSSHMQLVSRALEMGGSRNGARALLHEALSTFEGSHSHAHGRAHLRNDAATLEAHSQTVSVPIDEKLAMTVKVSPTYALDTIQSVTLKAFRKIVGYDTFESIRVKERNETKDTSDYYNVTVSMMVQRKPVEAAAAPAAAGASLATTLDKGFPYDD
Ga0188870_1011900513300019149Freshwater LakeFVKALAIAATASASEIESYENIGLSSHMQLVSRALEMGGSRNAAKALLHSALETFEGSHSHSHGRARNDAATLEAHSQTVSVPIDEKLAMTVKVSPTYALDEIQSVTLKAFRKIVGYDTFESIRVKERNETKDTSDYYNVTVSMMVRRKPVEGAAPAPAASGSVSLAASLDKGFPYDD
Ga0194244_1001518413300019150MarineMKFAKATLAALAVASASETESFETVGLSSHMQLVSRALEMGGSRTAAKALLHSALETFEGSHSRAHAGVRMMNDAATLEAHSQLVAVPIDEKLALTVKVSPTYALDEIQSVTLKAFRKIVGYDTFDSIRRKERSEQKDTSDYYNVTVSMMVKRKPVEAAAAPAAAHATSLAATLDKGFPYDD
Ga0206692_161954813300021350SeawaterQLVSRALEMGGSRNAAKALLHEALSTFEGAHAHAHGRARNDAATLEAHSQTVSVPIDEKLAMTVKVSPTYALDTINSVTLKAFRKIVGYDTFESIRVKERNETKDTSDYYNVTVSMMVQRKPVEGAAAATGATPASLAATLDKGFPYDD
Ga0206692_184762813300021350SeawaterMKFAQATLAALSVASATETESLETVGLSSHMQLVSRALEMGGSRNAAKALLHSALETFEGSHTKTHAGVRMMNDGAALEAHSQLVAVPIDEKLALTVKVSPTYALDEIQSVTLKAFRKIVGYDTFDSIRRKERSEQKDTSDYYNVTVSMMVKRKPVEAAAAPGPAAHASSLAATLDKGFPYDD
Ga0206690_1079862513300021355SeawaterAVVGLVAASNALSSHMELVEKALSMAGSREQAHILLQSALATFGRGGDNEMEAHSQTVAVPIDEKKALTLKVSPTYSLDEVNSVTLKAFRKIVGYDTFDSIRKKDRSESKDTSDYYNVTVSMMIKRKPVENTAAPAASTGASLSSKLDKGFPYDD
Ga0063132_10604213300021872MarineKFAKATLAALAVASASETESFETVGLSSHMQLVSRALEMGGSRTAAKALLHSALETFEGSHSRAHAGVRMMNDAATLEAHSQLVAVPIDEKLALTVKVSPTYALDEIQSVTLKAFRKIVGYDTFDSIRRKERSEQKDTSDYYNVTVSMMVKRKPVEAAAAPAAAHATSLAATLDKGFPYD
Ga0063117_102319913300021881MarineVKATLAALATASAAETESYETIGLNSQMQLVSRALEMGGSRMAARALLHAALETFEGSHSYAHGRAHLRNDAATLEAHSQTVAVPIDEKLAMTVKVSPTYALDEIQSVTLKAFRKIVGYDTFESIRVKERNEQKDTSDYYNVTVSMMVRRKPVEAAAAPASQSVSLA
Ga0063136_102987313300021896MarineGGSRNAAKALLHSALETFEGSHTKTHAGVRMMNDGAALEAHSQLVAVPIDEKLALTVKVSPTYALDEIQSVTLKAFRKIVGYDTFDSIRRKERSEQKDTSDYYNVTVSMMVKRKPVEAAAAPGPAAHASSLAATLDKGFPYDD
Ga0063136_105907413300021896MarineMKFVKAICLAATASAAESESWETIGLSSHMQLVSRALEMGGSRNAAKALLHSALETFEGSHSHAHGRVRNDAATLEAHSQTVSVPIDEKLAMTVKVSPTYALDEIQSVTLKAFRKIVGYDTFESIRVKERNETKDTSDYYNVTVSMMVRRKPVAGAAAPAPSGSVSLASSLDKGFPYDD
Ga0063135_101605413300021908MarineFAQATLAALSVASATETESLETVGLSSHMQLVSRALEMGGSRNAAKALLHSALETFEGSHTKTHAGVRMMNDGAALEAHSQLVAVPIDEKLALTVKVSPTYALDEIQSVTLKAFRKIVGYDTFDSIRRKERSEQKDTSDYYNVTVSMMVKRKPVEAAAAPGPAAHASSLAATLDKGFPYD
Ga0063135_103411413300021908MarineVKATLVAAAAVSATETTETVGLSSHMQLVSRALEMGGSRNAAKALLHSALATFEGSHAHTHSGVRMMNDAATLEAHSQLVSVPIDEKLALSVKVSPTYALDEIQSVTLKAFRKIVGYDTFESIRRKERNETKDTSDYYNVTVSMMVKRKPVEAAAAPAAAPPASLAATLDKGFPYDD
Ga0063133_102342513300021912MarineFVKATLAALAVASATETENMETVGLSSHMQLVSRALEMGGSRNAARQLLTTALETFEGSHSRTHSRAHIRDEGAALEAHSQTVSVPIDEKLAMTVKVSPTYALDEIQSVTLKAFRKIVGYDTFESIRVKERNETKDTSDYYNVTVSMMVRRKPVESAATAPNANGATSLAASLDKGFPYD
Ga0063133_105612813300021912MarineTLVAAAAVSATETTETVGLSSHMQLVSRALEMGGSRNAAKALLHSALATFEGSHAHTHSGVRMMNDAATLEAHSQLVSVPIDEKLALSVKVSPTYALDEIQSVTLKAFRKIVGYDTFESIRRKERNETKDTSDYYNVTVSMMVKRKPVEAAAAPAAAPPASLAATLDKGFPYDD
Ga0063133_105763813300021912MarineKAICLAATASAAETESFENIGLSSHMQLVSRALEMGGSRNAAKALLHSALETFEGSHSHAHGRVRNDAATLEAHSQTVSVPIDEKLAMTVKVSPTYALDEIQSVTLKAFRKIVGYDTFESIRVKERNETKDTSDYYNVTVSMMVRRKPVAGAAAPAPSGSVSLASSLDKGFPYDD
Ga0063139_102093913300021934MarineVKALALATTVSASAPETYEFIELSSHMQLVSRALEMGGSRNAAKALLHSALETFEGSHSHAHGRARNDAATLEAHSQTVSVPIDEKLAMTVKVSPTYALDEIQSVTLKAFRKIVGYDTFESIRVKERNETKDTSDYYNVTVSMMVRRKPVEGAAPAPAAAGSVSLASSLDKGFPYDD
Ga0063138_113588813300021935MarineVKAICLAATASAAESESWETIGLSSHMQLVSRALEMGGSRNAAKALLHSALETFEGSHSHAHGRVRNDAATLEAHSQTVSVPIDEKLAMTVKVSPTYALDEIQSVTLKAFRKIVGYDTFESIRVKERNETKDTSDYYNVTVSMMVRRKPVAGAAAPAPSGSVSLASSLD
Ga0228681_102556513300023683SeawaterVKALALAATASAAETESYEYIALSSHMQLVSRALEMGGSRNAAKALLHSALETFEGSHSHAHGRARNDAATLEAHSQTVSVPIDEKLAMTVKVSPTYALDEIQSVTLKAFRKIVGYDTFESIRVKERNETKDTSDYYNVTVSMMVRRKPVEGAAPAPAAAGSVSLAASLDKGFPYDD
Ga0228680_102715013300023695SeawaterLASVSATETESLETIGLSSHMQLVSRALEMGGSRNAARALLTTALETFEGAHAHSHTRTHIRNDAATLEAHSQTVAVPIDEKLAMTVKVSPTYALDEIQSVTLKAFRKIVGYDTFESIRVKERNEAKDTSDYYNVTVSMMVRRKPVEGASAATPAAGQSLSASLDKGFPYDD
Ga0228684_102612613300023704SeawaterKFAQATLAALSVASATETESLETVGLSSHMQLVSRALEMGGSRNAAKALLHSALETFEGSHTKTHAGVRMMNDGAALEAHSQLVAVPIDEKLALTVKVSPTYALDEIQSVTLKAFRKIVGYDTFDSIRRKERSEQKDTSDYYNVTVSMMVKRKPVEAAAAPGPAAHASSLAATLDKGFPYDD
Ga0208815_105907313300026134Marine OceanicYEAVGLSSHMQLVSRALEMGGSRNAARALLTTALETFEGAHSHGRAHIRTNDATLEAHSQTVSVPIDEKLAMTVKVSPTYALDTIQSVTLKAFRKIVGYDTFESIRQKERQEAKDTSDYYNVTVSMMVRRKPAEVASAPARDPYNPDGAPNLAATLDKGFPYDD
Ga0247594_108077013300026448SeawaterNAAKALLHSALETFEGSHSHAHGRARNDAATLEAHSQTVSVPIDEKLAMTVKVSPTYALDEIQSVTLKAFRKIVGYDTFESIRVKERNETKDTSDYYNVTVSMMVRRKPVEGAAPAPAAAGSVSLAASLDKGFPYDD
Ga0247571_116550213300026495SeawaterLALAATASAAETESYEYIALSSHMQLVSRALEMGGSRNAAKALLHSALETFEGSHSHAHGRARNDAATLEAHSQTVSVPIDEKLAMTVKVSPTYALDEIQSVTLKAFRKIVGYDTFESIRVKERNETKDTSDYYNVTVSMMVRRKPVEGAAPAPAAAGSVSLAASLDKGFPYDD
Ga0247587_113552113300026504SeawaterTESLETIGLSSHMQLVSRALEMGGSRNAARALLTTALETFEGAHAHSHTRTHIRNDAATLEAHSQTVAVPIDEKLAMTVKVSPTYALDEIQSVTLKTFRKIVGYDTFESIRVKERNEAKDTSDYYNVTVSMMVRRKPVEGASAATPAAGQSLSASLDKGFPYDD
Ga0247590_107626513300026513SeawaterTESLETVGLSSHMQLVSRALEMGGSRNAAKALLHSALETFEGSHTKTHAGVRMMNDGAALEAHSQLVAVPIDEKLALTVKVSPTYALDEIQSVTLKAFRKIVGYDTFDSIRRKERSEQKDTSDYYNVTVSMMVKRKPVEAAAAPGPAAHASSLAATLDKGFPYDD
Ga0256411_117072013300028134SeawaterFVKATVLALASVSATETESLETIGLSSHMQLVSRALEMGGSRNAARALLTTALETFEGAHAHSHTRTHIRNDAATLEAHSQTVAVPIDEKLAMTVKVSPTYALDEIQSVTLKAFRKIVGYDTFESIRVKERNEAKDTSDYYNVTVSMMVRRKPVEGASAATPAAGQSLSASLDKGFPYDD
Ga0256412_115701413300028137SeawaterFVKALALAATASAAETESYEYIALSSHMQLVSRALEMGGSRNAAKALLHSALETFEGSHSHAHGRARNDAATLEAHSQTVSVPIDEKLAMTVKVSPTYALDEIQSVTLKAFRKIVGYDTFESIRVKERNETKDTSDYYNVTVSMMVRRKPVEGAAPAPAAAGSVSLAASLDKGFPYDD
Ga0256412_115779413300028137SeawaterVKAVLAVAATASASESPSWETIGLSSHMQLVSRALEMGGSRNAAKALLHEALSTFEGAHAHAHGRARNDAATLEAHSQTVSVPIDEKLAMTVKVSPTYALDEIQSVTLKAFRKIVGYDTFESIRVKERNEAKDTSDYYNVTVSMMVRRKPVEAAAAPAAGGSVSLASSLDKGFPYDD
Ga0256412_126804813300028137SeawaterVKATLAALATASATETESWETIGLSSHMQLVSRALEMGGSRSAARALLHSALQTFEGSQAHTRGATGNVDARSQTVAVPIDEKLAMTVKVSPTYALDTINSVTLKAFRKIVGYDTFESIRVKERNETKDTSDYYNVTVSMMVQRKPVEGAAAATGATPASLAATLDKGFPYDD
Ga0256412_127760213300028137SeawaterVLALASVSATETESLETIGLSSHMQLVSRALEMGGSRNAARALLTTALETFEGAHAHSHTRTHIRNDAATLEAHSQTVAVPIDEKLAMTVKVSPTYALDEIQSVTLKAFRKIVGYDTFESIRVKERNEAKDTSDYYNVTVSMMVRRKPV
Ga0256417_114821013300028233SeawaterATLAALATASATETESWETIGLSSHMQLVSRALEMGGSRNAAKALLHSALETFEGSHSRVHLRAADVDARSQTVAVPIDEKLAMTVKVSPTYALDDIQSVTLKAFRKIVGYDTFESIRVKERNETKDTSDYYNVTVSMMVRRKPVEGAAAAGGAAAESLAAKLDKGFPYDD
Ga0256413_114126413300028282SeawaterATLAALSVASATETESLETVGLSSHMQLVSRALEMGGSRNAAKALLHSALETFEGSHTKTHAGVRMMNDGAALEAHSQLVAVPIDEKLALTVKVSPTYALDEIQSVTLKAFRKIVGYDTFDSIRRKERSEQKDTSDYYNVTVSMMVKRKPVEAAAAPGPAAHASSLAATLDKGFPYDD
Ga0256413_118111313300028282SeawaterFVKALALAATASAAETESYEYIALSSHMQLVSRALEMGGSRNAAKALLHSALETFEGSHSHAHGRARNDAATLEAHSQTVSVPIDEKLAMTVKVSPTYALDEIQSVTLKAFRKIVGYDTFESIRVKERNETKDTSDYYNVTVSMMVRRSS
Ga0247572_112610513300028290SeawaterKFVKALALAATASAAETESYEYIALSSHMQLVSRALEMGGSRNAAKALLHSALETFEGSHSHAHGRARNDAATLEAHSQTVSVPIDEKLAMTVKVSPTYALDEIQSVTLKAFRKIVGYDTFESIRVKERNETKDTSDYYNVTVSMMVRRKPVEGAAPAPAAAGSVSLAASLDKGFPYDD
Ga0304731_1054846213300028575MarineKFVTATLAALATASAAEVDSYETVGLSSHMQLVSRALEMGGSRNGARALLHEALSTFEGSYSHAHGRAHLRNDAATLEAHSQTVSVPIDEKLAMTVKVSPTYALDTIQSVTLKAFRKIVGYDTFESIRVKERNETKDTSDYYNVTVSMMVQRKPVEAAAAPAATGASLATTLDKGFPYDD
Ga0304731_1147966513300028575MarineTESFETIGLSSHMQLVSRALEMGGSRMAAKALLTTALETFEGAYAHSHSHSRTHIRNDAATLEAHSQTVAVPIDEKLAMTVKVSPTYALDEIQSVTLKAFRKIVGYDTFESIRVKERNETKDTSDYYNVTVSMMVRRKPVEGAAASGPAAGSQTLSATLDKGFPYDD
Ga0304731_1159309413300028575MarineVKATLCAIATASATEVESWETIGLSSHMQLVSRALEMGGSRSAARALLHSALQTFEGSHARGNAANVDARSQTVAVPIDEKLAMTVKVSPTYALDTVNSVTLKAFRKIVGYDTFESIRVKERNETKDTSDYYNVTVSMMVQRKPVEGAAAAGGNTGESLAAKLDKGFPYDD
Ga0073990_1183386213300030856MarineGLSSHMQLVSRALEMGGSRNAAKALLHEALSTFEGAHSHAHGRARNDAATLEAHSQTVSVPIDEKLAMTVKVSPTYALDEIQSVTLKAFRKIVGYDTFESIRVKERNEAKDTSDYYNVTVSMMVRRKPVEAAAAPAAGGSVSLASSLDKGFPYDD
Ga0073990_1204339313300030856MarineRSAARALLHSALQTFEGSQAHTRGASSNVDARSQTVAVPIDEKLAMTVKVSPTYALDDIQSVTLKAFRKIVGYDTFESIRVKERNETKDTSDYYNVTVSMMVRRKPVDGAGAAGGATGTETLASKLDKGFPYDD
Ga0073989_1351052413300031062MarineIKKMKFVKATLAALATASATETESVETMGLSSHMQLVSRALEMGGSRNAAKALLHSALETFEGSRSHAHSRLHQRNDAATLEAHSQTVSVPIDEKLAMTVKVSPTYALDEIQSVTLKAFRKIVGYDTFESIRVKERNETKDTSDYYNVTVSMMVRRKPVEAAAAPSTAGASLATTLDKGFPYDD
Ga0314711_1061330913300032732SeawaterTASATETESWETIGLSSHMQLVSRALEMGGSRSAARALLHSALQTFEGSHVRGSTANVDARSQTVAVPIDEKLAMTVKVAPTYALDTINSVTLKAFRKIVGYDTFESIRVKERNETKDTSDYYNVTVSMMVQRKPVEGAAAAGGATAESLAAKLDKGFPYDD

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.