NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F086871

Metagenome / Metatranscriptome Family F086871

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F086871
Family Type Metagenome / Metatranscriptome
Number of Sequences 110
Average Sequence Length 39 residues
Representative Sequence MDLNLTAEELAFRDELRAWLASNVPKDWNEWREKPLEE
Number of Associated Samples 94
Number of Associated Scaffolds 110

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 100.00 %
% of genes near scaffold ends (potentially truncated) 98.18 %
% of genes from short scaffolds (< 2000 bps) 87.27 %
Associated GOLD sequencing projects 89
AlphaFold2 3D model prediction Yes
3D model pTM-score0.41

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (71.818 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(25.455 % of family members)
Environment Ontology (ENVO) Unclassified
(28.182 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(57.273 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 33.33%    β-sheet: 0.00%    Coil/Unstructured: 66.67%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.41
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 110 Family Scaffolds
PF13193AMP-binding_C 66.36
PF13561adh_short_C2 5.45
PF13673Acetyltransf_10 3.64
PF13620CarboxypepD_reg 1.82
PF00593TonB_dep_Rec 1.82
PF00106adh_short 0.91
PF03454MoeA_C 0.91
PF13432TPR_16 0.91
PF00230MIP 0.91
PF00583Acetyltransf_1 0.91
PF13474SnoaL_3 0.91
PF00378ECH_1 0.91
PF00107ADH_zinc_N 0.91
PF00126HTH_1 0.91
PF14329DUF4386 0.91

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 110 Family Scaffolds
COG0303Molybdopterin Mo-transferase (molybdopterin biosynthesis)Coenzyme transport and metabolism [H] 0.91
COG0580Glycerol uptake facilitator or related aquaporin (Major Intrinsic protein Family)Carbohydrate transport and metabolism [G] 0.91


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms71.82 %
UnclassifiedrootN/A28.18 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300001166|JGI12694J13545_1009162All Organisms → cellular organisms → Bacteria → Terrabacteria group1117Open in IMG/M
3300001170|JGI12704J13340_1004796All Organisms → cellular organisms → Bacteria → Terrabacteria group1333Open in IMG/M
3300001593|JGI12635J15846_10878856Not Available512Open in IMG/M
3300002245|JGIcombinedJ26739_101510817All Organisms → cellular organisms → Bacteria567Open in IMG/M
3300004080|Ga0062385_10350447All Organisms → cellular organisms → Bacteria865Open in IMG/M
3300004092|Ga0062389_102719819All Organisms → cellular organisms → Bacteria660Open in IMG/M
3300005526|Ga0073909_10188856All Organisms → cellular organisms → Bacteria884Open in IMG/M
3300005537|Ga0070730_10852180All Organisms → cellular organisms → Bacteria573Open in IMG/M
3300005542|Ga0070732_10764275All Organisms → cellular organisms → Bacteria589Open in IMG/M
3300005563|Ga0068855_100315353All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter1729Open in IMG/M
3300005575|Ga0066702_10061041All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2059Open in IMG/M
3300005764|Ga0066903_107339822Not Available570Open in IMG/M
3300006797|Ga0066659_10257099All Organisms → cellular organisms → Bacteria1310Open in IMG/M
3300009088|Ga0099830_10270048Not Available1351Open in IMG/M
3300009088|Ga0099830_11740235Not Available520Open in IMG/M
3300010048|Ga0126373_12786303Not Available546Open in IMG/M
3300010048|Ga0126373_13200191Not Available510Open in IMG/M
3300010339|Ga0074046_10803579Not Available550Open in IMG/M
3300010361|Ga0126378_13423039All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia → Pseudonocardia spinosispora503Open in IMG/M
3300010375|Ga0105239_10287095All Organisms → cellular organisms → Bacteria1853Open in IMG/M
3300010876|Ga0126361_10600555All Organisms → cellular organisms → Bacteria968Open in IMG/M
3300011269|Ga0137392_10392376All Organisms → cellular organisms → Bacteria1152Open in IMG/M
3300011271|Ga0137393_10124311All Organisms → cellular organisms → Bacteria2132Open in IMG/M
3300012189|Ga0137388_11291198Not Available669Open in IMG/M
3300012361|Ga0137360_11283487Not Available633Open in IMG/M
3300012363|Ga0137390_10485370Not Available1210Open in IMG/M
3300015053|Ga0137405_1248081All Organisms → cellular organisms → Bacteria2109Open in IMG/M
3300016294|Ga0182041_11527151All Organisms → cellular organisms → Bacteria615Open in IMG/M
3300016404|Ga0182037_10897203All Organisms → cellular organisms → Bacteria768Open in IMG/M
3300017821|Ga0187812_1041493Not Available1562Open in IMG/M
3300017993|Ga0187823_10197008All Organisms → cellular organisms → Bacteria659Open in IMG/M
3300018007|Ga0187805_10177405All Organisms → cellular organisms → Bacteria971Open in IMG/M
3300018047|Ga0187859_10020272All Organisms → cellular organisms → Bacteria3687Open in IMG/M
3300018062|Ga0187784_11073332All Organisms → cellular organisms → Bacteria639Open in IMG/M
3300018085|Ga0187772_10490878All Organisms → cellular organisms → Bacteria865Open in IMG/M
3300018468|Ga0066662_10939607All Organisms → cellular organisms → Bacteria852Open in IMG/M
3300019789|Ga0137408_1137109All Organisms → cellular organisms → Bacteria1428Open in IMG/M
3300020199|Ga0179592_10287979All Organisms → cellular organisms → Bacteria731Open in IMG/M
3300020579|Ga0210407_11441565Not Available510Open in IMG/M
3300020580|Ga0210403_10307723All Organisms → cellular organisms → Bacteria → Terrabacteria group1298Open in IMG/M
3300020580|Ga0210403_11008895All Organisms → cellular organisms → Bacteria651Open in IMG/M
3300020581|Ga0210399_10545381All Organisms → cellular organisms → Bacteria962Open in IMG/M
3300020581|Ga0210399_10651522All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium868Open in IMG/M
3300021046|Ga0215015_10183544Not Available593Open in IMG/M
3300021088|Ga0210404_10133224All Organisms → cellular organisms → Bacteria → Terrabacteria group1288Open in IMG/M
3300021403|Ga0210397_10079608All Organisms → cellular organisms → Bacteria2168Open in IMG/M
3300021405|Ga0210387_10643498All Organisms → cellular organisms → Bacteria941Open in IMG/M
3300021406|Ga0210386_11274238All Organisms → cellular organisms → Bacteria → Acidobacteria619Open in IMG/M
3300021420|Ga0210394_10603528All Organisms → cellular organisms → Bacteria965Open in IMG/M
3300021420|Ga0210394_10947938All Organisms → cellular organisms → Bacteria747Open in IMG/M
3300021420|Ga0210394_11054991All Organisms → cellular organisms → Bacteria702Open in IMG/M
3300021420|Ga0210394_11477598Not Available575Open in IMG/M
3300021433|Ga0210391_10151502All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1826Open in IMG/M
3300021478|Ga0210402_11160040All Organisms → cellular organisms → Bacteria700Open in IMG/M
3300021478|Ga0210402_11927893Not Available517Open in IMG/M
3300021559|Ga0210409_10103406All Organisms → cellular organisms → Bacteria2627Open in IMG/M
3300021559|Ga0210409_10323639Not Available1387Open in IMG/M
3300022533|Ga0242662_10313141Not Available526Open in IMG/M
3300025612|Ga0208691_1117187All Organisms → cellular organisms → Bacteria600Open in IMG/M
3300025898|Ga0207692_10786788All Organisms → cellular organisms → Bacteria621Open in IMG/M
3300025898|Ga0207692_10887252All Organisms → cellular organisms → Bacteria586Open in IMG/M
3300025905|Ga0207685_10110560All Organisms → cellular organisms → Bacteria1190Open in IMG/M
3300025911|Ga0207654_10656356All Organisms → cellular organisms → Bacteria752Open in IMG/M
3300025912|Ga0207707_10533559All Organisms → cellular organisms → Bacteria998Open in IMG/M
3300025912|Ga0207707_11016010All Organisms → cellular organisms → Bacteria → Acidobacteria680Open in IMG/M
3300025939|Ga0207665_10916798Not Available695Open in IMG/M
3300026356|Ga0257150_1061269All Organisms → cellular organisms → Bacteria564Open in IMG/M
3300026489|Ga0257160_1089092Not Available552Open in IMG/M
3300026499|Ga0257181_1035924All Organisms → cellular organisms → Bacteria791Open in IMG/M
3300026551|Ga0209648_10637777Not Available584Open in IMG/M
3300027034|Ga0209730_1040388Not Available541Open in IMG/M
3300027567|Ga0209115_1005491All Organisms → cellular organisms → Bacteria2570Open in IMG/M
3300027635|Ga0209625_1009244All Organisms → cellular organisms → Bacteria2138Open in IMG/M
3300027643|Ga0209076_1174908Not Available595Open in IMG/M
3300027651|Ga0209217_1042597Not Available1389Open in IMG/M
3300027655|Ga0209388_1032995Not Available1485Open in IMG/M
3300027674|Ga0209118_1035364Not Available1518Open in IMG/M
3300027676|Ga0209333_1186162Not Available551Open in IMG/M
3300027842|Ga0209580_10014509All Organisms → cellular organisms → Bacteria3437Open in IMG/M
3300027857|Ga0209166_10257321All Organisms → cellular organisms → Bacteria926Open in IMG/M
3300027862|Ga0209701_10480844All Organisms → cellular organisms → Bacteria678Open in IMG/M
3300027898|Ga0209067_10194401All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1089Open in IMG/M
3300028775|Ga0302231_10108476All Organisms → cellular organisms → Bacteria1158Open in IMG/M
3300028806|Ga0302221_10444167Not Available565Open in IMG/M
3300029944|Ga0311352_10030497All Organisms → cellular organisms → Bacteria5110Open in IMG/M
3300029951|Ga0311371_10827260All Organisms → cellular organisms → Bacteria1135Open in IMG/M
3300029993|Ga0302304_10126613All Organisms → cellular organisms → Bacteria968Open in IMG/M
3300030503|Ga0311370_10870718All Organisms → cellular organisms → Bacteria1025Open in IMG/M
3300030580|Ga0311355_10729554All Organisms → cellular organisms → Bacteria918Open in IMG/M
3300030580|Ga0311355_11013506All Organisms → cellular organisms → Bacteria745Open in IMG/M
3300031057|Ga0170834_107096014All Organisms → cellular organisms → Bacteria1898Open in IMG/M
3300031708|Ga0310686_101280647All Organisms → cellular organisms → Bacteria752Open in IMG/M
3300031708|Ga0310686_108587986All Organisms → cellular organisms → Bacteria → Acidobacteria632Open in IMG/M
3300031715|Ga0307476_10172974Not Available1559Open in IMG/M
3300031753|Ga0307477_10013619All Organisms → cellular organisms → Bacteria5555Open in IMG/M
3300031753|Ga0307477_10230290All Organisms → cellular organisms → Bacteria → Terrabacteria group1285Open in IMG/M
3300031771|Ga0318546_10763971All Organisms → cellular organisms → Bacteria680Open in IMG/M
3300031793|Ga0318548_10165818All Organisms → cellular organisms → Bacteria → Terrabacteria group1079Open in IMG/M
3300031805|Ga0318497_10055004All Organisms → cellular organisms → Bacteria2060Open in IMG/M
3300031945|Ga0310913_10808125All Organisms → cellular organisms → Bacteria661Open in IMG/M
3300031954|Ga0306926_10025046All Organisms → cellular organisms → Bacteria6934Open in IMG/M
3300032060|Ga0318505_10423270Not Available630Open in IMG/M
3300032261|Ga0306920_100136129All Organisms → cellular organisms → Bacteria3658Open in IMG/M
3300032770|Ga0335085_11025836All Organisms → cellular organisms → Bacteria889Open in IMG/M
3300032783|Ga0335079_10571898All Organisms → cellular organisms → Bacteria → Terrabacteria group1196Open in IMG/M
3300032783|Ga0335079_10819702All Organisms → cellular organisms → Bacteria962Open in IMG/M
3300032783|Ga0335079_11232971All Organisms → cellular organisms → Bacteria750Open in IMG/M
3300032805|Ga0335078_12642202Not Available513Open in IMG/M
3300032828|Ga0335080_12098856Not Available545Open in IMG/M
3300033289|Ga0310914_10887966All Organisms → cellular organisms → Bacteria791Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil25.45%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil11.82%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil9.09%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa7.27%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil5.45%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil4.55%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil3.64%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere3.64%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment2.73%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil2.73%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil2.73%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil2.73%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil1.82%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil1.82%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil1.82%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland1.82%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere1.82%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.82%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland0.91%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland0.91%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds0.91%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil0.91%
Bog Forest SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil0.91%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.91%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.91%
Boreal Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil0.91%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300001166Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_O2EnvironmentalOpen in IMG/M
3300001170Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_O2EnvironmentalOpen in IMG/M
3300001593Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2EnvironmentalOpen in IMG/M
3300002245Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027)EnvironmentalOpen in IMG/M
3300004080Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3EnvironmentalOpen in IMG/M
3300004092Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3EnvironmentalOpen in IMG/M
3300005526Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1EnvironmentalOpen in IMG/M
3300005537Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1EnvironmentalOpen in IMG/M
3300005542Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1EnvironmentalOpen in IMG/M
3300005563Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2Host-AssociatedOpen in IMG/M
3300005575Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151EnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300006797Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108EnvironmentalOpen in IMG/M
3300009088Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaGEnvironmentalOpen in IMG/M
3300010048Tropical forest soil microbial communities from Panama - MetaG Plot_11EnvironmentalOpen in IMG/M
3300010339Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3EnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010375Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaGHost-AssociatedOpen in IMG/M
3300010876Boreal forest soil eukaryotic communities from Alaska, USA - W5-5 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300011269Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaGEnvironmentalOpen in IMG/M
3300011271Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaGEnvironmentalOpen in IMG/M
3300012189Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaGEnvironmentalOpen in IMG/M
3300012361Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaGEnvironmentalOpen in IMG/M
3300012363Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaGEnvironmentalOpen in IMG/M
3300015053Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300016294Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178EnvironmentalOpen in IMG/M
3300016404Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082EnvironmentalOpen in IMG/M
3300017821Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_2EnvironmentalOpen in IMG/M
3300017993Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_3EnvironmentalOpen in IMG/M
3300018007Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5EnvironmentalOpen in IMG/M
3300018047Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10EnvironmentalOpen in IMG/M
3300018062Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018085Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018468Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111EnvironmentalOpen in IMG/M
3300019789Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300020199Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300020579Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-MEnvironmentalOpen in IMG/M
3300020580Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-MEnvironmentalOpen in IMG/M
3300020581Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-MEnvironmentalOpen in IMG/M
3300021046Soil microbial communities from Shale Hills CZO, Pennsylvania, United States - 90cm depthEnvironmentalOpen in IMG/M
3300021088Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-MEnvironmentalOpen in IMG/M
3300021403Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-OEnvironmentalOpen in IMG/M
3300021405Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-OEnvironmentalOpen in IMG/M
3300021406Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-OEnvironmentalOpen in IMG/M
3300021420Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-MEnvironmentalOpen in IMG/M
3300021433Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-OEnvironmentalOpen in IMG/M
3300021478Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-MEnvironmentalOpen in IMG/M
3300021559Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-MEnvironmentalOpen in IMG/M
3300022533Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-7-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300025612Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10 (SPAdes)EnvironmentalOpen in IMG/M
3300025898Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025905Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025911Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025912Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025939Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026356Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-13-AEnvironmentalOpen in IMG/M
3300026489Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-11-AEnvironmentalOpen in IMG/M
3300026499Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-06-BEnvironmentalOpen in IMG/M
3300026551Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes)EnvironmentalOpen in IMG/M
3300027034Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_RefH0_M2 (SPAdes)EnvironmentalOpen in IMG/M
3300027567Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O2 (SPAdes)EnvironmentalOpen in IMG/M
3300027635Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_M2 (SPAdes)EnvironmentalOpen in IMG/M
3300027643Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 (SPAdes)EnvironmentalOpen in IMG/M
3300027651Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M2 (SPAdes)EnvironmentalOpen in IMG/M
3300027655Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 (SPAdes)EnvironmentalOpen in IMG/M
3300027674Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300027676Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O3 (SPAdes)EnvironmentalOpen in IMG/M
3300027842Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027857Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027862Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027898Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 (SPAdes)EnvironmentalOpen in IMG/M
3300028775Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N2_2EnvironmentalOpen in IMG/M
3300028806Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E2_1EnvironmentalOpen in IMG/M
3300029944II_Palsa_E1 coassemblyEnvironmentalOpen in IMG/M
3300029951III_Palsa_N1 coassemblyEnvironmentalOpen in IMG/M
3300029993Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E2_2EnvironmentalOpen in IMG/M
3300030503III_Palsa_E3 coassemblyEnvironmentalOpen in IMG/M
3300030580II_Palsa_N1 coassemblyEnvironmentalOpen in IMG/M
3300031057Oak Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031708FICUS49499 Metagenome Czech Republic combined assemblyEnvironmentalOpen in IMG/M
3300031715Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05EnvironmentalOpen in IMG/M
3300031753Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515EnvironmentalOpen in IMG/M
3300031771Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19EnvironmentalOpen in IMG/M
3300031793Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21EnvironmentalOpen in IMG/M
3300031805Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23EnvironmentalOpen in IMG/M
3300031945Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082EnvironmentalOpen in IMG/M
3300031954Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2)EnvironmentalOpen in IMG/M
3300032060Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M
3300032770Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5EnvironmentalOpen in IMG/M
3300032783Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3EnvironmentalOpen in IMG/M
3300032805Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2EnvironmentalOpen in IMG/M
3300032828Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4EnvironmentalOpen in IMG/M
3300033289Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI12694J13545_100916213300001166Forest SoilMDLNLTSEEMQFRDELRSWLAAHVPSDWAERREESLESRFE
JGI12704J13340_100479613300001170Forest SoilMDLNLTAEELTFRDELRAWLASNVPKDWSDWREKPMEESFP
JGI12635J15846_1087885613300001593Forest SoilMDLNLTADELQFRDELRSWLTANLPKDWDEWREKPIEVSFPYL
JGIcombinedJ26739_10151081713300002245Forest SoilMDLKLTPEESSFRDELRAWLATNAPKDWAEWREKPLEE
Ga0062385_1035044713300004080Bog Forest SoilMDLRLTAEESAFRDELRAWLAINVPRDWSEWREKPIEESYPYLRA
Ga0062389_10271981923300004092Bog Forest SoilMDLNLSTDEQTFQDELRSWLETNVPREWEHAREQSLDVRFEFHR
Ga0073909_1018885613300005526Surface SoilMDLNLSPEEIKFRDELRTWLAANAPKDWDERREESMESRFEYLKRWQR
Ga0070730_1085218013300005537Surface SoilMDLNLSPEEIKFRDELRNWLSANAPKDWDERREESM
Ga0070732_1076427513300005542Surface SoilMDLKLSLEELQFRDELRAWLRANVPRDWGEWREKPIE
Ga0068855_10031535333300005563Corn RhizosphereMDLNLSPDEIKFRDELRTWLAANAPTDWDERREES
Ga0066702_1006104113300005575SoilMDLSLSPDEIKFRDVLRTWLAGNAPTDWDERREESMESRFEYLKRWQ
Ga0066903_10733982233300005764Tropical Forest SoilMDLNLSADELKFRDELRAWLAANVPKDWDEYRDESLEARF
Ga0066659_1025709913300006797SoilMDLKLTAEELKFRDELRAWLKSNVPKDWDEWREETLEARF
Ga0099830_1027004813300009088Vadose Zone SoilMDLNLTTEELSFRDELRAWLVSNVPKDWNEWREKP
Ga0099830_1174023513300009088Vadose Zone SoilMDLNLTLEEKQFRDELRIWLEANVPKDWSEWREKPIEESFTYL
Ga0126373_1278630313300010048Tropical Forest SoilMDLNLTREEVAFRDAFRSWLASNVPNDWSRWREKPLEESFSYL
Ga0126373_1320019123300010048Tropical Forest SoilMDLNLTREEVAFRDEFRSWLASNVPNDWSRWREKPLE
Ga0074046_1080357923300010339Bog Forest SoilMDLNLSSEERQFRDEFRGWLEANVPKDWPEWREKPL
Ga0126378_1342303913300010361Tropical Forest SoilMDLNLSADELKFRDELRAWLAANVPKDWNEHREESLEAR
Ga0105239_1028709533300010375Corn RhizosphereMDLNLSPDEIKFRDELRTWLSANAPTDWDERREESMESRFEYL
Ga0126361_1060055513300010876Boreal Forest SoilMDLKLTPEESSFRDELRSWLAANAPKDWAEWREKPLEES
Ga0137392_1039237623300011269Vadose Zone SoilMNLNLSPEELQFRDELREWLRANVPRDWSEWREKPIEESFPYLRAW
Ga0137393_1012431113300011271Vadose Zone SoilMDLNLTTEELSFRDELRAWLVSNVPKDWNEWREKPIEE
Ga0137388_1129119823300012189Vadose Zone SoilMDLNLSTEELKFRDELRAWLTANVPRDWDERREESLEVRFDYLK
Ga0137360_1128348723300012361Vadose Zone SoilMNLNLSPEELQFRDELRKWLRANVPRDWSEWREKPIEESF
Ga0137390_1048537023300012363Vadose Zone SoilMDLNLTKEEIAFRDELRAWLKASVPKDWDERRESPM
Ga0137405_124808113300015053Vadose Zone SoilMDLNLTTEELSFRDELRAWLVSNVPKDWNEWRGVA*
Ga0182041_1152715123300016294SoilMDLNLTPDEAAFRDELRLWLAANVPTDGNTWREKSLEESFP
Ga0182037_1089720313300016404SoilMDLNLNNEEKQFRDELRSWLEANAPKDWAEWRERPL
Ga0187812_104149323300017821Freshwater SedimentVDLNLTPGERQFRDDLRAWLAVHVPKDWNEWREKPIEVSF
Ga0187823_1019700813300017993Freshwater SedimentMDLNLNAEERQFRDELRAWLEANTPKDWSDWREKPLEESF
Ga0187805_1017740523300018007Freshwater SedimentVDLNLNAEEKQFRDELRAWLSANVPKDWAEWREKPLE
Ga0187859_1002027213300018047PeatlandMDLNLTPEELTFRDELRAWLASNVPKDWKEWREKPMEESF
Ga0187784_1107333223300018062Tropical PeatlandMDLNLSAEERSFRDEFRTWLEANVPRDWPEWREKPLE
Ga0187772_1049087823300018085Tropical PeatlandMDLNLNAEERQFRDELRAWLEMHVPKDWSEWREKPLEESFPYLR
Ga0066662_1093960723300018468Grasslands SoilMDLNLTAGELKFRDELRAWLATNVPKDWEEWREESLEAR
Ga0137408_113710933300019789Vadose Zone SoilMDLNLSPDEIKFRDELRSWLSANAPTDWDERREESMESRFEYL
Ga0179592_1028797913300020199Vadose Zone SoilMDLNLTAGESAFREELRAWLAANAPKDWNEWREKPLE
Ga0210407_1144156513300020579SoilMDLKLTPEESSFRDELRAWLATNAPKDWAEWREKPLE
Ga0210403_1030772323300020580SoilMDLKLTPEESSFRDELRAWLATNAPKDWAEWREKPL
Ga0210403_1100889513300020580SoilMDLNLTADEKLFRDELRSWLALNAPKDWPAWQNKPLEE
Ga0210399_1054538113300020581SoilMDLKLTAEELAFRDELRAWLASNIPKDWEEWREKPIEES
Ga0210399_1065152223300020581SoilMDLNLTADESAFRDELRAWLASHVPKDWDAWREKPMEESF
Ga0215015_1018354413300021046SoilMDLNLSVEELRFRDELRAWLLANAPRDWSEWPVSY
Ga0210404_1013322423300021088SoilMDLNLTAEELAFRDELRGWLAANAPKDWNEWREKPLEES
Ga0210397_1007960813300021403SoilMDLNLTADELQFRDELRSWLASNVPKDWNEWREKP
Ga0210387_1064349823300021405SoilMDLNLTADEKVFRDELRSWLAANAPKDWPVWQNKP
Ga0210386_1127423823300021406SoilMDLNLTAEELAFRDELRSWLASHVPKDWDEWREKHM
Ga0210394_1060352813300021420SoilMDLNLTAEELAFRDELRSWLASNLPIDWEEWREKPIEESFP
Ga0210394_1094793823300021420SoilMDLNLTSEEMQFRDELRSWLTANVPTDWAERREESLE
Ga0210394_1105499123300021420SoilMDLNLTPDELQFRDELRSWLATNVPKDWNEWREKPI
Ga0210394_1147759823300021420SoilMDLNLNTEEKQFRDELRAWLDANVPKDWAQWREKPLEEVFPYH
Ga0210391_1015150213300021433SoilMDLKLTAEESAFRDEFCAWLTSNVPKDWTEWREKPIEES
Ga0210402_1116004013300021478SoilMDLKLSREELQFRDELRAWLAANLPRDWGEWREKPIEESFSYLR
Ga0210402_1192789323300021478SoilMDLNLTAEELAFRDELRAWLATNVPKDWNEWREKP
Ga0210409_1010340613300021559SoilMDLNLTAEEKAFRDELRAWLASNVPRDWSEWREKPIE
Ga0210409_1032363913300021559SoilMDLNLTTEELSFRDELRAWLVSNVPKDWNEWREKPIEES
Ga0242662_1031314113300022533SoilMDLNLTAEELAFRDELRAWLASNVPKDWNEWREKPLEE
Ga0208691_111718723300025612PeatlandMDLNLTPEELTFRDELRAWLASNVPKDWKEWREKPMEES
Ga0207692_1078678823300025898Corn, Switchgrass And Miscanthus RhizosphereMDLNLNPAETKFRDELRAWLTANVPKDWDERREESLE
Ga0207692_1088725223300025898Corn, Switchgrass And Miscanthus RhizosphereMDLNLSPDEIKFRDELRSWLAANAPKDWDERREESMESRFEY
Ga0207685_1011056033300025905Corn, Switchgrass And Miscanthus RhizosphereMDLNLSPEEIKFRDELRSWLATNAPKDWDERREES
Ga0207654_1065635623300025911Corn RhizosphereMDLNLSPDEIKFRDELRTWLAANAPSDWDERREESMESRFEYLKRWQRPSTQPA
Ga0207707_1053355913300025912Corn RhizosphereMDLNLSPDEIKFRDELRTWLAANAPTDWDERREESMESRFEYLK
Ga0207707_1101601013300025912Corn RhizosphereMDLNLSPDEIKFRDELRTWLAANAPTDWDERREESMESRFEYL
Ga0207665_1091679823300025939Corn, Switchgrass And Miscanthus RhizosphereMDLNLSPEEIKFRDELRAWLAANVPKDWDERREESLESRF
Ga0257150_106126913300026356SoilMDLNLTPDELQFRDELRSWLATNVPKDWNEWREKPIEES
Ga0257160_108909223300026489SoilMDLNLNAEESAFRDELGAWLASNVPKDWNQWREKP
Ga0257181_103592423300026499SoilMDLNLAAEESAFRDEFRAWLAANAPKDWNEWCEKPLEESFPYL
Ga0209648_1063777733300026551Grasslands SoilMDLNLSADELKFRDELRAWLAANVPKDWDEHREESLEA
Ga0209730_104038823300027034Forest SoilMDLNLTAEELAFRDELRAWLAVNVPRDWNEWREKPLEESFPYL
Ga0209115_100549133300027567Forest SoilMDLNLTKEELSFRDELRAWLANNLPKDWNEWREKP
Ga0209625_100924413300027635Forest SoilMDLKLTPEESSFRDELRAWLATNAPKDWAEWREKPLEESFPYL
Ga0209076_117490813300027643Vadose Zone SoilMDLNLTTEELSFRDELRAWLVSNVPKDWNEWREKPIEESFPY
Ga0209217_104259723300027651Forest SoilMNLNLNAEESTFRDELRLWLASNVPKDWNMWSEKPIEESFAY
Ga0209388_103299513300027655Vadose Zone SoilMDLNLTTEELSFRDELRAWLVSNVPKDWNEWREKPIEESFP
Ga0209118_103536423300027674Forest SoilMDLNLTAEEMAFRDELRAWLASNAPKDWNEWREKPLEESF
Ga0209333_118616223300027676Forest SoilVDLNLTSEEMQFRDELRSWLTANVPTDWAERREES
Ga0209580_1001450913300027842Surface SoilMDLNLSPEEIKFRDELRSWLSANAPTDWDERREESMESRFEYLK
Ga0209166_1025732113300027857Surface SoilMDLNLSPDEIKFRDELRTWLAANAPTDWDERREESMESRFEYLKRWQR
Ga0209701_1048084423300027862Vadose Zone SoilMDLNLTTEELSFRDELRAWLVSNVPKDWNERREKP
Ga0209067_1019440113300027898WatershedsMDLKLTAEELAFRDELRTWLASNVPADWSEGREKP
Ga0302231_1010847613300028775PalsaMDLNLTEQELSFRDELRAWLAANLPKDWSEWREKPI
Ga0302221_1044416723300028806PalsaMDLNLTDEELKFRDELRAWLASNVPKDWKEWREKPM
Ga0311352_1003049713300029944PalsaMDLSLTAEESAFRDQLRAWLASNVPKDWSEWRDKPMEES
Ga0311371_1082726023300029951PalsaMDLNLTPDEKQFRDELRTWLAANTPKDWPEWQNKPLEESYPYL
Ga0302304_1012661313300029993PalsaMDLNLTDEELKFRDELRAWLASNVPKDWKEWREKPMEES
Ga0311370_1087071823300030503PalsaMDLNLTADEKLFRDELRSWLAANAPKDWPAWQNKPLEESYPY
Ga0311355_1072955423300030580PalsaVDLNLTSDEMQFRDELRSWLTANVPADWAERREES
Ga0311355_1101350623300030580PalsaMDLNLTDEELKFRDELRAWLASNVPKDWKEWREKPMEESFP
Ga0170834_10709601413300031057Forest SoilMDLNLTPDEAAFRDELRPWLAANVPKDWSTWREKPLEES
Ga0310686_10128064723300031708SoilMDLNLTPDELQFRDELRSWLATNVPKDWNEWREKPIE
Ga0310686_10858798633300031708SoilMDLNLTAEELTFRDELRAWLASNVPKDWAEWREKPIE
Ga0307476_1017297423300031715Hardwood Forest SoilMDLNLTPEETKFRDELRTWLEANVPKDWGEWREKPLEESFP
Ga0307477_1001361913300031753Hardwood Forest SoilMDLNLTGEEVAFRDEFRSWLGINAPKDWSSWREKPLEESFA
Ga0307477_1023029023300031753Hardwood Forest SoilMDLKLSLEELQFREELRAWLGANLPRDWGEWREKPIEESFP
Ga0318546_1076397123300031771SoilMDLNLTRDEVAFRDELRSWLAANVPEDWSSWREKPLEE
Ga0318548_1016581823300031793SoilMDLNLTREEVAFRDEFRSWLASNVPNDWRRWREKPLEES
Ga0318497_1005500433300031805SoilMDLNLTREEVAFRDEFRSWLASNVPNDWSRWREKPLEE
Ga0310913_1080812513300031945SoilMDLNLTREEAAFRDEFRSWLATNVPRDWSAWREKPLEESF
Ga0306926_1002504613300031954SoilMDLNLTREETAFRDELRAWLAGNVPKDWSSWREKPLAVSFPYLR
Ga0318505_1042327023300032060SoilMDLTLNDEEKEFRNELRAWLEANAPNDWAEWREKPLEESFPYLR
Ga0306920_10013612913300032261SoilMDLNLSADELKFRDELRAWLAANVPKDWNEHREESLEV
Ga0335085_1102583613300032770SoilMDLNLTTEEKQFRDELRAWLEANVPKDWGEWREKP
Ga0335079_1057189823300032783SoilMDLNLSAEEREFRDEFRGWLEANVPKDWPVWREKPLEESF
Ga0335079_1081970223300032783SoilMDLNLSPDELKFRDELRAWLETNVPREWDEAREESLD
Ga0335079_1123297113300032783SoilMDLNLNAEERQFRDELRAWLEANTPKDWSDWREKPLE
Ga0335078_1264220223300032805SoilMDLNLNAEELAFRGELRAWLEANVPKDWREWREKPLEE
Ga0335080_1209885623300032828SoilMDLNLNAEERQFRDELRAWLEANTPKDWSDWREKPLEES
Ga0310914_1088796623300033289SoilMDLKLTTEELAFRNELRAWLEANIPTDWSEWREKPLDESF


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.