NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F085837

Metagenome Family F085837

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F085837
Family Type Metagenome
Number of Sequences 111
Average Sequence Length 51 residues
Representative Sequence LGQTFVTWNCEVQVKPGDLATEKPYLVSNRKDRNVKCVGVEKPKPVCATD
Number of Associated Samples 97
Number of Associated Scaffolds 111

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 2.06 %
% of genes near scaffold ends (potentially truncated) 84.68 %
% of genes from short scaffolds (< 2000 bps) 81.98 %
Associated GOLD sequencing projects 90
AlphaFold2 3D model prediction Yes
3D model pTM-score0.33

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (85.586 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere
(9.910 % of family members)
Environment Ontology (ENVO) Unclassified
(49.550 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(68.468 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 3.85%    β-sheet: 23.08%    Coil/Unstructured: 73.08%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.33
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 111 Family Scaffolds
PF14522Cytochrome_C7 16.22
PF02085Cytochrom_CIII 16.22
PF03572Peptidase_S41 0.90
PF13247Fer4_11 0.90
PF00498FHA 0.90
PF00156Pribosyltran 0.90

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 111 Family Scaffolds
COG0793C-terminal processing protease CtpA/Prc, contains a PDZ domainPosttranslational modification, protein turnover, chaperones [O] 0.90

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms85.59 %
UnclassifiedrootN/A14.41 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000890|JGI11643J12802_11674373All Organisms → cellular organisms → Bacteria → Acidobacteria735Open in IMG/M
3300000891|JGI10214J12806_11216261All Organisms → cellular organisms → Bacteria → Acidobacteria688Open in IMG/M
3300000956|JGI10216J12902_114841082All Organisms → cellular organisms → Bacteria → Acidobacteria730Open in IMG/M
3300002100|JGI24809J26612_1039650All Organisms → cellular organisms → Bacteria → Acidobacteria738Open in IMG/M
3300002120|C687J26616_10044475All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1568Open in IMG/M
3300003319|soilL2_10006057All Organisms → cellular organisms → Bacteria → Acidobacteria1334Open in IMG/M
3300003996|Ga0055467_10275744All Organisms → cellular organisms → Bacteria → Acidobacteria534Open in IMG/M
3300004013|Ga0055465_10161910All Organisms → cellular organisms → Bacteria → Acidobacteria715Open in IMG/M
3300004114|Ga0062593_100056973All Organisms → cellular organisms → Bacteria → Acidobacteria2484Open in IMG/M
3300004157|Ga0062590_101149191All Organisms → cellular organisms → Bacteria → Acidobacteria752Open in IMG/M
3300004463|Ga0063356_104446383All Organisms → cellular organisms → Bacteria → Acidobacteria603Open in IMG/M
3300004463|Ga0063356_104731766All Organisms → cellular organisms → Bacteria → Acidobacteria585Open in IMG/M
3300004480|Ga0062592_100879119All Organisms → cellular organisms → Bacteria → Acidobacteria805Open in IMG/M
3300004643|Ga0062591_101826314All Organisms → cellular organisms → Bacteria → Acidobacteria621Open in IMG/M
3300005293|Ga0065715_11182277All Organisms → cellular organisms → Bacteria → Acidobacteria502Open in IMG/M
3300005328|Ga0070676_11097386All Organisms → cellular organisms → Bacteria → Acidobacteria601Open in IMG/M
3300005339|Ga0070660_101868100All Organisms → cellular organisms → Bacteria → Acidobacteria512Open in IMG/M
3300005344|Ga0070661_101877686Not Available509Open in IMG/M
3300005364|Ga0070673_100458760All Organisms → cellular organisms → Bacteria → Acidobacteria1147Open in IMG/M
3300005366|Ga0070659_100815152All Organisms → cellular organisms → Bacteria → Acidobacteria812Open in IMG/M
3300005406|Ga0070703_10519665All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium538Open in IMG/M
3300005468|Ga0070707_101098472All Organisms → cellular organisms → Bacteria → Acidobacteria761Open in IMG/M
3300005530|Ga0070679_101108431All Organisms → cellular organisms → Bacteria → Acidobacteria736Open in IMG/M
3300005536|Ga0070697_100009205All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Chloracidobacterium → Chloracidobacterium thermophilum7718Open in IMG/M
3300005539|Ga0068853_100391773All Organisms → cellular organisms → Bacteria → Acidobacteria1299Open in IMG/M
3300005545|Ga0070695_101336147All Organisms → cellular organisms → Bacteria → Acidobacteria593Open in IMG/M
3300005548|Ga0070665_102517062All Organisms → cellular organisms → Bacteria → Acidobacteria516Open in IMG/M
3300005549|Ga0070704_100532244All Organisms → cellular organisms → Bacteria → Acidobacteria1024Open in IMG/M
3300005549|Ga0070704_101324469All Organisms → cellular organisms → Bacteria → Acidobacteria659Open in IMG/M
3300005577|Ga0068857_101857013All Organisms → cellular organisms → Bacteria → Acidobacteria590Open in IMG/M
3300005617|Ga0068859_100458616All Organisms → cellular organisms → Bacteria → Acidobacteria1370Open in IMG/M
3300005617|Ga0068859_102293049All Organisms → cellular organisms → Bacteria → Acidobacteria595Open in IMG/M
3300005840|Ga0068870_10328403All Organisms → cellular organisms → Bacteria → Acidobacteria974Open in IMG/M
3300006880|Ga0075429_100192503All Organisms → cellular organisms → Bacteria → Acidobacteria1786Open in IMG/M
3300006880|Ga0075429_101462835All Organisms → cellular organisms → Bacteria → Acidobacteria595Open in IMG/M
3300006894|Ga0079215_10061678All Organisms → cellular organisms → Bacteria → Acidobacteria1504Open in IMG/M
3300006954|Ga0079219_11503732All Organisms → cellular organisms → Bacteria → Acidobacteria610Open in IMG/M
3300009098|Ga0105245_11102921All Organisms → cellular organisms → Bacteria → Acidobacteria840Open in IMG/M
3300009101|Ga0105247_10484805All Organisms → cellular organisms → Bacteria → Acidobacteria898Open in IMG/M
3300009156|Ga0111538_12412370All Organisms → cellular organisms → Bacteria → Acidobacteria660Open in IMG/M
3300009162|Ga0075423_10492710All Organisms → cellular organisms → Bacteria → Acidobacteria1289Open in IMG/M
3300009162|Ga0075423_11943413All Organisms → cellular organisms → Bacteria → Acidobacteria636Open in IMG/M
3300009176|Ga0105242_12822448All Organisms → cellular organisms → Bacteria → Acidobacteria536Open in IMG/M
3300009177|Ga0105248_12526518All Organisms → cellular organisms → Bacteria → Acidobacteria585Open in IMG/M
3300009553|Ga0105249_12026022All Organisms → cellular organisms → Bacteria → Acidobacteria648Open in IMG/M
3300010038|Ga0126315_10840723All Organisms → cellular organisms → Bacteria → Acidobacteria607Open in IMG/M
3300010043|Ga0126380_10846767Not Available753Open in IMG/M
3300010375|Ga0105239_11889553All Organisms → cellular organisms → Bacteria → Acidobacteria692Open in IMG/M
3300010397|Ga0134124_10938972All Organisms → cellular organisms → Bacteria → Acidobacteria874Open in IMG/M
3300010397|Ga0134124_12192722All Organisms → cellular organisms → Bacteria → Acidobacteria592Open in IMG/M
3300010403|Ga0134123_10368977All Organisms → cellular organisms → Bacteria → Acidobacteria1303Open in IMG/M
3300010403|Ga0134123_12545499All Organisms → cellular organisms → Bacteria → Acidobacteria578Open in IMG/M
3300012925|Ga0137419_11434838All Organisms → cellular organisms → Bacteria → Acidobacteria583Open in IMG/M
3300012930|Ga0137407_10327488All Organisms → cellular organisms → Bacteria → Acidobacteria1406Open in IMG/M
3300012960|Ga0164301_11716566All Organisms → cellular organisms → Bacteria → Acidobacteria525Open in IMG/M
3300013297|Ga0157378_10369228All Organisms → cellular organisms → Bacteria → Acidobacteria1406Open in IMG/M
3300013306|Ga0163162_10186940All Organisms → cellular organisms → Bacteria → Acidobacteria2199Open in IMG/M
3300013307|Ga0157372_10844661All Organisms → cellular organisms → Bacteria → Acidobacteria1063Open in IMG/M
3300013307|Ga0157372_12681721All Organisms → cellular organisms → Bacteria → Acidobacteria572Open in IMG/M
3300014325|Ga0163163_10289141All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1691Open in IMG/M
3300014325|Ga0163163_11883310All Organisms → cellular organisms → Bacteria → Acidobacteria658Open in IMG/M
3300014326|Ga0157380_11293492All Organisms → cellular organisms → Bacteria → Acidobacteria776Open in IMG/M
3300014745|Ga0157377_11550525All Organisms → cellular organisms → Bacteria → Acidobacteria529Open in IMG/M
3300014745|Ga0157377_11663965All Organisms → cellular organisms → Bacteria → Acidobacteria513Open in IMG/M
3300015262|Ga0182007_10366699All Organisms → cellular organisms → Bacteria → Acidobacteria544Open in IMG/M
3300015374|Ga0132255_106223004All Organisms → cellular organisms → Bacteria → Acidobacteria505Open in IMG/M
3300017792|Ga0163161_11381381All Organisms → cellular organisms → Bacteria → Acidobacteria615Open in IMG/M
3300018061|Ga0184619_10046736All Organisms → cellular organisms → Bacteria → Acidobacteria1872Open in IMG/M
3300018422|Ga0190265_12539584All Organisms → cellular organisms → Bacteria → Acidobacteria611Open in IMG/M
3300018466|Ga0190268_12344339All Organisms → cellular organisms → Bacteria → Acidobacteria505Open in IMG/M
3300025735|Ga0207713_1105356All Organisms → cellular organisms → Bacteria966Open in IMG/M
3300025912|Ga0207707_10293567All Organisms → cellular organisms → Bacteria → Acidobacteria1406Open in IMG/M
3300025917|Ga0207660_11556332All Organisms → cellular organisms → Bacteria → Acidobacteria533Open in IMG/M
3300025921|Ga0207652_10742496All Organisms → cellular organisms → Bacteria → Acidobacteria874Open in IMG/M
3300025922|Ga0207646_10906620All Organisms → cellular organisms → Bacteria → Acidobacteria782Open in IMG/M
3300025930|Ga0207701_10198637All Organisms → cellular organisms → Bacteria → Acidobacteria1763Open in IMG/M
3300025933|Ga0207706_10491944All Organisms → cellular organisms → Bacteria → Acidobacteria1059Open in IMG/M
3300025961|Ga0207712_11918780All Organisms → cellular organisms → Bacteria → Acidobacteria530Open in IMG/M
3300026023|Ga0207677_11981688All Organisms → cellular organisms → Bacteria → Acidobacteria541Open in IMG/M
3300026035|Ga0207703_11086081All Organisms → cellular organisms → Bacteria → Acidobacteria768Open in IMG/M
3300026041|Ga0207639_12003262All Organisms → cellular organisms → Bacteria → Acidobacteria540Open in IMG/M
3300026075|Ga0207708_11534121All Organisms → cellular organisms → Bacteria → Acidobacteria585Open in IMG/M
3300026089|Ga0207648_10450586All Organisms → cellular organisms → Bacteria → Acidobacteria1172Open in IMG/M
3300026089|Ga0207648_10611375All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes1005Open in IMG/M
3300026095|Ga0207676_11559666All Organisms → cellular organisms → Bacteria → Acidobacteria658Open in IMG/M
3300026116|Ga0207674_11810104All Organisms → cellular organisms → Bacteria → Acidobacteria578Open in IMG/M
3300026551|Ga0209648_10197818All Organisms → cellular organisms → Bacteria → Acidobacteria1538Open in IMG/M
3300027886|Ga0209486_10143936All Organisms → cellular organisms → Bacteria → Acidobacteria1307Open in IMG/M
3300027907|Ga0207428_10007945All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia9636Open in IMG/M
3300028381|Ga0268264_11984483All Organisms → cellular organisms → Bacteria → Acidobacteria591Open in IMG/M
3300030619|Ga0268386_10062140All Organisms → cellular organisms → Bacteria → Acidobacteria2930Open in IMG/M
3300031548|Ga0307408_102039491All Organisms → cellular organisms → Bacteria → Acidobacteria552Open in IMG/M
3300031731|Ga0307405_10418884All Organisms → cellular organisms → Bacteria → Acidobacteria1053Open in IMG/M
3300031824|Ga0307413_10176614All Organisms → cellular organisms → Bacteria → Acidobacteria1518Open in IMG/M
3300031858|Ga0310892_10008215All Organisms → cellular organisms → Bacteria → Acidobacteria4128Open in IMG/M
3300032075|Ga0310890_11840600All Organisms → cellular organisms → Bacteria → Acidobacteria504Open in IMG/M
3300032159|Ga0268251_10266362All Organisms → cellular organisms → Bacteria → Acidobacteria699Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere9.91%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil5.41%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere5.41%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere5.41%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil4.50%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere4.50%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere4.50%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere4.50%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil3.60%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere3.60%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere3.60%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere3.60%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil2.70%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil2.70%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere2.70%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands1.80%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil1.80%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil1.80%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere1.80%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.80%
Switchgrass RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere1.80%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.80%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.80%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.80%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere1.80%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere1.80%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.90%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.90%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil0.90%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil0.90%
Sugarcane Root And Bulk SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil0.90%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.90%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere0.90%
Prmafrost SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil0.90%
SoilEnvironmental → Terrestrial → Soil → Loam → Unclassified → Soil0.90%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.90%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere0.90%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere0.90%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.90%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.90%
AgaveHost-Associated → Plants → Phylloplane → Unclassified → Unclassified → Agave0.90%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000890Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
3300000891Soil microbial communities from Great Prairies - Wisconsin, Continuous corn soilEnvironmentalOpen in IMG/M
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300002100Soil microbial communities from Manhattan, Kansas, USA - Sample 500um MDAEnvironmentalOpen in IMG/M
3300002120Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_2EnvironmentalOpen in IMG/M
3300003319Sugarcane bulk soil Sample L2EnvironmentalOpen in IMG/M
3300003996Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailB_D2EnvironmentalOpen in IMG/M
3300004013Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailA_D2EnvironmentalOpen in IMG/M
3300004114Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5EnvironmentalOpen in IMG/M
3300004157Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2EnvironmentalOpen in IMG/M
3300004463Combined assembly of Arabidopsis thaliana microbial communitiesHost-AssociatedOpen in IMG/M
3300004480Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4EnvironmentalOpen in IMG/M
3300004643Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3EnvironmentalOpen in IMG/M
3300005293Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1Host-AssociatedOpen in IMG/M
3300005328Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaGHost-AssociatedOpen in IMG/M
3300005339Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaGHost-AssociatedOpen in IMG/M
3300005344Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaGHost-AssociatedOpen in IMG/M
3300005364Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaGHost-AssociatedOpen in IMG/M
3300005366Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaGHost-AssociatedOpen in IMG/M
3300005406Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaGEnvironmentalOpen in IMG/M
3300005441Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaGEnvironmentalOpen in IMG/M
3300005468Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaGEnvironmentalOpen in IMG/M
3300005530Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaGEnvironmentalOpen in IMG/M
3300005536Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaGEnvironmentalOpen in IMG/M
3300005539Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2Host-AssociatedOpen in IMG/M
3300005545Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaGEnvironmentalOpen in IMG/M
3300005546Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaGEnvironmentalOpen in IMG/M
3300005548Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaGHost-AssociatedOpen in IMG/M
3300005549Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaGEnvironmentalOpen in IMG/M
3300005577Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2Host-AssociatedOpen in IMG/M
3300005616Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2Host-AssociatedOpen in IMG/M
3300005617Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2Host-AssociatedOpen in IMG/M
3300005840Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2Host-AssociatedOpen in IMG/M
3300005993Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-046EnvironmentalOpen in IMG/M
3300006237Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2)Host-AssociatedOpen in IMG/M
3300006880Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3Host-AssociatedOpen in IMG/M
3300006894Agricultural soil microbial communities from Utah to study Nitrogen management - NC ControlEnvironmentalOpen in IMG/M
3300006954Agricultural soil microbial communities from Georgia to study Nitrogen management - GA ControlEnvironmentalOpen in IMG/M
3300009098Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaGHost-AssociatedOpen in IMG/M
3300009101Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaGHost-AssociatedOpen in IMG/M
3300009156Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300009174Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaGHost-AssociatedOpen in IMG/M
3300009176Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaGHost-AssociatedOpen in IMG/M
3300009177Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaGHost-AssociatedOpen in IMG/M
3300009553Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaGHost-AssociatedOpen in IMG/M
3300010038Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106EnvironmentalOpen in IMG/M
3300010043Tropical forest soil microbial communities from Panama - MetaG Plot_26EnvironmentalOpen in IMG/M
3300010375Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaGHost-AssociatedOpen in IMG/M
3300010397Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4EnvironmentalOpen in IMG/M
3300010400Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2EnvironmentalOpen in IMG/M
3300010401Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1EnvironmentalOpen in IMG/M
3300010403Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3EnvironmentalOpen in IMG/M
3300012925Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012930Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012960Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MGEnvironmentalOpen in IMG/M
3300013297Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaGHost-AssociatedOpen in IMG/M
3300013306Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaGHost-AssociatedOpen in IMG/M
3300013307Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaGHost-AssociatedOpen in IMG/M
3300013308Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaGHost-AssociatedOpen in IMG/M
3300014325Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaGHost-AssociatedOpen in IMG/M
3300014326Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaGHost-AssociatedOpen in IMG/M
3300014745Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaGHost-AssociatedOpen in IMG/M
3300015262Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaGHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300017792Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaGHost-AssociatedOpen in IMG/M
3300018061Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1EnvironmentalOpen in IMG/M
3300018422Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 TEnvironmentalOpen in IMG/M
3300018466Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 TEnvironmentalOpen in IMG/M
3300025735Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025912Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025917Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025921Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025922Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025930Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes)EnvironmentalOpen in IMG/M
3300025932Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025933Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025961Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026023Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026035Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026041Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026075Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026089Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026095Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026116Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026551Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes)EnvironmentalOpen in IMG/M
3300027886Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost (SPAdes)EnvironmentalOpen in IMG/M
3300027907Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes)Host-AssociatedOpen in IMG/M
3300028380Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028381Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300030619Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT150D86 (Novaseq)EnvironmentalOpen in IMG/M
3300031548Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3Host-AssociatedOpen in IMG/M
3300031731Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1Host-AssociatedOpen in IMG/M
3300031824Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2Host-AssociatedOpen in IMG/M
3300031858Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2EnvironmentalOpen in IMG/M
3300032075Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3EnvironmentalOpen in IMG/M
3300032159Agave microbial communities from Guanajuato, Mexico - As.Ma.e (v2)Host-AssociatedOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI11643J12802_1167437313300000890SoilNSVIWNCEVQVKTGDLATEKPYLVSNRKDKNVKCLAVERSLPTCEK*
JGI10214J12806_1121626113300000891SoilSVVNWNCEVQVKPGDLATEKPYLLSNRKDRLVKCVAVEKPLPPCPEPVK*
JGI10216J12902_11484108213300000956SoilNLIPTELGQSFVTWNCEVQVKPGDLATEKPYLVSNRKDKNVKCVGIEKPKPICNAD*
JGI24809J26612_103965013300002100SoilVKAGDLATERPYLVSNRNEKSVKCLGVAKPKPVCTAD*
C687J26616_1004447513300002120SoilTNLLPTEMTSTFVSWNCEVQIKAGDLGTERPFLVMNRQERNVKCVGVEKPLPVCESGTGQ
soilL2_1000605723300003319Sugarcane Root And Bulk SoilTELAQTIVTWTCEVQVKQGDLATEKPYLISNRKDRLVKCVAVEKPLPACN*
Ga0055467_1027574423300003996Natural And Restored WetlandsLGQTLVTWNCEVQFKTNDLASEKPYQISNRKDRLVKCVGIEKPIPVCNAN*
Ga0055465_1016191013300004013Natural And Restored WetlandsVGQMADSWNCEVQIKAGDIATEKPYLVSNRKDRNVKCVAVESPPPACSQ*
Ga0062593_10005697313300004114SoilGTYVLSNLVPTELGQTVVSWNCEVQVKQGDLATEKPYLVSNRKDRLVKCIGVEKPSPACN
Ga0062590_10064007513300004157SoilSVVWNCEVQVKTGDLATEKPYLISNRKDRNVKCVGVERPLPVCEK*
Ga0062590_10114919123300004157SoilFLSNLLPTELGQTVATWNCEVQIKPDDLASEKPYLISNRNDRLVKCVAVEKPVPPCQ*
Ga0063356_10444638313300004463Arabidopsis Thaliana RhizosphereSWNCEVQVKQGDLATEKPYLVSNRKDRLVKCVGVEKPLPPCN*
Ga0063356_10473176623300004463Arabidopsis Thaliana RhizosphereITNLVPTELGQTLATWTCELQIKADDLASEKPYLISNRKDRLVKCVAIEKPAPACQ*
Ga0062592_10087911913300004480SoilWNCEVQVKAGDLATEKPYMVSNRKDKNVKCVGIEKPMPVCAAD*
Ga0062591_10182631423300004643SoilNLIPTELGQTLVTWNCEVQVKPGDLATEKPYLISNRKDRLVKCVSVEKPKPVCTPN*
Ga0065715_1118227713300005293Miscanthus RhizosphereCEVQVKAGDLATEKPYMVSNRKDKNVKCVGIEKPMPVCAAD*
Ga0070676_1037817133300005328Miscanthus RhizosphereESSSVVWNCEVQVKTGDLATEKPYLVSNRKDRNVKCVGLERPLPVCEK*
Ga0070676_1109738613300005328Miscanthus RhizosphereQTFVTWNCEVQVKPGDLATEKPYMVSNRKDRNVKCLGIEKPKPVCATN*
Ga0070660_10186810023300005339Corn RhizosphereTELDQTLVTWNCEVKVNPGDLATEKPYLVSNRKEKTVKCVGVEKPKPVCTAD*
Ga0070661_10187768613300005344Corn RhizosphereTEIGQSAASWNCEVQIKPGDIATEKPYQVSNRKDKNVKCVAVEKPLPACVK*
Ga0070673_10045876023300005364Switchgrass RhizosphereVVPTEMGQTSVTWNCEVQVKQGDLATEKPYLVSNRKDRLVKCVGVEKPLPACE*
Ga0070659_10081515223300005366Corn RhizosphereYVLTNVVPTELGQTSVTWNCEVQVKQGDLATEKPYLVSNRKDRLVKCVGVEKPLPACE*
Ga0070703_1051966523300005406Corn, Switchgrass And Miscanthus RhizosphereVTWNCEVQVKAGDLATEKPYLVSNRKERNVKCVGVEKPMPVCAAN*
Ga0070700_10003344943300005441Corn, Switchgrass And Miscanthus RhizosphereAEIESSSVVWNCEVQVKTGDLATEKPYLVSNRKDRNVKCVGLERPLPVCEK*
Ga0070707_10109847223300005468Corn, Switchgrass And Miscanthus RhizosphereTELGQTLVTWNCEVQVKAGDLATEKPYLVSNRKERNVKCVGVEKPMPVCAAN*
Ga0070679_10110843123300005530Corn RhizosphereGQTFVTWNCEVLVKPGDLATEKPYMVSNRKDRNVKCLGIEKPKPVCATN*
Ga0070697_10000920573300005536Corn, Switchgrass And Miscanthus RhizospherePTELGQNFVTWNCEVQVKPGDLATEKPYLLSNRKDKNVKCVGIEKPKPVCATD*
Ga0068853_10039177313300005539Corn RhizosphereLIPTELGQTLVTWNCEVQVKAGDLATEKPYLISNRKEKLVKCVSVEKPKPVCTAK*
Ga0070695_10133614713300005545Corn, Switchgrass And Miscanthus RhizosphereVIPTELGQTLVTWNCEVQIKPEDLATEKPYLISNRKDKTVKCVGIVKPKPPCAAD*
Ga0070696_10081226923300005546Corn, Switchgrass And Miscanthus RhizosphereASWNCEVQIKPGDIATEKPYQVSNRKDKNVKCVAVEKPLPACVK*
Ga0070665_10251706213300005548Switchgrass RhizosphereVTWNCEVQVKPGDLATEKPYLVSNRKDKNVKCVAIEKPKPACV*
Ga0070704_10053224423300005549Corn, Switchgrass And Miscanthus RhizosphereVPTELGTNSVVWNCEVQVKTGDLATEKPYLVSNRKDKNVKCLAVERRLPTCEK*
Ga0070704_10132446913300005549Corn, Switchgrass And Miscanthus RhizosphereGTYLLSNLVPTELGQTLATWNCEVQIKNEDLASEKPYLISNRKDRLVKCVAVEKPVPPCQ
Ga0068857_10185701323300005577Corn RhizosphereGTYVLSNLIPTELGQTLVTWNCEVQVKPGDLATEKPYLVSNRKERLVKCVGVEKPKPVCNAD*
Ga0068852_10105177413300005616Corn RhizosphereIQSNSVVWNCEVQVKTGDLATEKPYLISNTKDRNVKCVGLERPLPVCEKQ*
Ga0068859_10045861613300005617Switchgrass RhizospherePTELGQTLVTWNCEVQVKAGDLATEKPYLVSNRKEKNVKCVGVEKPKPVCAAD*
Ga0068859_10229304923300005617Switchgrass RhizosphereVLTNLLATEIAGNATTWNCEVQIKSGDIATEKPYMVSNSKDRNVKCVGVEKPLPACSK*
Ga0068870_1032840323300005840Miscanthus RhizosphereFVTWNCEVQVKPGDLATEKPYLVSNRKDKNVKCVAVEKPKPVCTD*
Ga0080027_1016695223300005993Prmafrost SoilVLTNIVPAEFGATTELWNCDVSVKAGDLATEKPFLISNRIDRNVKCVAVERPVPACGPVP
Ga0097621_10091730423300006237Miscanthus RhizosphereWNCEVQIKPGDIATEKPYQVSNRKDKNVKCVAVEKPLPACVK*
Ga0075429_10019250333300006880Populus RhizosphereSNLVPTELGQSLATWNCEVQVKAGDLATEKPYLVSNRKEKNVKCVAVEKPMPGCATD*
Ga0075429_10146283523300006880Populus RhizosphereLVPTELGQSLATWNCEVQVKAGDLATEKPYLVSNRKEKNVKCIAVEKPMPSCAAD*
Ga0079215_1006167833300006894Agricultural SoilPTELGPTAVYWNCEVQVKQGDLATEKPYLVSNRKDRLVKCVGVEKPLPACE*
Ga0079219_1150373223300006954Agricultural SoilWNCEVQVKAGDIATEKPYLVSNRKDKLVKCVGVEKPKPVCAAD*
Ga0105245_1110292113300009098Miscanthus RhizosphereWNCEVQVKADERAFEKPYLLSNRKEKNVKCVAVEKPLPVCAVTTK*
Ga0105247_1048480523300009101Switchgrass RhizosphereSEIGQTLVTWNCEVQIKYVATETPYTISNRKDKNVKCVGVEKPKPACD*
Ga0111538_1241237023300009156Populus RhizosphereATEIGQSAANWNCEVQIKPGDIATEKPYQVSNRKDKNVKCVAVEKPLPACIK*
Ga0075423_1049271023300009162Populus RhizosphereEIGNTGVIWNCPVQVKPGDLATEKPYLVSNRADKNVKCVGVEKPLPQCEAKPAEQR*
Ga0075423_1194341313300009162Populus RhizospherePGTYVLTNLIPAELGQTLVTWNCEVQVKAGDLATEKPYLVSNRKEKNVKCVGIEKPIPVCAAD*
Ga0105241_1263305013300009174Corn RhizosphereLPVEIQTNSVLWNCEVQVKTGDLATEKPYLISNTKDRNVKCVGLERPLPVCEK*
Ga0105242_1282244823300009176Miscanthus RhizosphereMSNVIPTELGQTLVTWNCEVQVKAGDLATEKPYLVSNRKDKNVKCVAVEKPMPVCNR*
Ga0105248_1252651823300009177Switchgrass RhizosphereWNCEVQVKPGDLATEKPYLVSNRKDKNVKCVGVEKPMPVCNRGSNG*
Ga0105249_1202602223300009553Switchgrass RhizosphereVLSNVIPTELGQTLVTWNCEVQVNPGDLATEKPYLVSNRKDKNVKCVAVEKPKPVCAAD*
Ga0126315_1084072323300010038Serpentine SoilLVKPGDLATEKPYLVSNRKEKNVKCVGVEKPKPACAAD*
Ga0126380_1084676723300010043Tropical Forest SoilSVTFNCEVTVKPGDIATEKPYLVSNNKNERNVKCEGVEKPLPACEATSIPR*
Ga0105239_1188955313300010375Corn RhizosphereTLVMWNCEVQIKPEDLATEKPYMISNRKDKAAKCVGVEKPMPVCNRG*
Ga0134124_1093897233300010397Terrestrial SoilGQMLAMWNCEVQVKPGDLATEKPYLVSNRKEKNVKCVSVEKPMPVCAAD*
Ga0134124_1219272213300010397Terrestrial SoilPTELGQMLVTWNCEVQVKSGDLATEKPYLVSNRKERLVKCVGVEKPKPVCTAD*
Ga0134122_1034041013300010400Terrestrial SoilNSVLWNCEVQVKTGDLATEKPYLISNTKDRNVKCVGLERPLPVCEK*
Ga0134121_1096559123300010401Terrestrial SoilLPVEIQTNSVLWNCEVQVKTGDLATEKPYLISNTKDRNIKCVGLERPLPVCEK*
Ga0134123_1036897723300010403Terrestrial SoilLGQTFVTWNCEVQVKPGDLATEKPYLVSNRKDRNVKCVGVEKPKPVCATD*
Ga0134123_1254549923300010403Terrestrial SoilTELAQTLVTWSCEVQVKAGDLATEKPYLVSNRKEKNVKCVGVEKPKPVCAAN*
Ga0137419_1143483823300012925Vadose Zone SoilEVNVKAGDLATEKPFLISNRKDKNVKCVAVEKPLPACASQVTK*
Ga0137407_1032748823300012930Vadose Zone SoilKAGDLATEKPFLVSNKPDKNVKCVGVEKPLPVCEATASSSQ*
Ga0164301_1171656623300012960SoilVQVKPGDLATEKAYMVSNRKDKNVKCVGVEKPKPVCATD*
Ga0157378_1036922813300013297Miscanthus RhizosphereWNCEVQVKPGDLATEKPYLLSNRKDRLVKCVAVEKPLPPCPEPVK*
Ga0163162_1018694013300013306Switchgrass RhizosphereATWNCEVQVKPGDLATEKPYLVSNRKEKNVKCVAIEKPMPVCAAD*
Ga0157372_1084466123300013307Corn RhizosphereNLIPTQLGQTLATWNCEVQVKTGDLATEKPYLVSNRKEKNVKCVAIEKPMPASPAN*
Ga0157372_1268172123300013307Corn RhizosphereNLIPTELGQTLVTWNCEVQVKPGDLATEKPYLVSNRKDKNVKCVGVEKPKPTCNRGSDGL
Ga0157375_1040530913300013308Miscanthus RhizosphereIESSSVVWNCEVQVKTGDLATEKPYLASNRKDRNVKCVGLERPLPVCEK*
Ga0163163_1028914113300014325Switchgrass RhizosphereEIGQSAASWNCEVQIKPGEIATEKPYQVSNRKDKNVKCVAVEKPLPACVK*
Ga0163163_1188331013300014325Switchgrass RhizosphereVRPGDLATEKPYLVSNRKDRNECVGVEKSKPVCATN*
Ga0157380_1129349223300014326Switchgrass RhizosphereVQVKPGDLATEKPYMVSNRKDRNVKCVGVEKPKPVCATD*
Ga0157377_1155052513300014745Miscanthus RhizosphereLVTWNCEVQIKPEDLATEKPYLILNRADKGVKCVGIEKPKPACAADERK*
Ga0157377_1166396523300014745Miscanthus RhizosphereYVLSNLIPTELGQTFVTWNCEVQVKAGDLATEKPYLVSNRKDRTVKCVGVEKPKPVCNAD
Ga0182007_1036669913300015262RhizosphereTWNCEVQVKPGDIATEKPYLVSNRKDKLVKCVGIEKPKPVCAAD*
Ga0132255_10622300423300015374Arabidopsis RhizosphereVTWNCEVQVKAGDLATEKPYLVSNRKDKLVKCVGVEKPMPVCAAD*
Ga0163161_1138138113300017792Switchgrass RhizosphereTLVTWNCEVQVKAGDLATEKPYLVSNRKDKNVKCLGIEKPKPLCAAD
Ga0184619_1004673613300018061Groundwater SedimentNLVGMELGSSIVTWSCEVQVKAGDLATEKPYLVSNRKDKNVKCVGVEKPLPVCH
Ga0190265_1253958423300018422SoilPAELGQTLATWNCEVQVKPGDIATEKPYLVSNRKDKNVKCVAVEKPMPACGGTD
Ga0190268_1234433913300018466SoilSLIPTELGQTLATWNCEVQVKAGDLATEKPYLVSNRKEKNVKCVAVEKPMPACAAN
Ga0207713_110535623300025735Switchgrass RhizosphereGQTLVTWNCEVQIKPEDLATEKPYLISNRKDKTVKCVGIEKPKPTCAAD
Ga0207707_1029356733300025912Corn RhizosphereSIVPTELGTNSVVWNCEVQVKTGDLATEKPYLVSNRKDKNVKCLAVERRLPTCEK
Ga0207660_1155633213300025917Corn RhizosphereIVPTELGTNSVVWNCEVQVKTGDLATEKPYLVSNRKDKNVKCLAVERRLPTCEK
Ga0207652_1074249613300025921Corn RhizosphereLTNLIPTELGQSFVTWNCEVQVKPGDLATEKPYLVSNRKDKNVKCVGIEKPKPVCATD
Ga0207646_1090662023300025922Corn, Switchgrass And Miscanthus RhizosphereVLSNLIPTELGQTLVTWNCEVQVKAGDLATEKPYLVSNRKERNVKCVGVEKPMPVCAAN
Ga0207701_1019863733300025930Corn, Switchgrass And Miscanthus RhizosphereATEIGQSAASWNCEVQIKPGDIATEKPYQVSNRKDKNVKCVAVEKPLPACVK
Ga0207690_1000593313300025932Corn RhizosphereVWNCEVQVKTGDLATEKPYLASNRKDKNVKCLAVERRLPTCEK
Ga0207706_1049194413300025933Corn RhizosphereLSSIVPTELGTNSVVWNCEVQVKTGDLATEKPYLVSNRKDKNVKCLAVERRLPTCEK
Ga0207712_1191878013300025961Switchgrass RhizosphereVIPTELGQTLVTWNCEVQVKPGDLATEKPYLVSNRKDKNVKCVAVEKPKPVCAAD
Ga0207677_1198168823300026023Miscanthus RhizosphereAASWNCEVQIKPGDIATEKPYQVSNRKDKNVKCVAVEKPLPACVK
Ga0207703_1108608123300026035Switchgrass RhizosphereVQVKSGDLGTEKPYLVSNRKDRNVKCVGVEKPKPVCATD
Ga0207639_1200326213300026041Corn RhizosphereVIPTELQQTLVTWNCEVQVKPGDLATEKPYLVSNRKDRLVKCVGVEKPKPVCAAE
Ga0207708_1004792643300026075Corn, Switchgrass And Miscanthus RhizosphereAEIESSSVVWNCEVQVKTGDLATEKPYLVSNRKDRNVKCVGLERPLPVCEK
Ga0207708_1153412113300026075Corn, Switchgrass And Miscanthus RhizosphereYVLTNLIPTELGQTLVTWNCEVQVKAGDLATEKPYLVSNRKEKNVKCLGIEKPKPLCAAD
Ga0207648_1045058613300026089Miscanthus RhizosphereTWNCEVQIKPEDLATEKPYLISNRKDKTVKCVGIEKPKPICAAD
Ga0207648_1061137513300026089Miscanthus RhizosphereSAASWNCEVQIKPGDIATEKPYQASNRKDKNVKCVAVEKPLPACVK
Ga0207676_1155966613300026095Switchgrass RhizosphereVVSWNCEVQVKQGDLATEKPYLVSNRKDRLVKCVGVEKPIPSCN
Ga0207674_1181010413300026116Corn RhizospherePTELGQTLVTWSCEVQVKPGDLATEKPYLVSNRKEKNVKCVGVEKPMPVCATN
Ga0209648_1019781823300026551Grasslands SoilYVLSNLLPTEIGASTVSWTCEVQIKQGDLATERPYLVSNRKDKNVRCVGVEKPLPVCEAPKSAGS
Ga0209486_1014393613300027886Agricultural SoilGQTVVAWNCEVQVKQGDLATEKPYLVSNKKDRLVKCVGVEKPIPACE
Ga0207428_1000794593300027907Populus RhizosphereVLSNLIPTELGQTFVTWNCEVQVKPGDLATEKPYLVSNRKDRNVKCVGVEKPKPVCNAD
Ga0268265_1105760823300028380Switchgrass RhizosphereGTYIVSSLLPAEIESSSVVWNCEVQVKTGDLATEKPYLVSNRKDRNVKCVGLERPLPVCE
Ga0268264_1198448313300028381Switchgrass RhizosphereLVTWNCEVQIKPEDLATEKPYLISNRKDKTVKCVGIEKPKPICPAD
Ga0268386_1006214013300030619SoilLGQTLATWNCEVQVKVGDLATEKPYLVSNRKDRNVKCVAVEKPMPVCATD
Ga0307408_10203949123300031548RhizosphereSCEVQVKPGDLATEKPYLVSNRKEKNVKCVGVEKPKPVCAAN
Ga0307405_1041888413300031731RhizosphereVISNLIPAELGQSLATWTCELQIKNDDLAAEKPYLISNRKDRLVKCIAVEKPMPACQ
Ga0307413_1017661433300031824RhizosphereELGQTLVTWNCEVQVRPGDLATEKPYLVSNRKERLVKCVGIEKPKPVCTAN
Ga0310892_1000821513300031858SoilVNWNCEVQVKPGDLATEKPYLLSNRKDRLVKCVAVEKPLPPCPEPVK
Ga0310890_1184060013300032075SoilVVNWNCEVQVKPGDLATEKPYLLSNRKDRLVKCVAVEKPLPPCPEPVK
Ga0268251_1026636213300032159AgaveLIPTELGQNLVTWNCEVQVKPGDLATEKPYLVSNRKERNVKCVGIEKPMPVCATD

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.